Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
HYAP_01510408471381387191e-98
PPTG_02121972912221303163e-36
PHYRA_7241556986655893231e-34
PHYCA_10442940847645893231e-34
PHYRA_724639262658893231e-34
PHYKE_698456986450893163e-34
PHALS_0133830017383893116e-34
PHYCA_1044659267653893178e-34
PHYCA_10433569035656893179e-34
PITG_112449262663893179e-34
PHYSO_48001056986653893161e-33
PPTG_021229262657893152e-33
PHYSO_4856149267653893124e-33
PITG_1124792656531303124e-33
PPTG_1672792702171002955e-33
PITG_1124992676531303125e-33
PHYSO_4860859265653893081e-32
HYAP_0154075345634813045e-32
PYIR_158599262626813036e-32
PHYSO_34470592627981303047e-32
PYVX_156419262629893028e-32
PHYKE_70169270650893029e-32
H310_0260441593312832929e-32
PHALS_04330314037851303011e-31
PHALS_0980292706511003012e-31
PHYSO_48279392706581303002e-31
PYIW_1687692626431302993e-31
PYAP_1733497291650892984e-31
PYU1_G0139319262663752984e-31
PPTG_19690248375661302957e-31
HYAP_015379270651822951e-30
PYU1_G01392797291649892931e-30
H310_02610148347650832932e-30
CCI43221160520660832932e-30
SDRG_114731221156361302895e-30
H257_17322148347606832879e-30
CCA149671520391431832862e-29
SDRG_118999267652812852e-29
SPRG_045339267652812852e-29
PITG_1125292706541302852e-29
PHYRA_7165592706531222842e-29
SPRG_000681221156431302825e-29
PYVX_2298180377612752791e-28
H257_129589267649832782e-28
PHYCA_1044449270644742763e-28
H310_095579267644832754e-28
PHYRA_41888687195861222745e-28
CCI402499267660832702e-27
PYAP_19235994396431222693e-27
PYAP_173339262657832684e-27
CCA161539267663832605e-26
CCI40247152456643742306e-22
PYAR_1448756986467612234e-21
CCA16151152456643742219e-21
PYIR_15857972915771462219e-21
H257_188859761786992201e-20
H257_00007127542787992164e-20
PYIW_22144849376331302131e-19
PYIR_24387849376331302121e-19
PYAP_2223884937633912112e-19
SPRG_10519127542782992103e-19
SDRG_057779761786992103e-19
PYVX_1812197616331222085e-19
PHYRA_5190440847129541955e-19
CCI4609197617871222086e-19
H310_14759127542787992069e-19
PYAR_19807926216131092069e-19
PYU1_G001540849376331302051e-18
CCA2082897617871222042e-18
HYAP_126609761786992042e-18
PHYCA_53291256986626652032e-18
PPTG_0312197617861222015e-18
PHYKE_108159761786912015e-18
PHYSO_339667525751601201905e-18
PITG_1191397617861222006e-18
PHYCA_50982097617861221972e-17
PHYRA_7819397617861221962e-17
SDRG_057781275266181301953e-17
SPRG_1047797617621301935e-17
PHALS_0207997617861221935e-17
PHYRA_7223869419601741873e-16
SPRG_00333478615981785e-15
PYAP_13341478657741751e-14
PYIR_1673893996555741733e-14
HYAP_01005478660811733e-14
HYAP_0100493996660811733e-14
PYIW_21755478658741723e-14
PYAR_183544781084741723e-14
SDRG_03564478658921723e-14
H310_09434478658741724e-14
PHYSO_525429598456101161714e-14
PHYSO_286376478660741706e-14
PYVX_16738478658811707e-14
PITG_00527478656741698e-14
PYU1_G00409793996663741699e-14
PYIW_26567165855564741691e-13
PPTG_08245478658741681e-13
PHYKE_7992478657811681e-13
PHYCA_510696478659741672e-13
PHALS_00833478652741653e-13
PHYRA_71042478654531644e-13
PHYSO_5252361275422461021615e-13
PYU1_G004098478656741635e-13
CCA249364786611031601e-12
CCI50234478665741583e-12
PHYSO_33966669419585741573e-12
PYAR_24687105882618571478e-11
PHALS_0761612728677421424e-10
SPRG_0229412728634421415e-10
SDRG_1104312728649421415e-10
H310_0663112728651461406e-10
CCI4598212728661421407e-10
H257_0127712728652461407e-10
PYVX_1505112728632421398e-10
CCA2151412728659421391e-09
PHYSO_50048012728633421391e-09
PYAP_1973812728648421391e-09
PYU1_G00375412728650421372e-09
PPTG_1827412728648421372e-09
PHYRA_7112312728633421353e-09
PYIR_1969712728608421353e-09
PHYCA_54113412728633421353e-09
PITG_1578612728633421354e-09
PHYKE_900812728650421354e-09
PPTG_1708323795304381344e-09
PYAR_2218812728634421344e-09
PPTG_0405431403324381301e-08
PYIR_16737478511341273e-08
SPRG_001831221796091131258e-08
SDRG_05816127542479421231e-07
SPRG_156953097581931231e-07
PHYRA_7905413310563531222e-07
SDRG_100383097565931222e-07
PYIR_13638133105431161194e-07
PYU1_G002895133105611051186e-07
PYIW_1732013310563751178e-07
PYAP_1990313310527481161e-06
H257_0168013310571661151e-06
SDRG_1662113310531791133e-06
H310_0391113310570681124e-06
PYAR_1457913310567731124e-06
SPRG_0125513310566641115e-06
CCA2230513310561441107e-06
PPTG_0581913310561531108e-06
PHYSO_49338113310562531108e-06
PHYCA_645813310560531081e-05
PHYKE_707713310631691062e-05
PHALS_0269213310557551062e-05
CCI4526113310558491062e-05
HYAP_0185713310492531053e-05
PPTG_2266227245362251044e-05
PYIR_25979861144381261044e-05
HYAP_0185661895289531044e-05
PHYSO_5521163097570841044e-05
PPTG_1828024246384831045e-05
PITG_1652813310561551035e-05
PHYSO_32156516776697891028e-05
PHYRA_715913097570951011e-04
PYU1_G00885145764795751011e-04
PHYCA_50411412714887711002e-04
PYIR_24123309756789992e-04
PITG_03546309756984992e-04
PYVX_136151331058547982e-04
H310_12765309756089983e-04
HYAP_079181271489769974e-04
PPTG_10122309756984965e-04
PITG_157711271488383965e-04
SPRG_1113312787367673957e-04
PHYRA_736611271488471958e-04
PITG_030682664638106930.001
HYAP_01993309756984920.002
PHYCA_5322073097111867930.002
PYVX_1711749565103546920.002
PHYKE_90111271490253920.002
PHYSO_25550612714122869920.002
PYU1_G00089686114711123920.002
PYIW_14231861141243123920.002
PYU1_G006940309756589910.003
PITG_2158016776658120900.003
H257_07650309756387900.003
SDRG_1712212787336153890.004
PHALS_084981271489571890.005
PYIW_191653097112489880.006
PHALS_00390309756966870.010
PPTG_09610211695339800.010
PHYCA_1117404159381075850.015
PYAP_197411271488570850.018
PYVX_132884576481075840.023
PPTG_230392758211539800.026
PYVX_150611271489146830.026
PHYSO_2499024593213047800.030
H310_0622912615180076830.032
CCA215191271492962820.035
PYIR_183814576474775820.037
SPRG_0806012615179394820.039
PHYSO_2475174576479475820.042
PYIW_196764576466475810.049
PYU1_G0037641271491054810.050
PPTG_193754576480975810.055
SDRG_0326612615179282810.060
PHYKE_64309756993810.060
PYAP_16216309756489800.061
SDRG_018281271486669800.066
SPRG_062881271486969800.072
PYAP_186434576480475790.085
PYIR_242201271490842790.096
H257_1648412615179575790.10
CCA1591315237085775780.12
H257_002871271489370780.14
PYVX_184501393038641780.14
PHYRA_825454576480675780.14
PHYKE_66644576480475770.17
PHALS_040954576480375770.17
HYAP_044604576481875770.20
PHYRA_79746105666561770.21
PHYRA_797514433866561760.22
PYAR_154684576476975760.26
H310_0149314814890978760.27
H310_014961271490478760.28
CCI4670915237081975750.32
CCI459871271493958750.32
PITG_173831393043853750.35
PHALS_092811393046598740.41
CCI475823097582101730.58
PITG_01195105666661711.0
PHYCA_1208451393044466691.7
PYIW_233171266876646691.9
PYU1_G0068431393048147691.9
PPTG_22091267265339632.1
PPTG_05521196535339632.1
PPTG_107002155915016663.5
PHYCA_528722105665961674.2
PHYRA_478736903539623665.2
PHALS_01890105649361665.4
PHYKE_51105666361656.8
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= HYAP_01510

Length=138
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

HYAP_01510                                                            281        1e-98
PPTG_02121                                                            126        3e-36
PHYRA_72415                                                           129        1e-34
PHYCA_104429                                                          129        1e-34
PHYRA_72463                                                           129        1e-34
PHYKE_6984                                                            126        3e-34
PHALS_01338                                                           124        6e-34
PHYCA_104465                                                          126        8e-34
PHYCA_104335                                                          126        9e-34
PITG_11244                                                            126        9e-34
PHYSO_480010                                                          126        1e-33
PPTG_02122                                                            125        2e-33
PHYSO_485614                                                          124        4e-33
PITG_11247                                                            124        4e-33
PPTG_16727                                                            118        5e-33
PITG_11249                                                            124        5e-33
PHYSO_486085                                                          123        1e-32
HYAP_01540                                                            121        5e-32
PYIR_15859                                                            121        6e-32
PHYSO_344705                                                          121        7e-32
PYVX_15641                                                            120        8e-32
PHYKE_7016                                                            120        9e-32
H310_02604                                                            117        9e-32
PHALS_04330                                                           120        1e-31
PHALS_09802                                                           120        2e-31
PHYSO_482793                                                          120        2e-31
PYIW_16876                                                            119        3e-31
PYAP_17334                                                            119        4e-31
PYU1_G013931                                                          119        4e-31
PPTG_19690                                                            118        7e-31
HYAP_01537                                                            118        1e-30
PYU1_G013927                                                          117        1e-30
H310_02610                                                            117        2e-30
CCI43221                                                              117        2e-30
SDRG_11473                                                            115        5e-30
H257_17322                                                            115        9e-30
CCA14967                                                              114        2e-29
SDRG_11899                                                            114        2e-29
SPRG_04533                                                            114        2e-29
PITG_11252                                                            114        2e-29
PHYRA_71655                                                           114        2e-29
SPRG_00068                                                            113        5e-29
PYVX_22981                                                            112        1e-28
H257_12958                                                            111        2e-28
PHYCA_104444                                                          110        3e-28
H310_09557                                                            110        4e-28
PHYRA_41888                                                           110        5e-28
CCI40249                                                              108        2e-27
PYAP_19235                                                            108        3e-27
PYAP_17333                                                            107        4e-27
CCA16153                                                              104        5e-26
CCI40247                                                              93.2       6e-22
PYAR_14487                                                            90.5       4e-21
CCA16151                                                              89.7       9e-21
PYIR_15857                                                            89.7       9e-21
H257_18885                                                            89.4       1e-20
H257_00007                                                            87.8       4e-20
PYIW_22144                                                            86.7       1e-19
PYIR_24387                                                            86.3       1e-19
PYAP_22238                                                            85.9       2e-19
SPRG_10519                                                            85.5       3e-19
SDRG_05777                                                            85.5       3e-19
PYVX_18121                                                            84.7       5e-19
PHYRA_51904                                                           79.7       5e-19
CCI46091                                                              84.7       6e-19
H310_14759                                                            84.0       9e-19
PYAR_19807                                                            84.0       9e-19
PYU1_G001540                                                          83.6       1e-18
CCA20828                                                              83.2       2e-18
HYAP_12660                                                            83.2       2e-18
PHYCA_532912                                                          82.8       2e-18
PPTG_03121                                                            82.0       5e-18
PHYKE_10815                                                           82.0       5e-18
PHYSO_339667                                                          77.8       5e-18
PITG_11913                                                            81.6       6e-18
PHYCA_509820                                                          80.5       2e-17
PHYRA_78193                                                           80.1       2e-17
SDRG_05778                                                            79.7       3e-17
SPRG_10477                                                            79.0       5e-17
PHALS_02079                                                           79.0       5e-17
PHYRA_72238                                                           76.6       3e-16
SPRG_00333                                                            73.2       5e-15
PYAP_13341                                                            72.0       1e-14
PYIR_16738                                                            71.2       3e-14
HYAP_01005                                                            71.2       3e-14
HYAP_01004                                                            71.2       3e-14
PYIW_21755                                                            70.9       3e-14
PYAR_18354                                                            70.9       3e-14
SDRG_03564                                                            70.9       3e-14
H310_09434                                                            70.9       4e-14
PHYSO_525429                                                          70.5       4e-14
PHYSO_286376                                                          70.1       6e-14
PYVX_16738                                                            70.1       7e-14
PITG_00527                                                            69.7       8e-14
PYU1_G004097                                                          69.7       9e-14
PYIW_26567                                                            69.7       1e-13
PPTG_08245                                                            69.3       1e-13
PHYKE_7992                                                            69.3       1e-13
PHYCA_510696                                                          68.9       2e-13
PHALS_00833                                                           68.2       3e-13
PHYRA_71042                                                           67.8       4e-13
PHYSO_525236                                                          66.6       5e-13
PYU1_G004098                                                          67.4       5e-13
CCA24936                                                              66.2       1e-12
CCI50234                                                              65.5       3e-12
PHYSO_339666                                                          65.1       3e-12
PYAR_24687                                                            61.2       8e-11
PHALS_07616                                                           59.3       4e-10
SPRG_02294                                                            58.9       5e-10
SDRG_11043                                                            58.9       5e-10
H310_06631                                                            58.5       6e-10
CCI45982                                                              58.5       7e-10
H257_01277                                                            58.5       7e-10
PYVX_15051                                                            58.2       8e-10
CCA21514                                                              58.2       1e-09
PHYSO_500480                                                          58.2       1e-09
PYAP_19738                                                            58.2       1e-09
PYU1_G003754                                                          57.4       2e-09
PPTG_18274                                                            57.4       2e-09
PHYRA_71123                                                           56.6       3e-09
PYIR_19697                                                            56.6       3e-09
PHYCA_541134                                                          56.6       3e-09
PITG_15786                                                            56.6       4e-09
PHYKE_9008                                                            56.6       4e-09
PPTG_17083                                                            56.2       4e-09
PYAR_22188                                                            56.2       4e-09
PPTG_04054                                                            54.7       1e-08
PYIR_16737                                                            53.5       3e-08
SPRG_00183                                                            52.8       8e-08
SDRG_05816                                                            52.0       1e-07
SPRG_15695                                                            52.0       1e-07
PHYRA_79054                                                           51.6       2e-07
SDRG_10038                                                            51.6       2e-07
PYIR_13638                                                            50.4       4e-07
PYU1_G002895                                                          50.1       6e-07
PYIW_17320                                                            49.7       8e-07
PYAP_19903                                                            49.3       1e-06
H257_01680                                                            48.9       1e-06
SDRG_16621                                                            48.1       3e-06
H310_03911                                                            47.8       4e-06
PYAR_14579                                                            47.8       4e-06
SPRG_01255                                                            47.4       5e-06
CCA22305                                                              47.0       7e-06
PPTG_05819                                                            47.0       8e-06
PHYSO_493381                                                          47.0       8e-06
PHYCA_6458                                                            46.2       1e-05
PHYKE_7077                                                            45.4       2e-05
PHALS_02692                                                           45.4       2e-05
CCI45261                                                              45.4       2e-05
HYAP_01857                                                            45.1       3e-05
PPTG_22662                                                            44.7       4e-05
PYIR_25979                                                            44.7       4e-05
HYAP_01856                                                            44.7       4e-05
PHYSO_552116                                                          44.7       4e-05
PPTG_18280                                                            44.7       5e-05
PITG_16528                                                            44.3       5e-05
PHYSO_321565                                                          43.9       8e-05
PHYRA_71591                                                           43.5       1e-04
PYU1_G008851                                                          43.5       1e-04
PHYCA_504114                                                          43.1       2e-04
PYIR_24123                                                            42.7       2e-04
PITG_03546                                                            42.7       2e-04
PYVX_13615                                                            42.4       2e-04
H310_12765                                                            42.4       3e-04
HYAP_07918                                                            42.0       4e-04
PPTG_10122                                                            41.6       5e-04
PITG_15771                                                            41.6       5e-04
SPRG_11133                                                            41.2       7e-04
PHYRA_73661                                                           41.2       8e-04
PITG_03068                                                            40.4       0.001
HYAP_01993                                                            40.0       0.002
PHYCA_532207                                                          40.4       0.002
PYVX_17117                                                            40.0       0.002
PHYKE_9011                                                            40.0       0.002
PHYSO_255506                                                          40.0       0.002
PYU1_G000896                                                          40.0       0.002
PYIW_14231                                                            40.0       0.002
PYU1_G006940                                                          39.7       0.003
PITG_21580                                                            39.3       0.003
H257_07650                                                            39.3       0.003
SDRG_17122                                                            38.9       0.004
PHALS_08498                                                           38.9       0.005
PYIW_19165                                                            38.5       0.006
PHALS_00390                                                           38.1       0.010
PPTG_09610                                                            35.4       0.010
PHYCA_111740                                                          37.4       0.015
PYAP_19741                                                            37.4       0.018
PYVX_13288                                                            37.0       0.023
PPTG_23039                                                            35.4       0.026
PYVX_15061                                                            36.6       0.026
PHYSO_249902                                                          35.4       0.030
H310_06229                                                            36.6       0.032
CCA21519                                                              36.2       0.035
PYIR_18381                                                            36.2       0.037
SPRG_08060                                                            36.2       0.039
PHYSO_247517                                                          36.2       0.042
PYIW_19676                                                            35.8       0.049
PYU1_G003764                                                          35.8       0.050
PPTG_19375                                                            35.8       0.055
SDRG_03266                                                            35.8       0.060
PHYKE_64                                                              35.8       0.060
PYAP_16216                                                            35.4       0.061
SDRG_01828                                                            35.4       0.066
SPRG_06288                                                            35.4       0.072
PYAP_18643                                                            35.0       0.085
PYIR_24220                                                            35.0       0.096
H257_16484                                                            35.0       0.10 
CCA15913                                                              34.7       0.12 
H257_00287                                                            34.7       0.14 
PYVX_18450                                                            34.7       0.14 
PHYRA_82545                                                           34.7       0.14 
PHYKE_6664                                                            34.3       0.17 
PHALS_04095                                                           34.3       0.17 
HYAP_04460                                                            34.3       0.20 
PHYRA_79746                                                           34.3       0.21 
PHYRA_79751                                                           33.9       0.22 
PYAR_15468                                                            33.9       0.26 
H310_01493                                                            33.9       0.27 
H310_01496                                                            33.9       0.28 
CCI46709                                                              33.5       0.32 
CCI45987                                                              33.5       0.32 
PITG_17383                                                            33.5       0.35 
PHALS_09281                                                           33.1       0.41 
CCI47582                                                              32.7       0.58 
PITG_01195                                                            32.0       1.0  
PHYCA_120845                                                          31.2       1.7  
PYIW_23317                                                            31.2       1.9  
PYU1_G006843                                                          31.2       1.9  
PPTG_22091                                                            28.9       2.1  
PPTG_05521                                                            28.9       2.1  
PPTG_10700                                                            30.0       3.5  
PHYCA_528722                                                          30.4       4.2  
PHYRA_47873                                                           30.0       5.2  
PHALS_01890                                                           30.0       5.4  
PHYKE_51                                                              29.6       6.8  

>HYAP_01510
Length=138

 Score = 281 bits (719),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 138/138 (100%), Positives = 138/138 (100%), Gaps = 0/138 (0%)

Query  1    MFNVTKSSFLAGQQPKRSSKGRSIASIGNTLINVLIKKEASLVLQANVKHWPLKLTSVAS  60
            MFNVTKSSFLAGQQPKRSSKGRSIASIGNTLINVLIKKEASLVLQANVKHWPLKLTSVAS
Sbjct  1    MFNVTKSSFLAGQQPKRSSKGRSIASIGNTLINVLIKKEASLVLQANVKHWPLKLTSVAS  60

Query  61   NRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQRTLS  120
            NRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQRTLS
Sbjct  61   NRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQRTLS  120

Query  121  SLAQAYIEGNSKYTNIYF  138
            SLAQAYIEGNSKYTNIYF
Sbjct  121  SLAQAYIEGNSKYTNIYF  138

>PPTG_02121
Length=222

 Score = 126 bits (316),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 91/130 (70%), Gaps = 7/130 (5%)

Query  3    NVTKSSFLAGQQPKR----SSKGRSIASIGNTLIN---VLIKKEASLVLQANVKHWPLKL  55
            N T  S++A    +R    ++K +   +  NT+ +   ++ +K +  ++QA++KHWP K+
Sbjct  38   NRTTPSYVAFTDSERLIGDAAKNQVAMNAANTVFDAKRLIGRKFSDPIVQADIKHWPFKI  97

Query  56   TSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDL  115
            TS   ++ QITVQFK ES TFQP EISSMVLIKMRE+AEA+IGK+VKNAV+TVPAYFND 
Sbjct  98   TSGPGDKPQITVQFKGESKTFQPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDS  157

Query  116  QRTLSSLAQA  125
            QR  +  A A
Sbjct  158  QRQATKDAGA  167

>PHYRA_72415
Length=655

 Score = 129 bits (323),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 73/89 (82%), Gaps = 0/89 (0%)

Query  37   KKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAY  96
            +K +  ++QA++KHWP KLTS A ++ QITVQFK ES TFQP EISSMVLIKMRE+AEA+
Sbjct  80   RKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMREVAEAF  139

Query  97   IGKQVKNAVMTVPAYFNDLQRTLSSLAQA  125
            IGK+VKNAV+TVPAYFND QR  +  A A
Sbjct  140  IGKEVKNAVITVPAYFNDSQRQATKDAGA  168

>PHYCA_104429
Length=645

 Score = 129 bits (323),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 73/89 (82%), Gaps = 0/89 (0%)

Query  37   KKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAY  96
            +K +  ++QA++KHWP KLTS A ++ QITVQFK ES TFQP EISSMVLIKMRE+AEA+
Sbjct  79   RKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMREVAEAF  138

Query  97   IGKQVKNAVMTVPAYFNDLQRTLSSLAQA  125
            IGK+VKNAV+TVPAYFND QR  +  A A
Sbjct  139  IGKEVKNAVITVPAYFNDSQRQATKDAGA  167

>PHYRA_72463
Length=658

 Score = 129 bits (323),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 73/89 (82%), Gaps = 0/89 (0%)

Query  37   KKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAY  96
            +K +  ++QA++KHWP KLTS A ++ QITVQFK ES TFQP EISSMVLIKMRE+AEA+
Sbjct  80   RKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMREVAEAF  139

Query  97   IGKQVKNAVMTVPAYFNDLQRTLSSLAQA  125
            IGK+VKNAV+TVPAYFND QR  +  A A
Sbjct  140  IGKEVKNAVITVPAYFNDSQRQATKDAGA  168

>PHYKE_6984
Length=450

 Score = 126 bits (316),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 73/89 (82%), Gaps = 0/89 (0%)

Query  37   KKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAY  96
            +K +  ++Q+++KHWP KL+S A ++ QITVQFK ES TFQP EISSMVLIKMRE+AEA+
Sbjct  81   RKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMREVAEAF  140

Query  97   IGKQVKNAVMTVPAYFNDLQRTLSSLAQA  125
            IGK+VKNAV+TVPAYFND QR  +  A A
Sbjct  141  IGKEVKNAVITVPAYFNDSQRQATKDAGA  169

>PHALS_01338
Length=383

 Score = 124 bits (311),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 72/89 (81%), Gaps = 0/89 (0%)

Query  37   KKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAY  96
            +K +  V++A++KHWP K+T+   ++ QITVQFK E+ TFQP EISSMVLIKMRE+AEAY
Sbjct  79   RKYSDPVVKADIKHWPFKVTAGPGDKPQITVQFKGETKTFQPEEISSMVLIKMREVAEAY  138

Query  97   IGKQVKNAVMTVPAYFNDLQRTLSSLAQA  125
            IGK+VKNAV+TVPAYFND QR  +  A A
Sbjct  139  IGKEVKNAVITVPAYFNDSQRQATKDAGA  167

>PHYCA_104465
Length=653

 Score = 126 bits (317),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 73/89 (82%), Gaps = 0/89 (0%)

Query  37   KKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAY  96
            +K +  V+QA++KHWP ++TS A ++ QITVQFK ES TFQP EISSMVLIKMRE+AEA+
Sbjct  80   RKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMREVAEAF  139

Query  97   IGKQVKNAVMTVPAYFNDLQRTLSSLAQA  125
            IGK+VKNAV+TVPAYFND QR  +  A A
Sbjct  140  IGKEVKNAVITVPAYFNDSQRQATKDAGA  168

>PHYCA_104335
Length=656

 Score = 126 bits (317),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 73/89 (82%), Gaps = 0/89 (0%)

Query  37   KKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAY  96
            +K +  V+QA++KHWP ++TS A ++ QITVQFK ES TFQP EISSMVLIKMRE+AEA+
Sbjct  80   RKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMREVAEAF  139

Query  97   IGKQVKNAVMTVPAYFNDLQRTLSSLAQA  125
            IGK+VKNAV+TVPAYFND QR  +  A A
Sbjct  140  IGKEVKNAVITVPAYFNDSQRQATKDAGA  168

>PITG_11244
Length=663

 Score = 126 bits (317),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 73/89 (82%), Gaps = 0/89 (0%)

Query  37   KKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAY  96
            +K +  ++QA++KHWP K+T+ A ++ QITVQFK ES TFQP EISSMVLIKMRE+AEA+
Sbjct  79   RKFSDPIVQADIKHWPFKITAGAGDKPQITVQFKGESKTFQPEEISSMVLIKMREVAEAF  138

Query  97   IGKQVKNAVMTVPAYFNDLQRTLSSLAQA  125
            IGK+VKNAV+TVPAYFND QR  +  A A
Sbjct  139  IGKEVKNAVITVPAYFNDSQRQATKDAGA  167

>PHYSO_480010
Length=653

 Score = 126 bits (316),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 73/89 (82%), Gaps = 0/89 (0%)

Query  37   KKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAY  96
            +K +  ++QA++KHWP K++S A ++ QITVQFK ES TFQP EISSMVLIKMRE+AEA+
Sbjct  79   RKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMREVAEAF  138

Query  97   IGKQVKNAVMTVPAYFNDLQRTLSSLAQA  125
            IGK+VKNAV+TVPAYFND QR  +  A A
Sbjct  139  IGKEVKNAVITVPAYFNDSQRQATKDAGA  167

>PPTG_02122
Length=657

 Score = 125 bits (315),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 72/89 (81%), Gaps = 0/89 (0%)

Query  37   KKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAY  96
            +K +  ++QA++KHWP K+TS   ++ QITVQFK ES TFQP EISSMVLIKMRE+AEA+
Sbjct  79   RKFSDPIVQADIKHWPFKITSGPGDKPQITVQFKGESKTFQPEEISSMVLIKMREVAEAF  138

Query  97   IGKQVKNAVMTVPAYFNDLQRTLSSLAQA  125
            IGK+VKNAV+TVPAYFND QR  +  A A
Sbjct  139  IGKEVKNAVITVPAYFNDSQRQATKDAGA  167

>PHYSO_485614
Length=653

 Score = 124 bits (312),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 72/89 (81%), Gaps = 0/89 (0%)

Query  37   KKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAY  96
            +K +  V+QA++KHWP K++S   ++ QITVQFK ES TFQP EISSMVLIKMRE+AEA+
Sbjct  79   RKFSDPVVQADIKHWPFKISSGPGDKPQITVQFKGESKTFQPEEISSMVLIKMREVAEAF  138

Query  97   IGKQVKNAVMTVPAYFNDLQRTLSSLAQA  125
            IGK+VKNAV+TVPAYFND QR  +  A A
Sbjct  139  IGKEVKNAVITVPAYFNDSQRQATKDAGA  167

>PITG_11247
Length=653

 Score = 124 bits (312),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 91/130 (70%), Gaps = 7/130 (5%)

Query  3    NVTKSSFLAGQQPKR----SSKGRSIASIGNTLIN---VLIKKEASLVLQANVKHWPLKL  55
            N T  S++A    +R    ++K +   +  NT+ +   ++ +K +  V+QA++KHWP K+
Sbjct  38   NRTTPSYVAFTDSERLIGDAAKNQVAMNAANTVFDAKRLIGRKFSDPVVQADIKHWPFKI  97

Query  56   TSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDL  115
            T+   ++ QITVQFK E+ TFQP EISSMVLIKMRE+AEA+IGK+VKNAV+TVPAYFND 
Sbjct  98   TAGPGDKPQITVQFKGETKTFQPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDS  157

Query  116  QRTLSSLAQA  125
            QR  +  A A
Sbjct  158  QRQATKDAGA  167

>PPTG_16727
Length=217

 Score = 118 bits (295),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 73/100 (73%), Gaps = 3/100 (3%)

Query  29   NTLINV---LIKKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMV  85
            NT+ +V   + +K     +Q+++KHWP K+   A N+ Q+ VQFK ES TFQP EISSMV
Sbjct  68   NTVFDVKRLIGRKFTDPEVQSDIKHWPFKVVRGAENKPQLVVQFKGESKTFQPEEISSMV  127

Query  86   LIKMREIAEAYIGKQVKNAVMTVPAYFNDLQRTLSSLAQA  125
            LIKMRE+AEA+IGK VKNAV+TVPAYFND QR  +  A A
Sbjct  128  LIKMREVAEAFIGKHVKNAVVTVPAYFNDSQRQATKDAGA  167

>PITG_11249
Length=653

 Score = 124 bits (312),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 91/130 (70%), Gaps = 7/130 (5%)

Query  3    NVTKSSFLAGQQPKR----SSKGRSIASIGNTLIN---VLIKKEASLVLQANVKHWPLKL  55
            N T  S++A    +R    ++K +   +  NT+ +   ++ +K +  V+QA++KHWP K+
Sbjct  38   NRTTPSYVAFTDSERLIGDAAKNQVAMNAANTVFDAKRLIGRKFSDPVVQADIKHWPFKI  97

Query  56   TSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDL  115
            T+   ++ QITVQFK E+ TFQP EISSMVLIKMRE+AEA+IGK+VKNAV+TVPAYFND 
Sbjct  98   TAGPGDKPQITVQFKGETKTFQPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDS  157

Query  116  QRTLSSLAQA  125
            QR  +  A A
Sbjct  158  QRQATKDAGA  167

>PHYSO_486085
Length=653

 Score = 123 bits (308),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 72/89 (81%), Gaps = 0/89 (0%)

Query  37   KKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAY  96
            +K +  V+QA+++HWP K++S   ++ QITVQFK ES TFQP EISSMVLIKMRE+AEA+
Sbjct  79   RKFSDPVVQADIQHWPFKISSGPGDKPQITVQFKGESKTFQPEEISSMVLIKMREVAEAF  138

Query  97   IGKQVKNAVMTVPAYFNDLQRTLSSLAQA  125
            IGK+VKNAV+TVPAYFND QR  +  A A
Sbjct  139  IGKEVKNAVITVPAYFNDSQRQATKDAGA  167

>HYAP_01540
Length=634

 Score = 121 bits (304),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 68/81 (84%), Gaps = 0/81 (0%)

Query  37   KKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAY  96
            +K +  V+QA+VKHWP KLTS A ++ QITVQFK ES TFQ  EISSMVLIKMRE+AEA+
Sbjct  61   RKFSDAVVQADVKHWPFKLTSGAGDKPQITVQFKGESKTFQSEEISSMVLIKMREVAEAF  120

Query  97   IGKQVKNAVMTVPAYFNDLQR  117
            +GK+VK AV+TVPAYFND QR
Sbjct  121  MGKEVKKAVITVPAYFNDSQR  141

>PYIR_15859
Length=626

 Score = 121 bits (303),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 69/81 (85%), Gaps = 0/81 (0%)

Query  37   KKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAY  96
            +K +  ++QA++KHWP K++  A ++ QITV+FK E+ TFQP EISSMVLIKM+EI+EAY
Sbjct  83   RKFSDPIVQADIKHWPFKVSPGAGDKPQITVEFKGETKTFQPEEISSMVLIKMKEISEAY  142

Query  97   IGKQVKNAVMTVPAYFNDLQR  117
            IGKQVKNAV+TVPAYFND QR
Sbjct  143  IGKQVKNAVITVPAYFNDSQR  163

>PHYSO_344705
Length=798

 Score = 121 bits (304),  Expect = 7e-32, Method: Composition-based stats.
 Identities = 66/130 (51%), Positives = 92/130 (71%), Gaps = 7/130 (5%)

Query  3    NVTKSSFLAGQQPKR----SSKGRSIASIGNTLIN---VLIKKEASLVLQANVKHWPLKL  55
            N T  S++A    +R    ++K +   +  NT+ +   ++ +K +  ++QA++KHWP K+
Sbjct  179  NRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKI  238

Query  56   TSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDL  115
            +S A ++ QITVQFK ES TFQP EISSMVLIKMRE+AEA+IGK+VKNAV+TVPAYFND 
Sbjct  239  SSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDS  298

Query  116  QRTLSSLAQA  125
            QR  +  A A
Sbjct  299  QRQATKDAGA  308

>PYVX_15641
Length=629

 Score = 120 bits (302),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 70/89 (79%), Gaps = 0/89 (0%)

Query  37   KKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAY  96
            +K +  ++Q+++KHWP  LTS   ++ QI VQFK ES TFQP EISSMVLIKMRE+AEA+
Sbjct  79   RKFSDPIVQSDIKHWPFTLTSGPGDKPQIQVQFKGESKTFQPEEISSMVLIKMREVAEAF  138

Query  97   IGKQVKNAVMTVPAYFNDLQRTLSSLAQA  125
            IGK+VKNAV+TVPAYFND QR  +  A A
Sbjct  139  IGKEVKNAVITVPAYFNDSQRQATKDAGA  167

>PHYKE_7016
Length=650

 Score = 120 bits (302),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 69/89 (78%), Gaps = 0/89 (0%)

Query  37   KKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAY  96
            +K + L +Q+++KHWP K+     N+ Q+ VQFK ES TFQP EISSMVLIKMRE+AEA+
Sbjct  80   RKFSDLEVQSDIKHWPFKVVRGPDNKPQVVVQFKGESKTFQPEEISSMVLIKMREVAEAF  139

Query  97   IGKQVKNAVMTVPAYFNDLQRTLSSLAQA  125
            IGKQVKNAV+TVPAYFND QR  +  A A
Sbjct  140  IGKQVKNAVVTVPAYFNDSQRQATKDAGA  168

>H310_02604
Length=312

 Score = 117 bits (292),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 66/83 (80%), Gaps = 0/83 (0%)

Query  43   VLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVK  102
            V+QA++KHWP K+T  A ++ QITV+FK E+ TFQP EISSMVLIKM+E++EAYIG  V 
Sbjct  84   VIQADIKHWPFKVTPGAGDKPQITVEFKGETKTFQPEEISSMVLIKMKEVSEAYIGSTVN  143

Query  103  NAVMTVPAYFNDLQRTLSSLAQA  125
            NAV+TVPAYFND QR  +  A A
Sbjct  144  NAVITVPAYFNDSQRQATKDAGA  166

>PHALS_04330
Length=785

 Score = 120 bits (301),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 66/130 (51%), Positives = 91/130 (70%), Gaps = 7/130 (5%)

Query  3    NVTKSSFLAGQQPKR----SSKGRSIASIGNTLIN---VLIKKEASLVLQANVKHWPLKL  55
            N T  S++A    +R    ++K +   +  NT+ +   ++ +K +  ++QA++KHWP K+
Sbjct  38   NRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTVFDAKRLIGRKFSDPLVQADIKHWPFKV  97

Query  56   TSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDL  115
            TS A ++ QI VQFK ES TFQP EISSMVLIKMRE+AEA+IGK+VKNAV+TVPAYFND 
Sbjct  98   TSGAGDKPQIVVQFKGESKTFQPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDS  157

Query  116  QRTLSSLAQA  125
            QR  +  A A
Sbjct  158  QRQATKDAGA  167

>PHALS_09802
Length=651

 Score = 120 bits (301),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 74/100 (74%), Gaps = 3/100 (3%)

Query  29   NTLINV---LIKKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMV  85
            NT+ +V   + +K A   +Q+++KHWP K+     N+ Q+ VQFK ES TFQP EISSMV
Sbjct  68   NTVFDVKRLIGRKFADSEVQSDIKHWPFKVVCGPENKPQVVVQFKGESKTFQPEEISSMV  127

Query  86   LIKMREIAEAYIGKQVKNAVMTVPAYFNDLQRTLSSLAQA  125
            LIKMREIAEA+IGKQV+NAV+TVPAYFND QR  +  A A
Sbjct  128  LIKMREIAEAFIGKQVRNAVVTVPAYFNDSQRQATKDAGA  167

>PHYSO_482793
Length=658

 Score = 120 bits (300),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 86/130 (66%), Gaps = 7/130 (5%)

Query  3    NVTKSSFLAGQQPKR----SSKGRSIASIGNTLINV---LIKKEASLVLQANVKHWPLKL  55
            N T  S++A    +R    ++K +   +  NT+ +V   + +K     +Q+++KHWP K+
Sbjct  38   NRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTVFDVKRLIGRKFTDPEVQSDIKHWPFKV  97

Query  56   TSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDL  115
                 N+ Q+ VQFK ES TFQP EISSMVLIKMREIAEAYIGKQVKNAV+TVPAYFND 
Sbjct  98   ARGPENKPQLVVQFKGESKTFQPEEISSMVLIKMREIAEAYIGKQVKNAVVTVPAYFNDS  157

Query  116  QRTLSSLAQA  125
            QR  +  A A
Sbjct  158  QRQATKDAGA  167

>PYIW_16876
Length=643

 Score = 119 bits (299),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 89/130 (68%), Gaps = 7/130 (5%)

Query  3    NVTKSSFLAGQQPKR----SSKGRSIASIGNTLIN---VLIKKEASLVLQANVKHWPLKL  55
            N T  S++A    +R    ++K +   +  NT+ +   ++ +K +  V+QA++KHWP K+
Sbjct  38   NRTTPSYVAFTDTERLIGDAAKNQVAMNPANTVFDAKRLIGRKFSDQVVQADLKHWPFKV  97

Query  56   TSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDL  115
             + A N+ QI V FK E+ TFQP EISSMVLIKMRE++EA+IGK+VKNAV+TVPAYFND 
Sbjct  98   VAGADNKPQIVVHFKGETKTFQPEEISSMVLIKMREVSEAFIGKEVKNAVITVPAYFNDS  157

Query  116  QRTLSSLAQA  125
            QR  +  A A
Sbjct  158  QRQATKDAGA  167

>PYAP_17334
Length=650

 Score = 119 bits (298),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 69/89 (78%), Gaps = 0/89 (0%)

Query  37   KKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAY  96
            +K +  ++QA++KHWP  ++  A ++ QITVQFK ES TFQP EISSMVL KMRE+AEA+
Sbjct  79   RKFSDPIVQADIKHWPFTVSPGAGDKPQITVQFKGESKTFQPEEISSMVLTKMREVAEAF  138

Query  97   IGKQVKNAVMTVPAYFNDLQRTLSSLAQA  125
            IGK VKNAV+TVPAYFND QR  +  A A
Sbjct  139  IGKDVKNAVITVPAYFNDSQRQATKDAGA  167

>PYU1_G013931
Length=663

 Score = 119 bits (298),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 63/75 (84%), Gaps = 0/75 (0%)

Query  43   VLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVK  102
            V+QA+ KHWP K+ + A ++ QI VQFK ES TFQP EISSMVL KM+EIAEAYIGKQVK
Sbjct  91   VVQADTKHWPFKVVAGAESKPQIVVQFKGESKTFQPEEISSMVLTKMKEIAEAYIGKQVK  150

Query  103  NAVMTVPAYFNDLQR  117
            NAV+TVPAYFND QR
Sbjct  151  NAVITVPAYFNDSQR  165

>PPTG_19690
Length=566

 Score = 118 bits (295),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 86/130 (66%), Gaps = 7/130 (5%)

Query  3    NVTKSSFLAGQQPKR----SSKGRSIASIGNTLINV---LIKKEASLVLQANVKHWPLKL  55
            N T  S++A    +R    ++K +   +  NT+ +V   + +K     +Q+++KHWP K+
Sbjct  38   NRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTVFDVKRLIGRKFTDPEVQSDIKHWPFKV  97

Query  56   TSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDL  115
               A N+ Q+ VQFK ES TFQP EISSMVLIKMRE+AEA+IGK VKNAV+TVPAYFND 
Sbjct  98   VRGAENKPQLVVQFKGESKTFQPEEISSMVLIKMREVAEAFIGKHVKNAVVTVPAYFNDS  157

Query  116  QRTLSSLAQA  125
            QR  +  A A
Sbjct  158  QRQATKDAGA  167

>HYAP_01537
Length=651

 Score = 118 bits (295),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 67/82 (82%), Gaps = 0/82 (0%)

Query  44   LQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKN  103
            +Q+++KHWP K+T  ++++ Q+ VQFK E+  FQP EISSMVLIKMREIAEAYIGKQV+N
Sbjct  86   VQSDIKHWPFKVTRDSADKPQVEVQFKGETKRFQPEEISSMVLIKMREIAEAYIGKQVRN  145

Query  104  AVMTVPAYFNDLQRTLSSLAQA  125
            AV+TVPAYFND QR  +  A A
Sbjct  146  AVVTVPAYFNDSQRQATKDAGA  167

>PYU1_G013927
Length=649

 Score = 117 bits (293),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 70/89 (79%), Gaps = 0/89 (0%)

Query  37   KKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAY  96
            +K +  ++QA+ KHWP  +++   ++ QITVQFK ES TFQP EISSMVLIKMRE++EA+
Sbjct  79   RKFSDPIVQADCKHWPFTVSAGPGDKPQITVQFKGESKTFQPEEISSMVLIKMREVSEAF  138

Query  97   IGKQVKNAVMTVPAYFNDLQRTLSSLAQA  125
            IGK+V+NAV+TVPAYFND QR  +  A A
Sbjct  139  IGKEVRNAVITVPAYFNDSQRQATKDAGA  167

>H310_02610
Length=650

 Score = 117 bits (293),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 66/83 (80%), Gaps = 0/83 (0%)

Query  43   VLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVK  102
            V+QA++KHWP K+T  A ++ QITV+FK E+ TFQP EISSMVLIKM+E++EAYIG  V 
Sbjct  84   VIQADIKHWPFKVTPGAGDKPQITVEFKGETKTFQPEEISSMVLIKMKEVSEAYIGSTVN  143

Query  103  NAVMTVPAYFNDLQRTLSSLAQA  125
            NAV+TVPAYFND QR  +  A A
Sbjct  144  NAVITVPAYFNDSQRQATKDAGA  166

>CCI43221
Length=660

 Score = 117 bits (293),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 67/83 (81%), Gaps = 0/83 (0%)

Query  43   VLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVK  102
            V+QA++KHWP K+TS   ++  ITVQ+K E+ +F+P EISSMVLIKMREIAEA++GK VK
Sbjct  84   VVQADIKHWPFKVTSSEGDKTMITVQYKGETKSFRPEEISSMVLIKMREIAEAFLGKDVK  143

Query  103  NAVMTVPAYFNDLQRTLSSLAQA  125
            NAV+TVPAYFND QR  +  A A
Sbjct  144  NAVITVPAYFNDSQRQATKDAGA  166

>SDRG_11473
Length=636

 Score = 115 bits (289),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 65/130 (50%), Positives = 89/130 (68%), Gaps = 7/130 (5%)

Query  3    NVTKSSFLAGQQPKR----SSKGRSIASIGNTLIN---VLIKKEASLVLQANVKHWPLKL  55
            N T  S++A    +R    ++K +   +  NT+ +   ++ +K    V+QA++KHWP K+
Sbjct  35   NRTTPSYVAFTDTERLIGDAAKNQVAMNATNTVFDAKRLIGRKFHDAVVQADIKHWPFKV  94

Query  56   TSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDL  115
            TS A+++ QITVQFK ES TFQP EISSMVLIKM+EI+EAY+G  V NAV+TVPAYFND 
Sbjct  95   TSGAADKPQITVQFKGESKTFQPEEISSMVLIKMKEISEAYLGGPVANAVITVPAYFNDS  154

Query  116  QRTLSSLAQA  125
            QR  +  A A
Sbjct  155  QRQATKDAGA  164

>H257_17322
Length=606

 Score = 115 bits (287),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 66/83 (80%), Gaps = 0/83 (0%)

Query  43   VLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVK  102
            V+QA++KHWP K+T  A ++ QITV+FK E+ TFQP EISSMVLIKM+E++EA+IG  V 
Sbjct  84   VIQADIKHWPFKVTPGAGDKPQITVEFKGETKTFQPEEISSMVLIKMKEVSEAFIGSTVN  143

Query  103  NAVMTVPAYFNDLQRTLSSLAQA  125
            NAV+TVPAYFND QR  +  A A
Sbjct  144  NAVITVPAYFNDSQRQATKDAGA  166

>CCA14967
Length=1431

 Score = 114 bits (286),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 66/83 (80%), Gaps = 0/83 (0%)

Query  43   VLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVK  102
            V+QA++KHWP K+TS   ++  ITVQ+K E+ +F+P EISSMVLIKMREIA+AY+G  VK
Sbjct  96   VVQADIKHWPFKVTSCEGDKPMITVQYKGETKSFRPEEISSMVLIKMREIAQAYLGNDVK  155

Query  103  NAVMTVPAYFNDLQRTLSSLAQA  125
            NAV+TVPAYFND QR  +  A A
Sbjct  156  NAVITVPAYFNDSQRQATKDAGA  178

>SDRG_11899
Length=652

 Score = 114 bits (285),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 64/81 (79%), Gaps = 0/81 (0%)

Query  45   QANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNA  104
            QA++KHWP K+T  A ++ QITV+FK ES TFQP EISSMVLIKM+E++EA+IG  V NA
Sbjct  86   QADIKHWPFKVTPGAGDKPQITVEFKGESKTFQPEEISSMVLIKMKEVSEAFIGSPVNNA  145

Query  105  VMTVPAYFNDLQRTLSSLAQA  125
            V+TVPAYFND QR  +  A A
Sbjct  146  VITVPAYFNDSQRQATKDAGA  166

>SPRG_04533
Length=652

 Score = 114 bits (285),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 64/81 (79%), Gaps = 0/81 (0%)

Query  45   QANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNA  104
            QA++KHWP K+T  A ++ QITV+FK ES TFQP EISSMVLIKM+E++EA+IG  V NA
Sbjct  86   QADIKHWPFKVTPGAGDKPQITVEFKGESKTFQPEEISSMVLIKMKEVSEAFIGSPVNNA  145

Query  105  VMTVPAYFNDLQRTLSSLAQA  125
            V+TVPAYFND QR  +  A A
Sbjct  146  VITVPAYFNDSQRQATKDAGA  166

>PITG_11252
Length=654

 Score = 114 bits (285),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 85/130 (65%), Gaps = 7/130 (5%)

Query  3    NVTKSSFLAGQQPKR----SSKGRSIASIGNTLINV---LIKKEASLVLQANVKHWPLKL  55
            N T  S++A    +R    ++K +   +  NT+ +V   + +K     +Q+++KHWP  +
Sbjct  38   NRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTVFDVKRLIGRKFTDPEVQSDIKHWPFNV  97

Query  56   TSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDL  115
               A ++ Q+ VQFK E  TFQP EISSMVLIKMRE+AEA+IGKQVKNAV+TVPAYFND 
Sbjct  98   IRGAESKPQVVVQFKGEKKTFQPEEISSMVLIKMREVAEAFIGKQVKNAVVTVPAYFNDS  157

Query  116  QRTLSSLAQA  125
            QR  +  A A
Sbjct  158  QRQATKDAGA  167

>PHYRA_71655
Length=653

 Score = 114 bits (284),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 82/122 (67%), Gaps = 7/122 (6%)

Query  3    NVTKSSFLAGQQPKR----SSKGRSIASIGNTLINV---LIKKEASLVLQANVKHWPLKL  55
            N T  S++A    +R    ++K +   +  NT+ +V   + +K     +Q++++HWP K+
Sbjct  38   NRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTVFDVKRLIGRKFTDPEVQSDIRHWPFKV  97

Query  56   TSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDL  115
                 N+ ++ VQFK E  TFQP EISSMVL+KMREIAEAYIGKQVKNAV+TVPAYFND 
Sbjct  98   ARGPENKPEVVVQFKGEQVTFQPEEISSMVLVKMREIAEAYIGKQVKNAVVTVPAYFNDS  157

Query  116  QR  117
            QR
Sbjct  158  QR  159

>SPRG_00068
Length=643

 Score = 113 bits (282),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 63/130 (48%), Positives = 88/130 (68%), Gaps = 7/130 (5%)

Query  3    NVTKSSFLAGQQPKR----SSKGRSIASIGNTLIN---VLIKKEASLVLQANVKHWPLKL  55
            N T  S++A    +R    ++K +   +  NT+ +   ++ +K    V+QA++KHWP K+
Sbjct  36   NRTTPSYVAFTDNERLIGDAAKNQVAMNAANTVFDAKRLIGRKFHDAVVQADIKHWPFKV  95

Query  56   TSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDL  115
            T  A+++ QITV+FK ES TFQP EISSMVLIKM+EI+EAY+G  V NAV+TVPAYFND 
Sbjct  96   TPGAADKPQITVEFKGESKTFQPEEISSMVLIKMKEISEAYLGGPVANAVITVPAYFNDS  155

Query  116  QRTLSSLAQA  125
            QR  +  A A
Sbjct  156  QRQATKDAGA  165

>PYVX_22981
Length=612

 Score = 112 bits (279),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 64/75 (85%), Gaps = 0/75 (0%)

Query  43   VLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVK  102
            V+Q +++HWP K+++ + ++ QITVQF+ E  TFQP EISSMVL+KMR++AEA+IGK VK
Sbjct  92   VVQQDIRHWPFKVSAGSDSKPQITVQFQGERKTFQPEEISSMVLMKMRDVAEAFIGKPVK  151

Query  103  NAVMTVPAYFNDLQR  117
            NAV+TVPAYFND QR
Sbjct  152  NAVITVPAYFNDSQR  166

 Score = 29.3 bits (64),  Expect = 8.1, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 17/23 (74%), Gaps = 0/23 (0%)

Query  116  QRTLSSLAQAYIEGNSKYTNIYF  138
            +RTLSS AQAY+E +S Y  + F
Sbjct  237  KRTLSSSAQAYVEIDSLYDGVDF  259

>H257_12958
Length=649

 Score = 111 bits (278),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 65/83 (78%), Gaps = 0/83 (0%)

Query  43   VLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVK  102
            ++QA++KHWP K+ + A ++ QI V+FK E  TFQP EISSMVLIKM+E+AEAY+G  V+
Sbjct  84   MIQADIKHWPFKVIAGAGDKPQIVVEFKGERKTFQPEEISSMVLIKMKEVAEAYLGLDVQ  143

Query  103  NAVMTVPAYFNDLQRTLSSLAQA  125
            NAV+TVPAYFND QR  +  A A
Sbjct  144  NAVITVPAYFNDSQRQATKDAGA  166

>PHYCA_104444
Length=644

 Score = 110 bits (276),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 60/74 (81%), Gaps = 0/74 (0%)

Query  44   LQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKN  103
            +Q+++KHWP KL     ++  + VQFK E  TFQP EISSMVL+KMRE+AEA+IGKQVKN
Sbjct  86   VQSDIKHWPFKLVRGPESKPLVEVQFKGEKRTFQPEEISSMVLVKMREVAEAFIGKQVKN  145

Query  104  AVMTVPAYFNDLQR  117
            AV+TVPAYFND QR
Sbjct  146  AVVTVPAYFNDSQR  159

>H310_09557
Length=644

 Score = 110 bits (275),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 66/83 (80%), Gaps = 0/83 (0%)

Query  43   VLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVK  102
            ++QA++KHWP K+ +   ++ QI V+FK ES TFQP EISSMVLIKM+++AEA+IG +V+
Sbjct  83   MIQADIKHWPFKVVAGPGDKPQIVVEFKGESKTFQPEEISSMVLIKMKQVAEAFIGVEVQ  142

Query  103  NAVMTVPAYFNDLQRTLSSLAQA  125
            NAV+TVPAYFND QR  +  A A
Sbjct  143  NAVITVPAYFNDSQRQATKDAGA  165

>PHYRA_41888
Length=586

 Score = 110 bits (274),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 60/122 (49%), Positives = 82/122 (67%), Gaps = 7/122 (6%)

Query  3    NVTKSSFLAGQQPKR----SSKGRSIASIGNTLINV---LIKKEASLVLQANVKHWPLKL  55
            N T  S++A    +R    ++K +   +  NT+ +V   + +K     +Q++++HWP K+
Sbjct  38   NRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTVFDVKRLIGRKFTDPEVQSDIRHWPFKV  97

Query  56   TSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDL  115
                 N+ ++ VQFK E  TFQP EISSMVL+KMREIAEAYIGKQVKNAV+TVPAYFND 
Sbjct  98   ARGPENKPEVVVQFKGEQVTFQPEEISSMVLVKMREIAEAYIGKQVKNAVVTVPAYFNDS  157

Query  116  QR  117
            QR
Sbjct  158  QR  159

>CCI40249
Length=660

 Score = 108 bits (270),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 62/83 (75%), Gaps = 0/83 (0%)

Query  43   VLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVK  102
            ++QA++KHWP  + +   N+  I V FK E   FQP EISSMVL+KMRE++EAYIGKQVK
Sbjct  81   IVQADMKHWPFTVQNGPGNKPLIEVTFKGEKKIFQPEEISSMVLVKMREVSEAYIGKQVK  140

Query  103  NAVMTVPAYFNDLQRTLSSLAQA  125
            NAV+TVPAYFND QR  +  A A
Sbjct  141  NAVITVPAYFNDSQRQATKDAGA  163

>PYAP_19235
Length=643

 Score = 108 bits (269),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 59/122 (48%), Positives = 82/122 (67%), Gaps = 7/122 (6%)

Query  3    NVTKSSFLAGQQPKR----SSKGRSIASIGNTLIN---VLIKKEASLVLQANVKHWPLKL  55
            N T  S++A    +R    ++K +   +  NT+ +   ++ +K    V+QA++KHWP K+
Sbjct  37   NRTTPSYVAFTDSERLIGDAAKNQVAMNAHNTVFDAKRLIGRKFTDPVVQADMKHWPFKV  96

Query  56   TSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDL  115
             + A ++ QITV+FK E   FQP EISSMVL KM+EIAEAY+G  VKNAV+TVPAYFND 
Sbjct  97   VTGAGDKPQITVEFKGEKKVFQPEEISSMVLTKMKEIAEAYLGTDVKNAVITVPAYFNDS  156

Query  116  QR  117
            QR
Sbjct  157  QR  158

>PYAP_17333
Length=657

 Score = 107 bits (268),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 63/83 (76%), Gaps = 0/83 (0%)

Query  43   VLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVK  102
            V+QA++KHWP ++ +   ++ QI V+FK ES  F   EISSMVL KMR+IAEAYIGKQVK
Sbjct  86   VVQADLKHWPFQVVAGPDDKPQIIVEFKGESKRFYAEEISSMVLTKMRDIAEAYIGKQVK  145

Query  103  NAVMTVPAYFNDLQRTLSSLAQA  125
            NAV+TVPAYFND QR  +  A A
Sbjct  146  NAVITVPAYFNDSQRQATKDAGA  168

 Score = 30.0 bits (66),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 17/23 (74%), Gaps = 0/23 (0%)

Query  116  QRTLSSLAQAYIEGNSKYTNIYF  138
            +RTLSS AQAYIE +S Y  I F
Sbjct  275  KRTLSSSAQAYIEIDSLYEGIDF  297

>CCA16153
Length=663

 Score = 104 bits (260),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 61/83 (73%), Gaps = 0/83 (0%)

Query  43   VLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVK  102
            ++QA++KHWP  + +   N+  I V FK E   FQP EISSMVL+KMRE++EAYIGK VK
Sbjct  81   IVQADMKHWPFTVQNGPGNKPLIEVIFKGEKKIFQPEEISSMVLVKMREVSEAYIGKTVK  140

Query  103  NAVMTVPAYFNDLQRTLSSLAQA  125
            NAV+TVPAYFND QR  +  A A
Sbjct  141  NAVITVPAYFNDSQRQATKDAGA  163

>CCI40247
Length=643

 Score = 93.2 bits (230),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 53/74 (72%), Gaps = 0/74 (0%)

Query  44   LQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKN  103
            +Q + KHWP ++     ++ QI V+ K     F   EIS+MVL KMREIAEAY+G+QVKN
Sbjct  87   VQQDTKHWPFRVVCGPEDKPQIVVEVKGAKKMFYAEEISAMVLSKMREIAEAYLGRQVKN  146

Query  104  AVMTVPAYFNDLQR  117
            AV+TVPAYFND QR
Sbjct  147  AVVTVPAYFNDSQR  160

>PYAR_14487
Length=467

 Score = 90.5 bits (223),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 49/61 (80%), Gaps = 0/61 (0%)

Query  65   ITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQRTLSSLAQ  124
            ITV FK ES TFQP EISSMVL KMRE++EA+IGK VKNAV+TVPAYFND QR  +  A 
Sbjct  70   ITVTFKGESKTFQPEEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAG  129

Query  125  A  125
            A
Sbjct  130  A  130

>CCA16151
Length=643

 Score = 89.7 bits (221),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 51/74 (69%), Gaps = 0/74 (0%)

Query  44   LQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKN  103
            +Q + KHWP  +     ++ QI V+       F   EIS+MVL KMREIAEAY+G+QVKN
Sbjct  87   VQQDTKHWPFSVVCGPEDKPQIVVEVNGAKKMFYAEEISAMVLSKMREIAEAYLGRQVKN  146

Query  104  AVMTVPAYFNDLQR  117
            AV+TVPAYFND QR
Sbjct  147  AVVTVPAYFNDSQR  160

>PYIR_15857
Length=577

 Score = 89.7 bits (221),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 74/146 (51%), Gaps = 47/146 (32%)

Query  37   KKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAY  96
            +K +  ++QA++KHWP K++  A ++ QITV+FK E+ TFQP EISSMVLIKMRE++EA+
Sbjct  79   RKFSDPIVQADIKHWPFKVSPGAGDKPQITVEFKGETKTFQPEEISSMVLIKMREVSEAF  138

Query  97   IGKQVKNAVMTVPAYFNDL-----------------------------------------  115
            IGK+    +  V A   D                                          
Sbjct  139  IGKE---GIFEVKATAGDTHLGGEDFDNRLVDHFVGEFKRKHRKDITSNQRALRRLRTAC  195

Query  116  ---QRTLSSLAQAYIEGNSKYTNIYF  138
               +RTLSS AQAYIE +S +  + F
Sbjct  196  ERAKRTLSSSAQAYIEIDSLFDGVDF  221

>H257_18885
Length=786

 Score = 89.4 bits (220),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 64/99 (65%), Gaps = 8/99 (8%)

Query  27   IGNTLINVLIKKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVL  86
            IG    + ++KK+A+        H+P K+T+   ++  I V FK E+ +F P EISSMVL
Sbjct  260  IGRNFSDPIVKKDAA--------HFPFKITAGDDDKPLIEVTFKGEAKSFTPEEISSMVL  311

Query  87   IKMREIAEAYIGKQVKNAVMTVPAYFNDLQRTLSSLAQA  125
             +M+E AE Y+G+++K AV+TVPAYFND QR  +  A A
Sbjct  312  TRMKETAENYLGQEIKQAVVTVPAYFNDQQRQSTKDAGA  350

>H257_00007
Length=787

 Score = 87.8 bits (216),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 63/99 (64%), Gaps = 8/99 (8%)

Query  27   IGNTLINVLIKKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVL  86
            IG    + ++KK+A+        H+P K+T    ++  I V F+ E+ +F P EISSMVL
Sbjct  261  IGRNFSDPIVKKDAA--------HFPFKITKGEGDKPLIEVSFRGEAKSFTPEEISSMVL  312

Query  87   IKMREIAEAYIGKQVKNAVMTVPAYFNDLQRTLSSLAQA  125
             +M+E AE Y+G+++K AV+TVPAYFND QR  +  A A
Sbjct  313  TRMKETAENYLGQEIKQAVVTVPAYFNDQQRQSTKDAGA  351

>PYIW_22144
Length=633

 Score = 86.7 bits (213),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 50/130 (38%), Positives = 81/130 (62%), Gaps = 7/130 (5%)

Query  3    NVTKSSFLAGQQPKR----SSKGRSIASIGNTLIN---VLIKKEASLVLQANVKHWPLKL  55
            N T  S++A  + +R    ++K ++ ++  NT+ +   ++ +     +++ + KH+P K+
Sbjct  67   NRTTPSWVAFNESERLIGEAAKIQAASNATNTVFDAKRIIGRNFNDDIVKKDAKHFPFKI  126

Query  56   TSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDL  115
                SN++ I V+FK ES  F P EISSMVL +M+E AEAY+G+ +  AV+TVPAYFND 
Sbjct  127  VEGDSNKVLIEVEFKGESKRFTPEEISSMVLTRMKETAEAYLGQPINQAVVTVPAYFNDQ  186

Query  116  QRTLSSLAQA  125
            QR  +  A A
Sbjct  187  QRQSTKDAGA  196

>PYIR_24387
Length=633

 Score = 86.3 bits (212),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 50/130 (38%), Positives = 81/130 (62%), Gaps = 7/130 (5%)

Query  3    NVTKSSFLAGQQPKR----SSKGRSIASIGNTLIN---VLIKKEASLVLQANVKHWPLKL  55
            N T  S++A  + +R    ++K ++ ++  NT+ +   ++ +     +++ + KH+P K+
Sbjct  67   NRTTPSWVAFNESERLIGEAAKIQAASNATNTVFDAKRIIGRNFNDDIVKKDAKHFPFKI  126

Query  56   TSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDL  115
                SN++ I V+FK ES  F P EISSMVL +M+E AEAY+G+ +  AV+TVPAYFND 
Sbjct  127  VEGDSNKVLIEVEFKGESKRFTPEEISSMVLTRMKETAEAYLGQPINQAVVTVPAYFNDQ  186

Query  116  QRTLSSLAQA  125
            QR  +  A A
Sbjct  187  QRQSTKDAGA  196

>PYAP_22238
Length=633

 Score = 85.9 bits (211),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 43/91 (47%), Positives = 61/91 (67%), Gaps = 8/91 (9%)

Query  27   IGNTLINVLIKKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVL  86
            IG    + ++KK+A+        H+P K+T    N++ I V+FK E+ +F P EISSMVL
Sbjct  106  IGRNFSDEIVKKDAT--------HFPFKITEGDDNKVLIQVEFKGETKSFTPEEISSMVL  157

Query  87   IKMREIAEAYIGKQVKNAVMTVPAYFNDLQR  117
             +M+E AEAY+G+ +  AV+TVPAYFND QR
Sbjct  158  TRMKETAEAYLGQPINQAVVTVPAYFNDQQR  188

>SPRG_10519
Length=782

 Score = 85.5 bits (210),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 60/99 (61%), Gaps = 8/99 (8%)

Query  27   IGNTLINVLIKKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVL  86
            IG    + ++KK+A+        H+P K+     ++  I V FK E   F P EISSMVL
Sbjct  255  IGRAFSDPIVKKDAA--------HFPFKIVEGEGDKPLIQVTFKGEEKNFSPEEISSMVL  306

Query  87   IKMREIAEAYIGKQVKNAVMTVPAYFNDLQRTLSSLAQA  125
             +M+E AE Y+G+++K AV+TVPAYFND QR  +  A A
Sbjct  307  TRMKETAENYLGQEIKQAVVTVPAYFNDQQRQSTKDAGA  345

>SDRG_05777
Length=786

 Score = 85.5 bits (210),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 60/99 (61%), Gaps = 8/99 (8%)

Query  27   IGNTLINVLIKKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVL  86
            IG    + ++KK+A+        H+P K+     ++  I V FK E   F P EISSMVL
Sbjct  260  IGRAFSDPIVKKDAA--------HFPFKIVEGDEDKPLIQVSFKGEDKRFTPEEISSMVL  311

Query  87   IKMREIAEAYIGKQVKNAVMTVPAYFNDLQRTLSSLAQA  125
             +M+E AE Y+G+++K AV+TVPAYFND QR  +  A A
Sbjct  312  TRMKETAENYLGQEIKQAVVTVPAYFNDQQRQSTKDAGA  350

>PYVX_18121
Length=633

 Score = 84.7 bits (208),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 46/122 (38%), Positives = 78/122 (64%), Gaps = 7/122 (6%)

Query  3    NVTKSSFLAGQQPKR----SSKGRSIASIGNTLIN---VLIKKEASLVLQANVKHWPLKL  55
            N T  S++A  + +R    ++K ++ ++  NT+ +   ++ +  +  V++ +  H+P K+
Sbjct  67   NRTTPSWVAFNESERLIGEAAKIQAASNATNTVFDAKRIIGRNFSDEVVKKDATHFPFKI  126

Query  56   TSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDL  115
                 N++ I V+FK E+  F P EISSMVL++M+E AEAY+G+ +  AV+TVPAYFND 
Sbjct  127  VEGDDNKVLIEVEFKGEAKRFTPEEISSMVLLRMKETAEAYLGQPINQAVVTVPAYFNDQ  186

Query  116  QR  117
            QR
Sbjct  187  QR  188

>PHYRA_51904
Length=129

 Score = 79.7 bits (195),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 44/54 (81%), Gaps = 0/54 (0%)

Query  37   KKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMR  90
            +K +  ++QA++KHWP KLTS A ++ QITVQFK ES TFQP EISSMVLIKMR
Sbjct  76   RKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMR  129

>CCI46091
Length=787

 Score = 84.7 bits (208),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 47/122 (39%), Positives = 78/122 (64%), Gaps = 7/122 (6%)

Query  3    NVTKSSFLAGQQPKR----SSKGRSIASIGNTLIN---VLIKKEASLVLQANVKHWPLKL  55
            N T  S++A    +R    ++K ++ ++  NT+ +   ++ +  A   +Q + +H+P K+
Sbjct  221  NRTTPSWVAFTDSERLIGEAAKIQAASNPTNTVFDAKRIIGRSFADEAVQRDAQHFPFKI  280

Query  56   TSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDL  115
             S   ++  I V+FK+E+  F P EIS+MVL +M+E AEAY+G+ +K AV+TVPAYFND 
Sbjct  281  VSGDGDKPLIQVEFKKETKQFTPEEISAMVLTRMKETAEAYLGQPIKQAVVTVPAYFNDH  340

Query  116  QR  117
            QR
Sbjct  341  QR  342

>H310_14759
Length=787

 Score = 84.0 bits (206),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 62/99 (63%), Gaps = 8/99 (8%)

Query  27   IGNTLINVLIKKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVL  86
            IG    + ++KK+A+        H+P K++    ++  I V F+ E  +F P EISSMVL
Sbjct  261  IGRNFSDPIVKKDAA--------HFPFKISKGEGDKPLIQVTFRGEDKSFTPEEISSMVL  312

Query  87   IKMREIAEAYIGKQVKNAVMTVPAYFNDLQRTLSSLAQA  125
             +M+E AE ++G+++K AV+TVPAYFND QR  +  A A
Sbjct  313  TRMKETAENFLGQEIKQAVVTVPAYFNDQQRQSTKDAGA  351

>PYAR_19807
Length=1613

 Score = 84.0 bits (206),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 46/109 (42%), Positives = 71/109 (65%), Gaps = 7/109 (6%)

Query  3    NVTKSSFLAGQQPKR----SSKGRSIASIGNTLIN---VLIKKEASLVLQANVKHWPLKL  55
            N T  S++A    +R    ++K +   +  NT+ +   ++ +K    V+QA++KHWP ++
Sbjct  40   NRTTPSYVAFTDSERLIGDAAKNQVAMNAHNTVFDAKRLIGRKFTDAVVQADIKHWPFRV  99

Query  56   TSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNA  104
             + ++N+ QI VQFK E+  F   EISSMVL KMR++AEA+IGKQVKNA
Sbjct  100  MADSANKPQIVVQFKGETKKFYAEEISSMVLTKMRDVAEAFIGKQVKNA  148

>PYU1_G001540
Length=633

 Score = 83.6 bits (205),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 48/130 (37%), Positives = 79/130 (61%), Gaps = 7/130 (5%)

Query  3    NVTKSSFLAGQQPKR----SSKGRSIASIGNTLIN---VLIKKEASLVLQANVKHWPLKL  55
            N T  S++A  + +R    ++K ++ ++  NT+ +   ++ +     +++ + KH+P K+
Sbjct  67   NRTTPSWVAFNETERLIGEAAKIQAASNAHNTVFDAKRIIGRNFNDEIVKKDAKHFPFKI  126

Query  56   TSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDL  115
                 N++ I V+FK E   F P EISSMVL +M+E AEAY+G+ +  AV+TVPAYFND 
Sbjct  127  VEGDDNKVLIEVEFKGEQKRFTPEEISSMVLTRMKETAEAYLGQPINQAVVTVPAYFNDQ  186

Query  116  QRTLSSLAQA  125
            QR  +  A A
Sbjct  187  QRQSTKDAGA  196

>CCA20828
Length=787

 Score = 83.2 bits (204),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 46/122 (38%), Positives = 78/122 (64%), Gaps = 7/122 (6%)

Query  3    NVTKSSFLAGQQPKR----SSKGRSIASIGNTLIN---VLIKKEASLVLQANVKHWPLKL  55
            N T  S++A    +R    ++K ++ ++  NT+ +   ++ +  A   +Q + +H+P K+
Sbjct  221  NRTTPSWVAFTDTERLIGEAAKIQAASNPTNTVFDAKRIIGRSFADEAVQRDAQHFPFKI  280

Query  56   TSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDL  115
             S   ++  I V++K+E+  F P EIS+MVL +M+E AEAY+G+ +K AV+TVPAYFND 
Sbjct  281  VSGDGDKPLIQVEYKKETKQFTPEEISAMVLTRMKETAEAYLGQPIKQAVVTVPAYFNDH  340

Query  116  QR  117
            QR
Sbjct  341  QR  342

>HYAP_12660
Length=786

 Score = 83.2 bits (204),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 43/99 (43%), Positives = 64/99 (65%), Gaps = 8/99 (8%)

Query  27   IGNTLINVLIKKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVL  86
            IG +  + ++KK+A        KH+P K+     +++ I V+FK E  +F P EISSMVL
Sbjct  259  IGRSFSDEVVKKDA--------KHFPFKIKEGDDDKVLIEVEFKGEKKSFTPEEISSMVL  310

Query  87   IKMREIAEAYIGKQVKNAVMTVPAYFNDLQRTLSSLAQA  125
            ++M+E AEA++G+ +  AV+TVPAYFND QR  +  A A
Sbjct  311  LRMKETAEAFLGQSISQAVVTVPAYFNDQQRQSTKDAGA  349

>PHYCA_532912
Length=626

 Score = 82.8 bits (203),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 49/65 (75%), Gaps = 0/65 (0%)

Query  37   KKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAY  96
            +K +  V+QA++KHWP ++TS A ++ QITVQFK ES TFQP EISSMVLIKMRE A A 
Sbjct  80   RKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMREDAGAI  139

Query  97   IGKQV  101
             G  V
Sbjct  140  AGLNV  144

>PPTG_03121
Length=786

 Score = 82.0 bits (201),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 44/122 (36%), Positives = 78/122 (64%), Gaps = 7/122 (6%)

Query  3    NVTKSSFLAGQQPKR----SSKGRSIASIGNTLIN---VLIKKEASLVLQANVKHWPLKL  55
            N T  S++A  + +R    ++K ++  +  NT+ +   ++ +  +  V++ +  H+P K+
Sbjct  220  NRTTPSWVAFNESERLIGEAAKIQAAGNATNTVFDAKRIIGRSFSDEVVKKDATHFPFKI  279

Query  56   TSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDL  115
                 +++ I V+FK E+ +F P EISSMVL++M+E AEA++G+ +  AV+TVPAYFND 
Sbjct  280  KEGDDDKVLIEVEFKGENKSFTPEEISSMVLLRMKETAEAFLGQSISQAVVTVPAYFNDQ  339

Query  116  QR  117
            QR
Sbjct  340  QR  341

>PHYKE_10815
Length=786

 Score = 82.0 bits (201),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 40/91 (44%), Positives = 61/91 (67%), Gaps = 8/91 (9%)

Query  27   IGNTLINVLIKKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVL  86
            IG +  + ++KK+A        KH+P  +     +++ I V+FK E  +F P EISSMVL
Sbjct  259  IGRSFSDEMVKKDA--------KHFPFTIKEGDDDKVLIEVEFKNEKKSFTPEEISSMVL  310

Query  87   IKMREIAEAYIGKQVKNAVMTVPAYFNDLQR  117
            ++M+E AEA++G+++  AV+TVPAYFND QR
Sbjct  311  LRMKETAEAFLGQKIGQAVVTVPAYFNDQQR  341

>PHYSO_339667
Length=160

 Score = 77.8 bits (190),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 71/120 (59%), Gaps = 15/120 (13%)

Query  5    TKSSFLAG----QQPKRSSKGRSIASIGNTLINV---LIKKEASLVLQANVKHWPLKLTS  57
            T ++ L G    +QP R+++        NT+ N+   + +K +   LQ ++++WP K+  
Sbjct  46   TDTALLTGNAAKRQPTRNAE--------NTVFNIHQLIGRKFSDPALQLSIRYWPFKVEC  97

Query  58   VASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQR  117
               +  Q+ VQ+K E+  FQP EI +++L +MR++AE Y+ ++V  AV+TVP  FN  QR
Sbjct  98   GPKDTAQVVVQYKGETKRFQPIEIVAILLCEMRKMAEIYLDQEVTKAVLTVPGSFNYFQR  157

>PITG_11913
Length=786

 Score = 81.6 bits (200),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 44/122 (36%), Positives = 77/122 (63%), Gaps = 7/122 (6%)

Query  3    NVTKSSFLAGQQPKR----SSKGRSIASIGNTLIN---VLIKKEASLVLQANVKHWPLKL  55
            N T  S++A  + +R    ++K ++  +  NT+ +   ++ +  +  V++ + KH+P  +
Sbjct  220  NRTTPSWVAFNESERLIGEAAKIQAAGNATNTVFDAKRIIGRSFSDEVVKKDAKHFPFTI  279

Query  56   TSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDL  115
                 +++ I V+FK E  +F P EISSMVL++M+E AEA++G+ +  AV+TVPAYFND 
Sbjct  280  KEGDEDKVLIEVEFKGEKKSFTPEEISSMVLLRMKETAEAFLGQSISQAVVTVPAYFNDQ  339

Query  116  QR  117
            QR
Sbjct  340  QR  341

>PHYCA_509820
Length=786

 Score = 80.5 bits (197),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 43/122 (35%), Positives = 76/122 (62%), Gaps = 7/122 (6%)

Query  3    NVTKSSFLAGQQPKR----SSKGRSIASIGNTLIN---VLIKKEASLVLQANVKHWPLKL  55
            N T  S++A  + +R    ++K ++  +  NT+ +   ++ +  +  V++ +  H+P  +
Sbjct  220  NRTTPSWVAFNESERLIGEAAKIQAAGNATNTVFDAKRIIGRSFSDEVVKKDATHFPFTI  279

Query  56   TSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDL  115
                 +++ I V+FK E  +F P EISSMVL++M+E AEA++G+ +  AV+TVPAYFND 
Sbjct  280  KEGDDDKVLIEVEFKNEKKSFTPEEISSMVLLRMKETAEAFLGQSISQAVVTVPAYFNDQ  339

Query  116  QR  117
            QR
Sbjct  340  QR  341

>PHYRA_78193
Length=786

 Score = 80.1 bits (196),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 43/122 (35%), Positives = 77/122 (63%), Gaps = 7/122 (6%)

Query  3    NVTKSSFLAGQQPKR----SSKGRSIASIGNTLIN---VLIKKEASLVLQANVKHWPLKL  55
            N T  S++A  + +R    ++K ++  +  NT+ +   ++ +  +  V++ + KH+P  +
Sbjct  220  NRTTPSWVAFNESERLIGEAAKIQAAGNATNTVFDAKRIIGRSFSDEVVKKDAKHFPFTI  279

Query  56   TSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDL  115
                 +++ I V+FK +  +F P EISSMVL++M+E AEA++G+ +  AV+TVPAYFND 
Sbjct  280  KEGDDDKVLIEVEFKGDKKSFTPEEISSMVLLRMKETAEAFLGQSISQAVVTVPAYFNDQ  339

Query  116  QR  117
            QR
Sbjct  340  QR  341

>SDRG_05778
Length=618

 Score = 79.7 bits (195),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 46/130 (35%), Positives = 78/130 (60%), Gaps = 7/130 (5%)

Query  3    NVTKSSFLAGQQPKR----SSKGRSIASIGNTLIN---VLIKKEASLVLQANVKHWPLKL  55
            N T  S++A  + +R    ++K ++ ++  NT+ +   ++ +  +  +++ +  H+P K+
Sbjct  221  NRTTPSWVAFNEAERLIGDAAKLQAASNATNTVFDAKRIIGRAFSDPIVKKDAAHFPFKI  280

Query  56   TSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDL  115
                 ++  I V FK E   F P EISSMVL +M+E AE Y+G+++K AV+TVPAYFND 
Sbjct  281  VEGDEDKPLIQVSFKGEDKRFTPEEISSMVLTRMKETAENYLGQEIKQAVVTVPAYFNDQ  340

Query  116  QRTLSSLAQA  125
            QR  +  A A
Sbjct  341  QRQSTKDAGA  350

>SPRG_10477
Length=762

 Score = 79.0 bits (193),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 46/130 (35%), Positives = 78/130 (60%), Gaps = 7/130 (5%)

Query  3    NVTKSSFLAGQQPKR----SSKGRSIASIGNTLIN---VLIKKEASLVLQANVKHWPLKL  55
            N T  S++A  + +R    ++K ++ ++  NT+ +   ++ +  +  +++ +  H+P K+
Sbjct  212  NRTTPSWVAFNESERLIGDAAKLQAASNATNTVFDAKRIIGRAFSDPIVKKDAAHFPFKI  271

Query  56   TSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDL  115
                 ++  I V FK E   F P EISSMVL +M+E AE Y+G+++K AV+TVPAYFND 
Sbjct  272  VEGDDDKPLIQVSFKGEDKRFTPEEISSMVLTRMKETAENYLGQEIKQAVVTVPAYFNDQ  331

Query  116  QRTLSSLAQA  125
            QR  +  A A
Sbjct  332  QRQSTKDAGA  341

>PHALS_02079
Length=786

 Score = 79.0 bits (193),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 43/122 (35%), Positives = 76/122 (62%), Gaps = 7/122 (6%)

Query  3    NVTKSSFLAGQQPKR----SSKGRSIASIGNTLIN---VLIKKEASLVLQANVKHWPLKL  55
            N T  S++A  + +R    ++K ++ ++  NT+ +   ++ +  +  V++ +  H+P  +
Sbjct  220  NRTTPSWVAFNESERLIGEAAKIQAASNATNTIFDAKRIIGRSFSDEVVKKDATHFPFTI  279

Query  56   TSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDL  115
                 +++ I V FK E  +F P EISSMVL++M+E AEA++G+ +  AV+TVPAYFND 
Sbjct  280  KEGDDDKVLIEVDFKGEKKSFTPEEISSMVLLRMKETAEAFLGQNISQAVVTVPAYFNDQ  339

Query  116  QR  117
            QR
Sbjct  340  QR  341

>PHYRA_72238
Length=601

 Score = 76.6 bits (187),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 34/74 (46%), Positives = 52/74 (70%), Gaps = 0/74 (0%)

Query  44   LQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKN  103
            +Q ++KHWP K+    ++  ++ VQF+ E+ TFQP EI +M+L ++RE+AE + GK VK 
Sbjct  87   VQRSMKHWPFKVICGQNDNPEVEVQFRGETKTFQPVEILAMLLAELRELAEKHTGKTVKE  146

Query  104  AVMTVPAYFNDLQR  117
             V+TVP+ FN  QR
Sbjct  147  VVLTVPSCFNHSQR  160

>SPRG_00333
Length=615

 Score = 73.2 bits (178),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 62/98 (63%), Gaps = 4/98 (4%)

Query  29   NTLINV--LIKKE-ASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMV  85
            NTL +V  LI ++     +QA+ K  P ++ +    R  I V+ K E+ TF   E+S+M+
Sbjct  91   NTLFDVKRLIGRQYNDKSVQADKKLLPFEIIN-KEGRPYIQVKVKGETKTFSAEEVSAMI  149

Query  86   LIKMREIAEAYIGKQVKNAVMTVPAYFNDLQRTLSSLA  123
            L KM+ IAE Y+GK+V +AV+TVPAYFND QR  +  A
Sbjct  150  LTKMKNIAENYLGKEVNDAVVTVPAYFNDAQRQATKDA  187

>PYAP_13341
Length=657

 Score = 72.0 bits (175),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 37/74 (50%), Positives = 52/74 (70%), Gaps = 1/74 (1%)

Query  44   LQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKN  103
            +QA+ K  P ++ +    +  I V  K E+  F P E+S+MVL KM++IAEAYIG++V +
Sbjct  109  VQADKKLLPYEIVN-KDGKPFIQVTIKGENKLFAPEEVSAMVLTKMKQIAEAYIGREVYD  167

Query  104  AVMTVPAYFNDLQR  117
            AV+TVPAYFND QR
Sbjct  168  AVVTVPAYFNDAQR  181

>PYIR_16738
Length=555

 Score = 71.2 bits (173),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 36/74 (49%), Positives = 48/74 (65%), Gaps = 1/74 (1%)

Query  44   LQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKN  103
            +QA+ K  P K+      +  I V  K E   F P EIS+M+L KM++IAE Y+GK + +
Sbjct  111  VQADKKLLPYKIVD-KDGKPAIEVPIKGEKKLFSPEEISAMILTKMKQIAEGYLGKDIHD  169

Query  104  AVMTVPAYFNDLQR  117
            AV+TVPAYFND QR
Sbjct  170  AVVTVPAYFNDAQR  183

>HYAP_01005
Length=660

 Score = 71.2 bits (173),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 38/81 (47%), Positives = 53/81 (65%), Gaps = 1/81 (1%)

Query  37   KKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAY  96
            +K     +Q++ K  P +L +    +  I VQ K E+  F P E+S+MVL KM+ IAE Y
Sbjct  102  RKYTDKSVQSDKKLLPYELVN-KDGKPFIQVQVKGETRQFAPEEVSAMVLTKMKHIAEGY  160

Query  97   IGKQVKNAVMTVPAYFNDLQR  117
            IG++V +AV+TVPAYFND QR
Sbjct  161  IGREVFDAVVTVPAYFNDAQR  181

>HYAP_01004
Length=660

 Score = 71.2 bits (173),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 38/81 (47%), Positives = 53/81 (65%), Gaps = 1/81 (1%)

Query  37   KKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAY  96
            +K     +Q++ K  P +L +    +  I VQ K E+  F P E+S+MVL KM+ IAE Y
Sbjct  102  RKYTDKSVQSDKKLLPYELVN-KDGKPFIQVQVKGETRQFAPEEVSAMVLTKMKHIAEGY  160

Query  97   IGKQVKNAVMTVPAYFNDLQR  117
            IG++V +AV+TVPAYFND QR
Sbjct  161  IGREVFDAVVTVPAYFNDAQR  181

>PYIW_21755
Length=658

 Score = 70.9 bits (172),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 36/74 (49%), Positives = 50/74 (68%), Gaps = 1/74 (1%)

Query  44   LQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKN  103
            +QA+ K  P  + +     L I V  K E  TF P E+S+M+L KM+++AE YIG++V +
Sbjct  109  VQADKKLLPYNIINKDGKPL-IEVSVKGEKKTFSPEEVSAMILTKMKQVAEGYIGREVFD  167

Query  104  AVMTVPAYFNDLQR  117
            AV+TVPAYFND QR
Sbjct  168  AVVTVPAYFNDAQR  181

>PYAR_18354
Length=1084

 Score = 70.9 bits (172),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 38/74 (51%), Positives = 49/74 (66%), Gaps = 1/74 (1%)

Query  44   LQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKN  103
            +QA+ K  P  + +    +  I V  K E   F P EIS+MVL KM+ IAEAYIG++V +
Sbjct  110  VQADKKLLPFDIVN-KDGKPFIQVTIKGEKKQFSPEEISAMVLSKMKTIAEAYIGREVYD  168

Query  104  AVMTVPAYFNDLQR  117
            AV+TVPAYFND QR
Sbjct  169  AVVTVPAYFNDAQR  182

>SDRG_03564
Length=658

 Score = 70.9 bits (172),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 59/92 (64%), Gaps = 4/92 (4%)

Query  29   NTLINV--LIKKE-ASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMV  85
            NTL +V  LI ++     +QA+ K  P ++ +    R  I V  K E+ TF   E+S+M+
Sbjct  91   NTLFDVKRLIGRQYNDKSVQADKKLLPYEIVN-KEGRPYIQVIVKGETKTFSAEEVSAMI  149

Query  86   LIKMREIAEAYIGKQVKNAVMTVPAYFNDLQR  117
            L KM+ IAE Y+GK+V +AV+TVPAYFND QR
Sbjct  150  LTKMKNIAENYLGKEVNDAVVTVPAYFNDAQR  181

>H310_09434
Length=658

 Score = 70.9 bits (172),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 36/74 (49%), Positives = 50/74 (68%), Gaps = 1/74 (1%)

Query  44   LQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKN  103
            +QA+ K  P  + +    R  I V+ K E+  F P E+S+M+L KM+ IAE Y+GK+V +
Sbjct  109  VQADKKLLPFHIVN-KDGRPFIEVKIKGEAKQFSPEEVSAMILTKMKTIAENYLGKEVHD  167

Query  104  AVMTVPAYFNDLQR  117
            AV+TVPAYFND QR
Sbjct  168  AVVTVPAYFNDAQR  181

>PHYSO_525429
Length=610

 Score = 70.5 bits (171),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 41/116 (35%), Positives = 68/116 (59%), Gaps = 7/116 (6%)

Query  5    TKSSFLAGQQPKRSSKGRSIASIGNTLIN---VLIKKEASLVLQANVKHWPLKLTSVASN  61
            T +  L G   KR    +   ++ NT+     ++ +K + L +Q ++KHWP K+    ++
Sbjct  32   TDTERLVGDVAKR----QVATNVNNTVFGTTRLIGRKFSDLEVQEDLKHWPFKVVGGPND  87

Query  62   RLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQR  117
               + VQ   ++ TF+P EI +M+L + RE  E ++GK+V+NAV+TVPA FN  QR
Sbjct  88   GPLVEVQAAGQTKTFRPVEILAMLLAEARETVETHLGKRVENAVVTVPASFNYAQR  143

>PHYSO_286376
Length=660

 Score = 70.1 bits (170),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 36/74 (49%), Positives = 51/74 (69%), Gaps = 1/74 (1%)

Query  44   LQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKN  103
            +QA+ K  P +L +    +  I V+ K E   F P E+S+MVL KM++I+E YIG++V +
Sbjct  109  VQADKKLLPYELVN-KDGKPFIQVEVKGEKRQFAPEEVSAMVLTKMKQISEGYIGREVYD  167

Query  104  AVMTVPAYFNDLQR  117
            AV+TVPAYFND QR
Sbjct  168  AVVTVPAYFNDAQR  181

>PYVX_16738
Length=658

 Score = 70.1 bits (170),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 38/81 (47%), Positives = 51/81 (63%), Gaps = 1/81 (1%)

Query  37   KKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAY  96
            +K A   +QA+ K  P  +      +  I V  K E   F P E+S+MVL KM++IAE Y
Sbjct  101  RKYADKSVQADKKLLPYHIAD-KQGKPFIEVTVKGEKRQFAPEEVSAMVLTKMKQIAEGY  159

Query  97   IGKQVKNAVMTVPAYFNDLQR  117
            IG++V +AV+TVPAYFND QR
Sbjct  160  IGREVFDAVVTVPAYFNDAQR  180

>PITG_00527
Length=656

 Score = 69.7 bits (169),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 36/74 (49%), Positives = 51/74 (69%), Gaps = 1/74 (1%)

Query  44   LQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKN  103
            +QA+ K  P +L +    +  I V+ K E   F P E+S+MVL KM++I+E YIG++V +
Sbjct  108  VQADKKLLPYELVN-KDGKPFIEVEVKGEKRQFAPEEVSAMVLTKMKQISEGYIGREVFD  166

Query  104  AVMTVPAYFNDLQR  117
            AV+TVPAYFND QR
Sbjct  167  AVVTVPAYFNDAQR  180

>PYU1_G004097
Length=663

 Score = 69.7 bits (169),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 36/74 (49%), Positives = 52/74 (70%), Gaps = 1/74 (1%)

Query  44   LQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKN  103
            +QA+ K  P ++ +    +  I V  K ++  F P EIS+MVL KM++IAEAY+G+ V++
Sbjct  113  VQADKKLLPYEIVN-KDGKPVIQVTVKGQTKLFSPEEISAMVLGKMKQIAEAYLGRDVRD  171

Query  104  AVMTVPAYFNDLQR  117
            AV+TVPAYFND QR
Sbjct  172  AVVTVPAYFNDAQR  185

>PYIW_26567
Length=564

 Score = 69.7 bits (169),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/74 (46%), Positives = 50/74 (68%), Gaps = 1/74 (1%)

Query  44   LQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKN  103
            +QA+ K  P  + +    +  I V  K E   F P EIS+M+L KM++IAE+Y+G++V +
Sbjct  110  VQADKKLLPYHIVN-KDGKPMIEVLIKGEKKLFSPEEISAMILTKMKQIAESYLGREVHD  168

Query  104  AVMTVPAYFNDLQR  117
            A++TVPAYFND QR
Sbjct  169  AIVTVPAYFNDAQR  182

>PPTG_08245
Length=658

 Score = 69.3 bits (168),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 36/74 (49%), Positives = 50/74 (68%), Gaps = 1/74 (1%)

Query  44   LQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKN  103
            +QA+ K  P  L +    +  I V+ K E   F P E+S+MVL KM++I+E YIG++V +
Sbjct  109  VQADKKLLPYNLVN-KDGKPFIEVEVKGEKRQFAPEEVSAMVLTKMKQISEGYIGREVFD  167

Query  104  AVMTVPAYFNDLQR  117
            AV+TVPAYFND QR
Sbjct  168  AVVTVPAYFNDAQR  181

>PHYKE_7992
Length=657

 Score = 69.3 bits (168),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 37/81 (46%), Positives = 52/81 (64%), Gaps = 1/81 (1%)

Query  37   KKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAY  96
            +K     +QA+ K  P  L +    +  I V+ K E   F P E+S+MVL KM++I+E Y
Sbjct  101  RKYTDKSVQADKKLLPYDLIN-KDGKPFIQVEVKGEKRQFAPEEVSAMVLTKMKQISEGY  159

Query  97   IGKQVKNAVMTVPAYFNDLQR  117
            IG++V +AV+TVPAYFND QR
Sbjct  160  IGREVFDAVVTVPAYFNDAQR  180

>PHYCA_510696
Length=659

 Score = 68.9 bits (167),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 35/74 (47%), Positives = 51/74 (69%), Gaps = 1/74 (1%)

Query  44   LQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKN  103
            +QA+ K  P ++ +    +  I V+ K E   F P E+S+MVL KM++I+E YIG++V +
Sbjct  108  VQADKKLLPYEIVN-KEGKPFIEVEVKGEKRQFAPEEVSAMVLTKMKQISEGYIGREVFD  166

Query  104  AVMTVPAYFNDLQR  117
            AV+TVPAYFND QR
Sbjct  167  AVVTVPAYFNDAQR  180

>PHALS_00833
Length=652

 Score = 68.2 bits (165),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 36/74 (49%), Positives = 50/74 (68%), Gaps = 1/74 (1%)

Query  44   LQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKN  103
            +QA+ K  P +L +    +  I V  K E   F P E+S+MVL KM++I+E YIG++V +
Sbjct  108  VQADKKLLPYELVN-KDGKPFIQVVIKGEKRQFAPEEVSAMVLSKMKQISEGYIGREVFD  166

Query  104  AVMTVPAYFNDLQR  117
            AV+TVPAYFND QR
Sbjct  167  AVVTVPAYFNDAQR  180

>PHYRA_71042
Length=654

 Score = 67.8 bits (164),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 41/53 (77%), Gaps = 0/53 (0%)

Query  65   ITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQR  117
            I V+ K E   F P E+S+MVL KM++I+E YIG++V +AV+TVPAYFND QR
Sbjct  125  IQVEVKGEKREFAPEEVSAMVLTKMKQISEGYIGREVFDAVVTVPAYFNDAQR  177

>PHYSO_525236
Length=246

 Score = 66.6 bits (161),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 54/102 (53%), Gaps = 4/102 (4%)

Query  31   LINVLIKKEASLVLQANVKHWPLKLT----SVASNRLQITVQFKRESNTFQPGEISSMVL  86
            +  +L +K +   +Q  +KHWP K+             + VQF+ ++  F P +I S++L
Sbjct  74   ITRLLGRKFSDPEVQERIKHWPFKVIRGPHDTPPPPPHVMVQFRGQTKIFHPVQILSLLL  133

Query  87   IKMREIAEAYIGKQVKNAVMTVPAYFNDLQRTLSSLAQAYIE  128
             +MR I E Y GK+   AV+TVPA+FN  QR     A A  E
Sbjct  134  SEMRGIVETYTGKEATTAVVTVPAHFNYSQRQAVKDAGAIAE  175

>PYU1_G004098
Length=656

 Score = 67.4 bits (163),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 34/74 (46%), Positives = 49/74 (66%), Gaps = 1/74 (1%)

Query  44   LQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKN  103
            +QA+ K  P ++ +    +  I V  K E   F P E+S+M+L KM++ AE YIG++V +
Sbjct  108  VQADKKLLPYEIVN-KDGKPVIQVTVKGEKKHFSPEEVSAMILTKMKQTAEGYIGREVFD  166

Query  104  AVMTVPAYFNDLQR  117
            AV+TVPAYFND QR
Sbjct  167  AVVTVPAYFNDAQR  180

>CCA24936
Length=661

 Score = 66.2 bits (160),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 42/103 (41%), Positives = 62/103 (60%), Gaps = 4/103 (4%)

Query  18   SSKGRSIASIGNTLINV---LIKKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESN  74
            ++K ++I +   T+ +V   + +K     +QA+ K  P ++ +    +  I V  K E  
Sbjct  82   AAKNQAIHNPEQTIFDVKRLIGRKFTDKSVQADKKLLPYEIIN-KDGKPFIRVTIKDEQK  140

Query  75   TFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQR  117
             F P EIS+MVL KM++IAE  IG  VK+AV+TVPAYFND QR
Sbjct  141  VFAPEEISAMVLQKMKDIAEKVIGTTVKDAVVTVPAYFNDAQR  183

>CCI50234
Length=665

 Score = 65.5 bits (158),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 37/74 (50%), Positives = 48/74 (65%), Gaps = 1/74 (1%)

Query  44   LQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKN  103
            +QA+ K  P ++ +    +  I V  K E   F P EIS+MVL KM++IAE  IG  VK+
Sbjct  115  VQADKKLLPYEIIN-KDGKPFIRVTVKGEQKVFAPEEISAMVLQKMKDIAEKVIGTTVKD  173

Query  104  AVMTVPAYFNDLQR  117
            AV+TVPAYFND QR
Sbjct  174  AVVTVPAYFNDAQR  187

>PHYSO_339666
Length=585

 Score = 65.1 bits (157),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 31/74 (42%), Positives = 47/74 (64%), Gaps = 0/74 (0%)

Query  44   LQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKN  103
            L+ +V  WP K+     +  Q+ VQ+K E+ +F P EI +++L +MR+IAE Y+ ++V  
Sbjct  79   LRESVIDWPFKVECGPEDTPQVVVQYKGETKSFMPVEIMAILLYEMRKIAEIYLDQEVTK  138

Query  104  AVMTVPAYFNDLQR  117
            AV TVP  FN  QR
Sbjct  139  AVFTVPGSFNYFQR  152

>PYAR_24687
Length=618

 Score = 61.2 bits (147),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 27/57 (47%), Positives = 42/57 (74%), Gaps = 0/57 (0%)

Query  61   NRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQR  117
            N+  I V+ K E+  F   E+++MVL +M++ AEAY+G++++NAV+TVPA F D QR
Sbjct  136  NKPFIQVEMKGETREFSVEEVTAMVLTRMKQFAEAYLGEEIENAVVTVPASFEDAQR  192

>PHALS_07616
Length=677

 Score = 59.3 bits (142),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 0/42 (0%)

Query  76   FQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQR  117
            + P +I SMVL KM+E A+ ++GK +  AV+TVPAYFND QR
Sbjct  161  YSPSQIGSMVLTKMKETADGFLGKPITQAVITVPAYFNDSQR  202

>SPRG_02294
Length=634

 Score = 58.9 bits (141),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 0/42 (0%)

Query  76   FQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQR  117
            + P +I SMVL KM+E A+ ++GK +  AV+TVPAYFND QR
Sbjct  133  YSPSQIGSMVLTKMKETADGFLGKTITQAVVTVPAYFNDSQR  174

>SDRG_11043
Length=649

 Score = 58.9 bits (141),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 0/42 (0%)

Query  76   FQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQR  117
            + P +I SMVL KM+E A+ ++GK +  AV+TVPAYFND QR
Sbjct  133  YSPSQIGSMVLTKMKETADGFLGKTITQAVVTVPAYFNDSQR  174

>H310_06631
Length=651

 Score = 58.5 bits (140),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 33/46 (72%), Gaps = 0/46 (0%)

Query  72   ESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQR  117
            +   + P +I SMVL KM+E AE ++GK +  AV+TVPAYFND QR
Sbjct  130  QGQKYSPSQIGSMVLTKMKETAEGFLGKTITQAVVTVPAYFNDSQR  175

>CCI45982
Length=661

 Score = 58.5 bits (140),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 33/42 (79%), Gaps = 0/42 (0%)

Query  76   FQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQR  117
            + P +I SMVL KM+E A++++G+ V  AV+TVPAYFND QR
Sbjct  142  YSPSQIGSMVLAKMKETADSFLGQSVSQAVITVPAYFNDSQR  183

>H257_01277
Length=652

 Score = 58.5 bits (140),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 33/46 (72%), Gaps = 0/46 (0%)

Query  72   ESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQR  117
            +   + P +I SMVL KM+E AE ++GK +  AV+TVPAYFND QR
Sbjct  130  QGQKYSPSQIGSMVLTKMKETAEGFLGKTITQAVVTVPAYFNDSQR  175

>PYVX_15051
Length=632

 Score = 58.2 bits (139),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 32/42 (76%), Gaps = 0/42 (0%)

Query  76   FQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQR  117
            + P +I SMVL KM+E AE ++GK +  AV+TVPAYFND QR
Sbjct  117  YSPSQIGSMVLTKMKETAEGFLGKSITQAVVTVPAYFNDSQR  158

>CCA21514
Length=659

 Score = 58.2 bits (139),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 33/42 (79%), Gaps = 0/42 (0%)

Query  76   FQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQR  117
            + P +I SMVL KM+E A++++G+ V  AV+TVPAYFND QR
Sbjct  141  YSPSQIGSMVLGKMKETADSFLGQSVSQAVITVPAYFNDSQR  182

>PHYSO_500480
Length=633

 Score = 58.2 bits (139),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 32/42 (76%), Gaps = 0/42 (0%)

Query  76   FQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQR  117
            + P +I SMVL KM+E A+ ++GK V  AV+TVPAYFND QR
Sbjct  117  YSPSQIGSMVLTKMKETADGFLGKHVTQAVVTVPAYFNDSQR  158

>PYAP_19738
Length=648

 Score = 58.2 bits (139),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 33/42 (79%), Gaps = 0/42 (0%)

Query  76   FQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQR  117
            + P +I SMVL KM+E A++++GK V  AV+TVPAYFND QR
Sbjct  135  YSPSQIGSMVLTKMKETADSFLGKSVSQAVVTVPAYFNDSQR  176

>PYU1_G003754
Length=650

 Score = 57.4 bits (137),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 32/42 (76%), Gaps = 0/42 (0%)

Query  76   FQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQR  117
            + P +I SMVL KM+E A+ ++GK V  AV+TVPAYFND QR
Sbjct  136  YSPSQIGSMVLTKMKETADGFLGKSVTQAVVTVPAYFNDSQR  177

>PPTG_18274
Length=648

 Score = 57.4 bits (137),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 32/42 (76%), Gaps = 0/42 (0%)

Query  76   FQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQR  117
            + P +I SMVL KM+E A+ ++GK V  AV+TVPAYFND QR
Sbjct  133  YSPSQIGSMVLTKMKETADGFLGKPVTQAVVTVPAYFNDSQR  174

>PHYRA_71123
Length=633

 Score = 56.6 bits (135),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 0/42 (0%)

Query  76   FQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQR  117
            + P +I SMVL KM+E A+ ++GK +  AV+TVPAYFND QR
Sbjct  117  YSPSQIGSMVLTKMKETADGFLGKPITQAVVTVPAYFNDSQR  158

>PYIR_19697
Length=608

 Score = 56.6 bits (135),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 0/42 (0%)

Query  76   FQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQR  117
            + P +I SMVL KM+E A+ ++GK +  AV+TVPAYFND QR
Sbjct  93   YSPSQIGSMVLTKMKETADGFLGKTITQAVVTVPAYFNDSQR  134

>PHYCA_541134
Length=633

 Score = 56.6 bits (135),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 0/42 (0%)

Query  76   FQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQR  117
            + P +I SMVL KM+E A+ ++GK +  AV+TVPAYFND QR
Sbjct  117  YSPSQIGSMVLTKMKETADGFLGKPITQAVVTVPAYFNDSQR  158

>PITG_15786
Length=633

 Score = 56.6 bits (135),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 0/42 (0%)

Query  76   FQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQR  117
            + P +I SMVL KM+E A+ ++GK +  AV+TVPAYFND QR
Sbjct  117  YSPSQIGSMVLTKMKETADGFLGKPITQAVVTVPAYFNDSQR  158

>PHYKE_9008
Length=650

 Score = 56.6 bits (135),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 0/42 (0%)

Query  76   FQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQR  117
            + P +I SMVL KM+E A+ ++GK +  AV+TVPAYFND QR
Sbjct  134  YSPSQIGSMVLTKMKETADGFLGKPITQAVVTVPAYFNDSQR  175

>PPTG_17083
Length=304

 Score = 56.2 bits (134),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 34/38 (89%), Gaps = 0/38 (0%)

Query  80   EISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQR  117
            EISSMV+++M+E+AEA++G+++  AV+T PAYFN+ QR
Sbjct  23   EISSMVVLRMKEMAEAFLGQRISQAVVTAPAYFNNQQR  60

>PYAR_22188
Length=634

 Score = 56.2 bits (134),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 0/42 (0%)

Query  76   FQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQR  117
            + P +I SMVL KM+E A+ ++GK +  AV+TVPAYFND QR
Sbjct  93   YSPSQIGSMVLTKMKETADGFLGKPITQAVVTVPAYFNDSQR  134

>PPTG_04054
Length=324

 Score = 54.7 bits (130),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 33/38 (87%), Gaps = 0/38 (0%)

Query  80   EISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQR  117
            EISSMV+++M E+AEA++G+++  AV+T PAYFN+ QR
Sbjct  29   EISSMVVLRMSEMAEAFLGQRISQAVVTAPAYFNNQQR  66

>PYIR_16737
Length=511

 Score = 53.5 bits (127),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 30/34 (88%), Gaps = 0/34 (0%)

Query  84   MVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQR  117
            M+L KM+++AE YIG++V +AV+TVPAYFND QR
Sbjct  1    MILTKMKQVAEGYIGREVFDAVVTVPAYFNDAQR  34

>SPRG_00183
Length=609

 Score = 52.8 bits (125),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 33/113 (29%), Positives = 60/113 (53%), Gaps = 1/113 (1%)

Query  5    TKSSFLAGQQPKRSSKGRSIASIGNTLINVLIKKEASLVLQANVKHWPLKLTSVASNRLQ  64
            T ++ L G Q K  ++      + N L ++L ++     +QA V   P ++ + +     
Sbjct  45   TDTTTLFGNQAKAIAQNDPTNVVFNVL-HLLGRRMNDPTVQAMVTSAPFRIIASSDKTPL  103

Query  65   ITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQR  117
            I VQ +R + T+ P EI  M+L   +++AE ++G  + +AV+TVPA +   QR
Sbjct  104  IHVQHRRSACTYYPQEIVGMLLEHAKKLAEDHLGACLDHAVVTVPATYTTSQR  156

>SDRG_05816
Length=479

 Score = 52.0 bits (123),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 0/42 (0%)

Query  84   MVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQRTLSSLAQA  125
            MVL +M+E AE Y+G+++K AV+TVPAYFND QR  +  A A
Sbjct  1    MVLTRMKETAENYLGQEIKQAVVTVPAYFNDQQRQSTKDAGA  42

>SPRG_15695
Length=581

 Score = 52.0 bits (123),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 32/93 (34%), Positives = 47/93 (51%), Gaps = 0/93 (0%)

Query  31   LINVLIKKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMR  90
            L  VL KK + +     +K W   + + A       V  K         E +S+VL K++
Sbjct  93   LKRVLGKKHSDVKSLDYIKGWSFDVKADAKGHAVAAVTHKEAKREISATEFASLVLGKLK  152

Query  91   EIAEAYIGKQVKNAVMTVPAYFNDLQRTLSSLA  123
             +AE Y G QVKN V+TVP  F++ Q+TL + A
Sbjct  153  ALAEDYTGVQVKNCVLTVPQEFSEEQKTLMNEA  185

>PHYRA_79054
Length=563

 Score = 51.6 bits (122),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/53 (49%), Positives = 40/53 (75%), Gaps = 4/53 (8%)

Query  77   QPGEISSMVLIKMREIAEAYI--GKQVKNAVMTVPAYFNDLQR--TLSSLAQA  125
            QP E+S+ VLI+++  AEAY   G++++N V+TVPAYF+D QR  T++S + A
Sbjct  139  QPEEVSACVLIELKASAEAYFEDGRRLENVVITVPAYFSDSQRKATITSASMA  191

>SDRG_10038
Length=565

 Score = 51.6 bits (122),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 32/93 (34%), Positives = 47/93 (51%), Gaps = 0/93 (0%)

Query  31   LINVLIKKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMR  90
            L  VL KK + +     +K W   + + A       V  K         E +S+VL K++
Sbjct  67   LKRVLGKKHSDVKSLDYIKGWSFDVKADAKGHAVAAVTHKEAKRDVSATEFASLVLGKLK  126

Query  91   EIAEAYIGKQVKNAVMTVPAYFNDLQRTLSSLA  123
             +AE Y G QVKN V+TVP  F++ Q+TL + A
Sbjct  127  ALAEDYTGVQVKNCVLTVPQEFSEEQKTLMNEA  159

>PYIR_13638
Length=543

 Score = 50.4 bits (119),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 34/116 (29%), Positives = 60/116 (52%), Gaps = 6/116 (5%)

Query  16   KRSSKGRSIASIGNTLINV---LIKKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRE  72
            KR++     A +GNT+ ++   + +K  S   +        K+ +       + V   ++
Sbjct  55   KRTTPSVETAPVGNTIRSIKRLMGQKYTSKAAEVAKSFGTYKIAATKQGSAAVQVVRAQK  114

Query  73   SNTFQPGEISSMVLIKMREIAEAYI-GKQVKNAVMTVPAYFNDLQR--TLSSLAQA  125
              T +P E+S+ +L  ++  AE Y   K++ N V+TVPAYFND QR  T++S + A
Sbjct  115  LVTVEPEEVSACILSDLKASAEVYFDNKRIDNVVITVPAYFNDSQRKATITSASMA  170

>PYU1_G002895
Length=561

 Score = 50.1 bits (118),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 33/105 (31%), Positives = 56/105 (53%), Gaps = 6/105 (6%)

Query  27   IGNTLINV---LIKKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISS  83
            +GNT+ ++   + +K AS  ++         + S       + V    +    QP E+S+
Sbjct  86   VGNTVRSIKRLMGQKYASKAVEVAKSFGTYTVASTKQGNAAVQVVRNEKPALLQPEEVSA  145

Query  84   MVLIKMREIAEAYI-GKQVKNAVMTVPAYFNDLQR--TLSSLAQA  125
             +L  ++  AEAY  GK++ N V+TVPAYF+D QR  T++S + A
Sbjct  146  CILSDLKASAEAYFDGKRIDNVVITVPAYFSDSQRKATITSASMA  190

>PYIW_17320
Length=563

 Score = 49.7 bits (117),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 45/75 (60%), Gaps = 5/75 (7%)

Query  56   TSVASNRLQITVQFKRESNT--FQPGEISSMVLIKMREIAEAYIG-KQVKNAVMTVPAYF  112
            T  A+ +    VQ  R + T   QP E+++ +L  ++  AEAY   K++ N V+TVPAYF
Sbjct  116  TITATKQGGAAVQVVRANKTAVVQPEEVAACILADLKASAEAYFDDKRIDNVVITVPAYF  175

Query  113  NDLQR--TLSSLAQA  125
            ND QR  TL+S + A
Sbjct  176  NDSQRKATLTSASMA  190

>PYAP_19903
Length=527

 Score = 49.3 bits (116),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 35/48 (73%), Gaps = 1/48 (2%)

Query  77   QPGEISSMVLIKMREIAEAYIG-KQVKNAVMTVPAYFNDLQRTLSSLA  123
            QP E+SS VL++++  AEAY   ++V N V+TVPAYFND QR  + L+
Sbjct  103  QPEEVSSHVLMELKASAEAYWDDERVDNVVITVPAYFNDSQRKATILS  150

>H257_01680
Length=571

 Score = 48.9 bits (115),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/66 (36%), Positives = 40/66 (61%), Gaps = 1/66 (2%)

Query  64   QITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQRTLSSLA  123
             + +    + +   P E+S+++L  +++ AE  +G QV N V+TVPAYFN+ QR  S+L 
Sbjct  121  HVAIDLPSKESIATPSEVSAILLKYIKDTAEDKLGHQVFNCVLTVPAYFNESQRQ-STLK  179

Query  124  QAYIEG  129
             A + G
Sbjct  180  AATMAG  185

>SDRG_16621
Length=531

 Score = 48.1 bits (113),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 48/79 (61%), Gaps = 4/79 (5%)

Query  49   KHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTV  108
            K+   KL    S  + I +  ++ S T  P E+++++L ++++ AEA + +++ N V+TV
Sbjct  70   KYLSYKLCEGESGHVSIALPARKTSVT--PSEVAALLLSELKKAAEAKLNERIANCVLTV  127

Query  109  PAYFNDLQR--TLSSLAQA  125
            PAYF + QR  TL + A A
Sbjct  128  PAYFTEPQRQATLEAAAMA  146

>H310_03911
Length=570

 Score = 47.8 bits (112),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/68 (34%), Positives = 39/68 (57%), Gaps = 2/68 (3%)

Query  64   QITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQR--TLSS  121
             + +    +     P E+S+++L  +++  E  +G QV N V+TVPA+FN+ QR  TL +
Sbjct  121  HVAIDLPSKKTVVAPSEVSAILLKYIKDTTEEKLGHQVVNCVLTVPAHFNESQRQATLKA  180

Query  122  LAQAYIEG  129
             A A  +G
Sbjct  181  AAMAGFQG  188

>PYAR_14579
Length=567

 Score = 47.8 bits (112),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 43/73 (59%), Gaps = 7/73 (10%)

Query  58   VASNRLQITVQFKRESN---TFQPGEISSMVLIKMREIAEAYI----GKQVKNAVMTVPA  110
            VA+ +    VQ +R  +     QP EI++ VL +++  AEAY      K++ N V+TVPA
Sbjct  116  VATAQGNAAVQVQRGGDGVIAVQPEEIAAEVLRELKASAEAYWEQTHSKRIDNVVITVPA  175

Query  111  YFNDLQRTLSSLA  123
            YFND QR  + L+
Sbjct  176  YFNDSQRKATILS  188

>SPRG_01255
Length=566

 Score = 47.4 bits (111),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 21/64 (33%), Positives = 39/64 (61%), Gaps = 2/64 (3%)

Query  64   QITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQR--TLSS  121
             +++       +  P E+++++L K++  AEA + +++ N V+TVPAYF + QR  TL +
Sbjct  124  HVSIALPARKTSVTPSEVAALLLSKLKAAAEAKLNERIANCVLTVPAYFTEPQRQATLEA  183

Query  122  LAQA  125
             A A
Sbjct  184  AAMA  187

>CCA22305
Length=561

 Score = 47.0 bits (110),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 21/44 (48%), Positives = 33/44 (75%), Gaps = 1/44 (2%)

Query  75   TFQPGEISSMVLIKMREIAEAYIG-KQVKNAVMTVPAYFNDLQR  117
            + +P E+++ +LIK++  AEAY   K ++N V+TVPA+FND QR
Sbjct  144  SVEPEEVAAHILIKLKARAEAYFDHKAIENVVLTVPAHFNDGQR  187

>PPTG_05819
Length=561

 Score = 47.0 bits (110),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 26/53 (49%), Positives = 36/53 (68%), Gaps = 4/53 (8%)

Query  77   QPGEISSMVLIKMREIAEAYIGKQVK--NAVMTVPAYFNDLQR--TLSSLAQA  125
            QP E+S+ VL +++  AEAY   Q K  N V+TVPAYF+D QR  T++S + A
Sbjct  138  QPEEVSACVLRELKASAEAYFDGQTKLDNVVITVPAYFSDAQRRATITSASMA  190

>PHYSO_493381
Length=562

 Score = 47.0 bits (110),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 26/53 (49%), Positives = 36/53 (68%), Gaps = 4/53 (8%)

Query  77   QPGEISSMVLIKMREIAEAYIGKQVK--NAVMTVPAYFNDLQR--TLSSLAQA  125
            QP E+S+ VL +++  AEAY    VK  N V+TVPAYF+D QR  T++S + A
Sbjct  139  QPEEVSACVLAELKASAEAYFDGSVKLDNVVITVPAYFSDSQRKATITSASMA  191

>PHYCA_6458
Length=560

 Score = 46.2 bits (108),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 6/53 (11%)

Query  77   QPGEISSMVLIKMREIAEAYIGKQVK--NAVMTVPAYFNDLQR----TLSSLA  123
            QP E+S+ +L +++  AE Y   QVK  N V+TVPAYF+D QR    T +S+A
Sbjct  137  QPEEVSACILTELKASAEGYFDGQVKLDNVVITVPAYFSDSQRKATITAASMA  189

>PHYKE_7077
Length=631

 Score = 45.4 bits (106),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 28/69 (41%), Positives = 45/69 (65%), Gaps = 8/69 (12%)

Query  65   ITVQFKR---ESNTFQPGEISSMVLIKMREIAEAYI--GK-QVKNAVMTVPAYFNDLQR-  117
            + +Q +R   ++   QP E+S+ VL +++  AEAY   GK ++ N V+TVPAYF+D QR 
Sbjct  257  VAIQVERGGKKAVVIQPEEVSACVLAELKASAEAYFEDGKTRLDNVVITVPAYFSDSQRK  316

Query  118  -TLSSLAQA  125
             T++S + A
Sbjct  317  ATITSASMA  325

>PHALS_02692
Length=557

 Score = 45.4 bits (106),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/55 (42%), Positives = 36/55 (65%), Gaps = 3/55 (5%)

Query  77   QPGEISSMVLIKMREIAEAYIGKQVK--NAVMTVPAYFNDLQRTLSSLAQAYIEG  129
            QP E+S+ +L +++  AEAY   Q +  N V+TVPAYF+D QR  +++  A + G
Sbjct  134  QPEEVSAYILTELKTSAEAYFDGQTRLNNVVITVPAYFSDAQRK-ATITSALMAG  187

>CCI45261
Length=558

 Score = 45.4 bits (106),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/49 (41%), Positives = 35/49 (71%), Gaps = 1/49 (2%)

Query  70   KRESNTFQPGEISSMVLIKMREIAEAYIG-KQVKNAVMTVPAYFNDLQR  117
            K + +  +P ++++ +L+K++  AEAY   K ++N V+TVPA+FND QR
Sbjct  137  KNDESIVEPEQVAACILLKLKAKAEAYFDHKIIENVVLTVPAHFNDGQR  185

>HYAP_01857
Length=492

 Score = 45.1 bits (105),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 4/53 (8%)

Query  77   QPGEISSMVLIKMREIAEAYIGKQ--VKNAVMTVPAYFNDLQR--TLSSLAQA  125
            QP E+ + VL +++  AEAY   Q  + N V+TVPAYF+D QR  TL+S + A
Sbjct  82   QPEEVVASVLAELKASAEAYFDGQLSIDNVVITVPAYFSDSQRKATLTSASMA  134

>PPTG_22662
Length=362

 Score = 44.7 bits (104),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 23/25 (92%), Gaps = 0/25 (0%)

Query  92   IAEAYIGKQVKNAVMTVPAYFNDLQ  116
            +AEA+IGK++KN V+TVPAYFND Q
Sbjct  225  LAEAFIGKEMKNIVVTVPAYFNDSQ  249

>PYIR_25979
Length=438

 Score = 44.7 bits (104),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 30/126 (24%), Positives = 65/126 (52%), Gaps = 12/126 (10%)

Query  3    NVTKSSFLAGQQPKRSSKGRSIASIGNTLINVLIKKEASLVLQANVKHWPLKLTSVASNR  62
            + T S FL G   +R ++    +++ +  + ++ +K   L  Q  +  WP K+    +++
Sbjct  79   SATDSGFLVGADARRRARSGDPSTVFD-FVRLVGRKIEDLSSQDILCKWPFKVVPGENDK  137

Query  63   --LQITVQFKRES---------NTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAY  111
              ++I+    ++S          TF P E+ + +++K+++ AEA +  +V++ V+ VP  
Sbjct  138  AMIEISAIDTKDSASTSTSDVIRTFHPEELVAALIMKIKQKAEALVSAKVESTVVCVPGG  197

Query  112  FNDLQR  117
            FN  QR
Sbjct  198  FNHSQR  203

>HYAP_01856
Length=289

 Score = 44.7 bits (104),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 4/53 (8%)

Query  77   QPGEISSMVLIKMREIAEAYIGKQ--VKNAVMTVPAYFNDLQR--TLSSLAQA  125
            QP E+ + VL +++  AEAY   Q  + N V+TVPAYF+D QR  TL+S + A
Sbjct  92   QPEEVVASVLAELKASAEAYFDGQLSIDNVVITVPAYFSDSQRKATLTSASMA  144

>PHYSO_552116
Length=570

 Score = 44.7 bits (104),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 46/84 (55%), Gaps = 0/84 (0%)

Query  31   LINVLIKKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMR  90
            L  +L K  A +  +  VK WP  +T+ A    Q   Q   E +   P E  +++L  ++
Sbjct  67   LKRLLGKAHADVADRDFVKEWPFDITAGADGVAQAETQRNGEKHPVSPVEFMALLLQNLK  126

Query  91   EIAEAYIGKQVKNAVMTVPAYFND  114
            ++AE + G+++++ V++ PA+ +D
Sbjct  127  DLAEDFTGEKLEHVVISKPAHTDD  150

>PPTG_18280
Length=384

 Score = 44.7 bits (104),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 46/83 (55%), Gaps = 2/83 (2%)

Query  47   NVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVM  106
            + +H+P +L   A+    I+++  ++  TF   E+ +MV    R+I + +    VK+ V+
Sbjct  109  DEEHFPYELVQNATRGGTISLKHGKD-QTFHAEELVAMVFAHARQITDTFAEAAVKDWVL  167

Query  107  TVPAYFNDLQRTLSSLAQAYIEG  129
            TVPA+F+  QR  + L  A I G
Sbjct  168  TVPAFFSQAQRQ-AMLDAAEISG  189

>PITG_16528
Length=561

 Score = 44.3 bits (103),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 24/55 (44%), Positives = 36/55 (65%), Gaps = 3/55 (5%)

Query  77   QPGEISSMVLIKMREIAEAYIGKQVK--NAVMTVPAYFNDLQRTLSSLAQAYIEG  129
            QP E+S+ VL +++  A+AY     K  N V+TVPAYF+D QR  +++A A + G
Sbjct  138  QPEEVSACVLRELKASADAYFDGHTKLDNVVITVPAYFSDTQRK-ATIASASMAG  191

>PHYSO_321565
Length=697

 Score = 43.9 bits (102),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 27/89 (30%), Positives = 50/89 (56%), Gaps = 5/89 (6%)

Query  32   INVLIKKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNT---FQPGEISSMVLIK  88
            + +L+ K+   + Q +V+ W   L S  +++    V+   +SNT     P ++ S +L  
Sbjct  109  LTMLLGKKLDALRQRDVERWAFILRSGVADK--AVVECPTKSNTPDLAYPEQLVSKLLST  166

Query  89   MREIAEAYIGKQVKNAVMTVPAYFNDLQR  117
            +++ AE + GK+V  AV++VPA +N  QR
Sbjct  167  IKQRAEVFTGKRVTGAVLSVPAAYNRTQR  195

>PHYRA_71591
Length=570

 Score = 43.5 bits (101),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 48/95 (51%), Gaps = 0/95 (0%)

Query  31   LINVLIKKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMR  90
            L  +L K  A +  +  VK WP  +T+ A    Q   Q   E +   P E  +++L  ++
Sbjct  67   LKRLLGKAHADVSDRDYVKEWPFNVTAGADGVAQAETQRNGEKHPVTPVEFMALLLQNLK  126

Query  91   EIAEAYIGKQVKNAVMTVPAYFNDLQRTLSSLAQA  125
            E+AE + G+++++ V+  PA+ ++    L   A A
Sbjct  127  ELAEDFTGEKLEHVVINKPAHTDESYTELLDAAAA  161

>PYU1_G008851
Length=795

 Score = 43.5 bits (101),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 40/75 (53%), Gaps = 1/75 (1%)

Query  44   LQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAY-IGKQVK  102
            +Q  +     K   + S  + I +++  E  TF   +I +MVL KM+ IA A   G Q  
Sbjct  80   VQQEIAQLAYKCVELPSGDVGIVLKYNDEDVTFSCEQIVAMVLNKMQAIAAAANDGVQPG  139

Query  103  NAVMTVPAYFNDLQR  117
             AV++VP Y+ D+QR
Sbjct  140  YAVVSVPGYYTDVQR  154

>PHYCA_504114
Length=887

 Score = 43.1 bits (100),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/71 (31%), Positives = 41/71 (58%), Gaps = 1/71 (1%)

Query  47   NVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVM  106
            + +H+P +L   A+    I+++  + S TF   E+ +MV    R+I + +    VK+ V+
Sbjct  109  DEEHFPYELVQNATRGGTISLKHGK-SQTFHAEELVAMVFAHARQITDTFAEAAVKDWVL  167

Query  107  TVPAYFNDLQR  117
            TVP++F+  QR
Sbjct  168  TVPSFFSQAQR  178

>PYIR_24123
Length=567

 Score = 42.7 bits (99),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/89 (24%), Positives = 44/89 (49%), Gaps = 0/89 (0%)

Query  31   LINVLIKKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMR  90
            L  VL K    +V +  ++ W  K+       +        E++   P E  S+++  ++
Sbjct  67   LKRVLGKNHEEIVDRDYIQEWSFKVAKSEDGAVHAATSRNGEAHHVTPVEFVSLLIKNLK  126

Query  91   EIAEAYIGKQVKNAVMTVPAYFNDLQRTL  119
            ++AE + G+ V N V+++PA+  + Q+ L
Sbjct  127  DLAEDFTGESVDNVVLSIPAHVTEKQKEL  155

>PITG_03546
Length=569

 Score = 42.7 bits (99),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/84 (29%), Positives = 46/84 (55%), Gaps = 1/84 (1%)

Query  31   LINVLIKKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMR  90
            L  +L K  A +  +  VK WP  +T   S   Q+  Q   E +   P E  +++L  ++
Sbjct  67   LNRILGKAHADIKDRDFVKEWPFDVTQ-GSEGAQVETQRNGEKHPVTPVEFMAVLLQNLK  125

Query  91   EIAEAYIGKQVKNAVMTVPAYFND  114
            E+AE + G+++++ V++ PA+ +D
Sbjct  126  ELAEDFTGEKLEHVVISKPAHTDD  149

>PYVX_13615
Length=585

 Score = 42.4 bits (98),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/47 (43%), Positives = 33/47 (70%), Gaps = 1/47 (2%)

Query  72   ESNTFQPGEISSMVLIKMREIAEAYIGKQ-VKNAVMTVPAYFNDLQR  117
            +++T  P ++S+ VL +++  AEAY   + + + V+TVPAYFND QR
Sbjct  136  KTDTVLPEDVSAAVLSELKASAEAYYQDESIDHVVITVPAYFNDSQR  182

>H310_12765
Length=560

 Score = 42.4 bits (98),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 29/89 (33%), Positives = 41/89 (46%), Gaps = 2/89 (2%)

Query  31   LINVLIKKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMR  90
            L  VL KK   +     VK W   L   A        +    S      E  ++VL K++
Sbjct  67   LKRVLGKKHKDVHAHEYVKDWSFDLA--ADKHGAPIAKILDGSRDIHAVEFCTIVLRKLK  124

Query  91   EIAEAYIGKQVKNAVMTVPAYFNDLQRTL  119
             +AE Y G  VKN+V+TVP  ++D Q+ L
Sbjct  125  ALAEDYTGSSVKNSVLTVPEGYSDEQKAL  153

>HYAP_07918
Length=897

 Score = 42.0 bits (97),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 23/69 (33%), Positives = 39/69 (57%), Gaps = 1/69 (1%)

Query  49   KHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTV  108
            +H+P +L S A+    I ++   ++ TF   E+ +MVL   R+I   +    VK+ V+TV
Sbjct  112  EHFPYQLVSNATRGGAIALKHANDA-TFHAEELVAMVLTHARQITNTFAEVPVKDYVLTV  170

Query  109  PAYFNDLQR  117
            P +F+  QR
Sbjct  171  PTFFSQAQR  179

>PPTG_10122
Length=569

 Score = 41.6 bits (96),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 24/84 (29%), Positives = 46/84 (55%), Gaps = 1/84 (1%)

Query  31   LINVLIKKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMR  90
            L  +L K  A +  +  VK WP  +T  A    Q+  Q   E +   P E  +++L  ++
Sbjct  67   LKRLLGKAHADVKDRDFVKEWPFDVTQGAEGA-QVETQRSGEKHPVTPVEFMAVLLQNLK  125

Query  91   EIAEAYIGKQVKNAVMTVPAYFND  114
            E+AE + G+++++ V++ PA+ +D
Sbjct  126  ELAEDFTGEKLEHVVISKPAHTDD  149

>PITG_15771
Length=883

 Score = 41.6 bits (96),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 45/83 (54%), Gaps = 2/83 (2%)

Query  47   NVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVM  106
            + +H+P +L   A+    I+++  +E  T+   E+ +MV    R+I + +    VK+ V+
Sbjct  109  DEEHFPYELIQNATRGGTISLKHGKE-QTYHAEELVAMVFTHARQITDTFAEAPVKDWVL  167

Query  107  TVPAYFNDLQRTLSSLAQAYIEG  129
            TVP +F+  QR  + L  A I G
Sbjct  168  TVPTFFSQAQRQ-AMLDAAEISG  189

>SPRG_11133
Length=676

 Score = 41.2 bits (95),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 26/73 (36%), Positives = 40/73 (55%), Gaps = 1/73 (1%)

Query  61   NRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQRTLS  120
            N   I V  K E+    P EI + +++K+++    Y   ++++AV+TVP  FN LQR   
Sbjct  96   NNPMIRVVEKGETKELHPEEILAELVVKLKDDVVTYTNARIEHAVVTVPTGFNLLQRQAV  155

Query  121  SLAQAYIEGNSKY  133
              A A I G +KY
Sbjct  156  RDACA-IAGLAKY  167

>PHYRA_73661
Length=884

 Score = 41.2 bits (95),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/71 (31%), Positives = 38/71 (54%), Gaps = 1/71 (1%)

Query  47   NVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVM  106
            + +H+P  L   AS    I+++  ++   FQ  E+ +MV    R+I   +    VK+ V+
Sbjct  108  DEEHFPYDLVQNASRGGTISLKHGKD-QAFQAEELVAMVFAHARQITNTFAEAPVKDWVL  166

Query  107  TVPAYFNDLQR  117
            TVP +F+  QR
Sbjct  167  TVPTFFSQAQR  177

>PITG_03068
Length=638

 Score = 40.4 bits (93),  Expect = 0.001, Method: Composition-based stats.
 Identities = 29/106 (27%), Positives = 52/106 (49%), Gaps = 4/106 (4%)

Query  13   QQPKRSSKGRSIASIGNTLINVLIKKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRE  72
            Q   R+  G S      T++  L +K  +L  Q +V  W   L + A+ +  +    K  
Sbjct  96   QSINRAKAGHSYTVYDLTML--LGQKTETLSAQ-DVNRWAFTLQAGAAGKAVVESPAKGN  152

Query  73   -SNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQR  117
              +   P ++++++   ++  AE + GK+V  AV+TVPA +N  QR
Sbjct  153  VPDLVYPEQVAALLFATIKNRAETFTGKRVTTAVVTVPAAYNRTQR  198

>HYAP_01993
Length=569

 Score = 40.0 bits (92),  Expect = 0.002, Method: Composition-based stats.
 Identities = 22/84 (26%), Positives = 43/84 (51%), Gaps = 0/84 (0%)

Query  31   LINVLIKKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMR  90
            L  +L K  A +  +  VK WP  +T  A    Q   Q   E +   P E   ++L  ++
Sbjct  67   LKRLLGKAHADVKDREFVKEWPFGVTEGADGVAQAETQRNGEKHAVDPVEFMMLLLQNLK  126

Query  91   EIAEAYIGKQVKNAVMTVPAYFND  114
            ++AE + G+++++ V+  PA+ ++
Sbjct  127  DLAEDFTGEKLEHVVINKPAHTDE  150

>PHYCA_532207
Length=1118

 Score = 40.4 bits (93),  Expect = 0.002, Method: Composition-based stats.
 Identities = 17/67 (25%), Positives = 38/67 (57%), Gaps = 0/67 (0%)

Query  48   VKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMT  107
            VK WP  +T  A    Q   +   E +   P E  +++L  ++++AE + G+++++ V++
Sbjct  632  VKEWPFDVTEGAEGVAQAETKRNGEKHPVTPVEFMTLLLQNLKDLAEDFTGEKLEHVVIS  691

Query  108  VPAYFND  114
             PA+ ++
Sbjct  692  KPAHTDE  698

>PYVX_17117
Length=1035

 Score = 40.0 bits (92),  Expect = 0.002, Method: Composition-based stats.
 Identities = 15/46 (33%), Positives = 32/46 (70%), Gaps = 0/46 (0%)

Query  72   ESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQR  117
            E     P ++ ++++ + ++IAE ++G++VK+ V+T+PA  N+ QR
Sbjct  578  ECQAVTPEQVLALLVARQKQIAEEFLGQEVKDVVVTLPAALNNRQR  623

>PHYKE_9011
Length=902

 Score = 40.0 bits (92),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 32/53 (60%), Gaps = 1/53 (2%)

Query  66   TVQFK-RESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQR  117
            TV  K R+ + +Q  E+ +MV    R+I + +    VK+ V+TVPA+F+  QR
Sbjct  126  TVSLKHRDGHIYQAEELVAMVFTHARQITDTFAEAAVKDWVVTVPAFFSQAQR  178

>PHYSO_255506
Length=1228

 Score = 40.0 bits (92),  Expect = 0.002, Method: Composition-based stats.
 Identities = 21/69 (30%), Positives = 39/69 (57%), Gaps = 1/69 (1%)

Query  49   KHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTV  108
            +H+P +L   A+    +++Q  ++   F   E+ +MV    R+I + +    VK+ V+TV
Sbjct  447  EHFPYQLLQNATRGGTVSLQHAKD-RVFHAEELVAMVFAHARQITDTFAEAPVKDWVLTV  505

Query  109  PAYFNDLQR  117
            PA+F+  QR
Sbjct  506  PAFFSQAQR  514

>PYU1_G000896
Length=711

 Score = 40.0 bits (92),  Expect = 0.002, Method: Composition-based stats.
 Identities = 28/123 (23%), Positives = 63/123 (51%), Gaps = 14/123 (11%)

Query  3    NVTKSSFLAGQQPKRSSKGRSIASIG--NTLINV--LIKKEASLVLQANVKHWPLKLTSV  58
            +VT + +L G      ++ R++A  G  NT+ ++  L+ ++   +  A+   WP  + + 
Sbjct  105  SVTDTGYLIG------TEARTLARRGDLNTVFDLTRLVGRKVGDLSDADQARWPFHVVAG  158

Query  59   ASNRLQITVQFKRES----NTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFND  114
              +++ + +     S        P E+ +++ ++++E AEA +  +++ AV+ VP  FN 
Sbjct  159  DHDKVLVAILGTNNSVSNPRKLYPEELLAVLFLQLKENAEALLHTKLQTAVLCVPEGFNH  218

Query  115  LQR  117
             QR
Sbjct  219  TQR  221

>PYIW_14231
Length=1243

 Score = 40.0 bits (92),  Expect = 0.002, Method: Composition-based stats.
 Identities = 27/123 (22%), Positives = 61/123 (50%), Gaps = 13/123 (11%)

Query  3    NVTKSSFLAGQQPKRSSKGRSIASIGNTLINV--LIKKEASLVLQANVKHWPLKLTSVAS  60
            +VT S F+ G + ++ +K    +   NT+ +   ++ ++ S +   ++  WP K+    +
Sbjct  56   SVTDSDFIVGSEARKRAK----SGDSNTIFDFVRIVGRKISDLNAGDLSKWPFKVVPGDN  111

Query  61   NRLQITVQFKRESNT-------FQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFN  113
            ++  + ++     +T       F P E+ ++++  ++E  E  +G  V +AV+ VP  FN
Sbjct  112  DKAVVEIRTSTNGSTASVSFRMFHPEELLAVLVRCIKEKVEMMLGAVVDSAVVCVPGGFN  171

Query  114  DLQ  116
              Q
Sbjct  172  HTQ  174

>PYU1_G006940
Length=565

 Score = 39.7 bits (91),  Expect = 0.003, Method: Composition-based stats.
 Identities = 20/89 (22%), Positives = 43/89 (48%), Gaps = 0/89 (0%)

Query  31   LINVLIKKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMR  90
            L  VL K    +V    ++ W  K++      +        E +   P E  S+++  ++
Sbjct  67   LKRVLGKNHEDVVDHDYIQEWSFKVSKADDGAVHAATSRNGEPHHVTPVEFVSLLIKNLK  126

Query  91   EIAEAYIGKQVKNAVMTVPAYFNDLQRTL  119
            ++AE + G+ V + V+++PA+  + Q+ L
Sbjct  127  DLAEDFTGEAVDSVVLSIPAHATEKQKEL  155

>PITG_21580
Length=658

 Score = 39.3 bits (90),  Expect = 0.003, Method: Composition-based stats.
 Identities = 31/120 (26%), Positives = 56/120 (47%), Gaps = 8/120 (7%)

Query  5    TKSSFLAGQQPKRSSKGRSIASIGN------TLINVLIKKEASLVLQANVKHWPLKLTSV  58
            T S  L   +P+ +    S++S          L  +L +K  +L  Q +V  W     + 
Sbjct  58   TGSVILIPLEPRSTENCYSLSSFAGHSYTVYDLTMLLGQKTETLSAQ-DVDRWAFTPQAG  116

Query  59   ASNRLQITVQFKRE-SNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQR  117
            A+ +  +    K    +   P ++++++   ++  AE + GK+V  AV+TVPA FN  QR
Sbjct  117  AAGKAVVESPAKGNVPDLVYPEQVAALLFATIKNRAETFTGKRVTTAVVTVPAAFNRTQR  176

>H257_07650
Length=563

 Score = 39.3 bits (90),  Expect = 0.003, Method: Composition-based stats.
 Identities = 29/87 (33%), Positives = 40/87 (46%), Gaps = 2/87 (2%)

Query  31   LINVLIKKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMR  90
            L  VL KK   +     VK W   L   A        +    S      E  ++VL K++
Sbjct  67   LKRVLGKKHKEVHEHDYVKDWSFDLA--ADTHGAPIAKILDGSRDISSVEFCTIVLRKLK  124

Query  91   EIAEAYIGKQVKNAVMTVPAYFNDLQR  117
             +AE Y G  VKNAV+TVP  ++D Q+
Sbjct  125  ALAEDYTGVVVKNAVLTVPEGYSDEQK  151

>SDRG_17122
Length=361

 Score = 38.9 bits (89),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 33/53 (62%), Gaps = 0/53 (0%)

Query  65   ITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQR  117
            I V  K ++    P E+ + +++K+++   AY   ++++A++TVP  FN LQR
Sbjct  27   IRVIEKGDAKELHPEEVLAELVVKLKDDVAAYTNARIEHAIVTVPTGFNLLQR  79

>PHALS_08498
Length=895

 Score = 38.9 bits (89),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 21/71 (30%), Positives = 37/71 (52%), Gaps = 1/71 (1%)

Query  47   NVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVM  106
            + +H P +L   A+    + +Q  ++   F   E+ +MV    R+I + +    VK+ V+
Sbjct  108  DEEHLPYELIQNATRGGTVMLQHGKK-QFFHAEELVAMVFTHARQITDTFAEASVKDWVL  166

Query  107  TVPAYFNDLQR  117
            TVP YF+  QR
Sbjct  167  TVPTYFSQAQR  177

>PYIW_19165
Length=1124

 Score = 38.5 bits (88),  Expect = 0.006, Method: Composition-based stats.
 Identities = 19/89 (21%), Positives = 44/89 (49%), Gaps = 0/89 (0%)

Query  31   LINVLIKKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMR  90
            L  VL K    +V +  ++ W  K+       +        +++   P E  S+++  ++
Sbjct  647  LKRVLGKNHEEIVDRDYIQEWSFKVAKSDDGAVHAATSRNGDAHHVTPVEFVSLLIKNLK  706

Query  91   EIAEAYIGKQVKNAVMTVPAYFNDLQRTL  119
            ++AE + G+ V + V+++PA+  + Q+ L
Sbjct  707  DLAEDFTGETVDDVVLSIPAHATEKQKEL  735

>PHALS_00390
Length=569

 Score = 38.1 bits (87),  Expect = 0.010, Method: Composition-based stats.
 Identities = 21/66 (32%), Positives = 40/66 (61%), Gaps = 5/66 (8%)

Query  48   VKHWPLKLTSVASNRLQITVQFKR--ESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAV  105
            VK W     SVA N   +TV+ +R  E +   P E  +++L  ++E+AE + G+++++ V
Sbjct  84   VKEWSF---SVAQNAEGVTVETQRNGEKHHVTPVEFMALLLQNLKELAEDFTGEKLEHVV  140

Query  106  MTVPAY  111
            ++ PA+
Sbjct  141  ISKPAH  146

>PPTG_09610
Length=53

 Score = 35.4 bits (80),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 26/39 (67%), Gaps = 3/39 (8%)

Query  67   VQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAV  105
            +Q K ES TF P EISSM   ++ E+ EA+I K  K+A+
Sbjct  1    MQVKGESKTFNPEEISSM---ELGEVVEAFITKGSKDAI  36

>PHYCA_111740
Length=810

 Score = 37.4 bits (85),  Expect = 0.015, Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 38/75 (51%), Gaps = 1/75 (1%)

Query  44   LQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAY-IGKQVK  102
            +Q  +K    K   +AS  + + + +  E  TF   ++ +M+L KM+ IA A   G    
Sbjct  80   VQQEIKQLAYKCVELASGDVGVVLNYNDEPVTFSCEQVVAMILNKMQSIAAAANEGVNPA  139

Query  103  NAVMTVPAYFNDLQR  117
              V++ P ++ D+QR
Sbjct  140  YCVLSCPGFYTDVQR  154

>PYAP_19741
Length=885

 Score = 37.4 bits (85),  Expect = 0.018, Method: Composition-based stats.
 Identities = 25/70 (36%), Positives = 37/70 (53%), Gaps = 2/70 (3%)

Query  61   NRLQITVQFKRESN-TFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQRTL  119
            N  + TV  K E++  F   E+ +MV    R+I +A+    VK+ V+TVP +F   QR  
Sbjct  120  NDTRGTVALKHENDQVFHAEELVAMVFTHARQITDAFAEVPVKDWVLTVPDFFTQAQRQ-  178

Query  120  SSLAQAYIEG  129
            + L  A I G
Sbjct  179  AMLDAAEISG  188

>PYVX_13288
Length=810

 Score = 37.0 bits (84),  Expect = 0.023, Method: Composition-based stats.
 Identities = 23/75 (31%), Positives = 38/75 (51%), Gaps = 1/75 (1%)

Query  44   LQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAY-IGKQVK  102
            +Q  +         +A+  + I +Q+  E  TF   +I +MVL KM+ IA A   G    
Sbjct  80   VQREIAQLAYPCVELANGDVGIVLQYNDEPVTFSCEQIVAMVLNKMQNIAAAANEGVNPA  139

Query  103  NAVMTVPAYFNDLQR  117
             AV++ P ++ D+QR
Sbjct  140  YAVLSCPGFYTDVQR  154

>PPTG_23039
Length=115

 Score = 35.4 bits (80),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 26/39 (67%), Gaps = 3/39 (8%)

Query  67   VQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAV  105
            +Q K ES TF P EISSM   +  ++ EA+I K+ K+A+
Sbjct  1    MQVKDESKTFHPEEISSM---EQDQVVEAFITKESKDAI  36

>PYVX_15061
Length=891

 Score = 36.6 bits (83),  Expect = 0.026, Method: Composition-based stats.
 Identities = 17/46 (37%), Positives = 26/46 (57%), Gaps = 0/46 (0%)

Query  72   ESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQR  117
            +   F   E+ +MV    R+I +A+    VK+ V+TVP YF+  QR
Sbjct  131  DKQLFHAEELVAMVFSHARQITDAFAEAPVKDWVVTVPVYFSQAQR  176

>PHYSO_249902
Length=130

 Score = 35.4 bits (80),  Expect = 0.030, Method: Compositional matrix adjust.
 Identities = 15/47 (32%), Positives = 27/47 (57%), Gaps = 0/47 (0%)

Query  44   LQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMR  90
            +Q  +K WP K+     ++  + V FK  S +F+  EI +M+L ++R
Sbjct  84   IQEGIKLWPFKVVCGPDDKPLVVVTFKGASKSFEAVEILAMLLSELR  130

>H310_06229
Length=800

 Score = 36.6 bits (83),  Expect = 0.032, Method: Composition-based stats.
 Identities = 21/76 (28%), Positives = 42/76 (55%), Gaps = 3/76 (4%)

Query  44   LQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKN  103
            +Q  +K++  K   + S ++ I + +     T+   ++ +M+L K++ IA A   + V+ 
Sbjct  80   VQEEIKNYGFKCVELPSGQVGIVLNYNDNPVTYTCEQVVAMMLNKLQNIA-AVANENVRP  138

Query  104  A--VMTVPAYFNDLQR  117
            A  V++ P YF D+QR
Sbjct  139  AYGVLSCPGYFTDVQR  154

>CCA21519
Length=929

 Score = 36.2 bits (82),  Expect = 0.035, Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 34/62 (55%), Gaps = 1/62 (2%)

Query  57   SVASNRLQITVQFKRESNT-FQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDL  115
            S+++N  + ++  K E    +   E+ +MV   +R+I + +    VK+ V+TVP Y+   
Sbjct  129  SLSTNEKRGSIHIKHEDEKHYHAEEVVAMVFSHVRQITDVFAETDVKDYVITVPEYYTQA  188

Query  116  QR  117
            QR
Sbjct  189  QR  190

>PYIR_18381
Length=747

 Score = 36.2 bits (82),  Expect = 0.037, Method: Composition-based stats.
 Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query  44   LQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGK-QVK  102
            +Q  +     K   + S  + I +++  E  TF   ++ +MV  KM+ IA A        
Sbjct  80   VQQEISQLAYKCVELPSGDVGIVLKYNDEDVTFSCEQVVAMVFNKMQAIAAAANDNVSPA  139

Query  103  NAVMTVPAYFNDLQR  117
             AV++VP Y+ D+QR
Sbjct  140  YAVVSVPGYYTDVQR  154

>SPRG_08060
Length=793

 Score = 36.2 bits (82),  Expect = 0.039, Method: Composition-based stats.
 Identities = 26/94 (28%), Positives = 45/94 (48%), Gaps = 2/94 (2%)

Query  37   KKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAE-A  95
            +K A+  +Q  +  +  K   + + ++ I + +     TF   ++  M L KM+ IA  A
Sbjct  73   RKFAAADVQEEIALYGFKCVELPNGQVGIVLNYNDTPTTFTCEQVVGMFLNKMQAIAAVA  132

Query  96   YIGKQVKNAVMTVPAYFNDLQRTLSSLAQAYIEG  129
              G      V++ P YF D+QR  + L+ A I G
Sbjct  133  NEGVNPAYCVISCPGYFTDMQRR-AMLSAAKIAG  165

>PHYSO_247517
Length=794

 Score = 36.2 bits (82),  Expect = 0.042, Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query  44   LQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAY-IGKQVK  102
            +Q  +     K   +AS  + I + +  E  TF   ++ +M+L KM+ IA A   G    
Sbjct  65   VQQEIAQLAYKCVELASGDVGIVLNYNDEPVTFSCEQVVAMILNKMQNIAAAANEGVNPA  124

Query  103  NAVMTVPAYFNDLQR  117
              V++ P ++ D+QR
Sbjct  125  YCVLSCPGFYTDVQR  139

>PYIW_19676
Length=664

 Score = 35.8 bits (81),  Expect = 0.049, Method: Composition-based stats.
 Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query  44   LQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGK-QVK  102
            +Q  +     K   + S  + I +++  E  TF   ++ +MV  KM+ IA A        
Sbjct  80   VQQEIAQLAYKCVELPSGDVGIVLKYNDEDVTFSCEQVVAMVFNKMQAIAAAANDNVSPA  139

Query  103  NAVMTVPAYFNDLQR  117
             AV++VP Y+ D+QR
Sbjct  140  YAVVSVPGYYTDVQR  154

>PYU1_G003764
Length=910

 Score = 35.8 bits (81),  Expect = 0.050, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 30/54 (56%), Gaps = 1/54 (2%)

Query  76   FQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQRTLSSLAQAYIEG  129
            F   E+ +MV    R+I +A+    VK+ V+TVP +F+  QR  + L  A I G
Sbjct  139  FHAEELVAMVFSHARQITDAFAEAPVKDWVITVPTFFSQAQRQ-AMLDAAEISG  191

>PPTG_19375
Length=809

 Score = 35.8 bits (81),  Expect = 0.055, Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query  44   LQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAY-IGKQVK  102
            +Q  +     K   +AS  + I + +  E  TF   ++ +M+L KM+ IA A   G    
Sbjct  80   VQQEIAQLAYKCVELASGDVGIVLNYNDEPVTFSCEQVVAMILNKMQNIAAAANEGVNPA  139

Query  103  NAVMTVPAYFNDLQR  117
              V++ P ++ D+QR
Sbjct  140  YCVLSCPGFYTDVQR  154

>SDRG_03266
Length=792

 Score = 35.8 bits (81),  Expect = 0.060, Method: Composition-based stats.
 Identities = 22/82 (27%), Positives = 39/82 (48%), Gaps = 1/82 (1%)

Query  37   KKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAE-A  95
            +K A+  +Q  +  +  K   + + ++ I + +     TF   ++  M L KM+ IA  A
Sbjct  73   RKFAAADVQEEIALYGFKCVELPNGQVGIVLNYNDTPTTFSCEQVVGMFLNKMQAIAAVA  132

Query  96   YIGKQVKNAVMTVPAYFNDLQR  117
              G      V++ P YF D+QR
Sbjct  133  NEGVNPAYCVISCPGYFTDMQR  154

>PHYKE_64
Length=569

 Score = 35.8 bits (81),  Expect = 0.060, Method: Composition-based stats.
 Identities = 21/93 (23%), Positives = 45/93 (48%), Gaps = 0/93 (0%)

Query  31   LINVLIKKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMR  90
            L  +L K  A +  +  VK WP  +   A            E +   P +  +++L  ++
Sbjct  67   LKRLLGKSHADVASRDFVKSWPFDVMEGAKGGAHAETVRNGEKHEVSPVDFMALLLQNLK  126

Query  91   EIAEAYIGKQVKNAVMTVPAYFNDLQRTLSSLA  123
            E+AE + G+ +++ V++ PA+ ++  + L + A
Sbjct  127  ELAEDFTGETLEHVVISKPAHADEKHQELLNAA  159

>PYAP_16216
Length=564

 Score = 35.4 bits (80),  Expect = 0.061, Method: Composition-based stats.
 Identities = 21/89 (24%), Positives = 42/89 (47%), Gaps = 0/89 (0%)

Query  31   LINVLIKKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMR  90
            L  VL K    +  +  V  W  +LT  A            E++   P +  S+++  ++
Sbjct  67   LKRVLGKNHEEIASRDFVSEWSFELTKGADGLAVAKTARNGEAHEVSPVDFVSILIKNLK  126

Query  91   EIAEAYIGKQVKNAVMTVPAYFNDLQRTL  119
            ++AE + G+ V + V+ +PA+  + Q+ L
Sbjct  127  DLAEDFTGETVDSIVINIPAHAGESQKEL  155

>SDRG_01828
Length=866

 Score = 35.4 bits (80),  Expect = 0.066, Method: Composition-based stats.
 Identities = 22/69 (32%), Positives = 38/69 (55%), Gaps = 2/69 (3%)

Query  49   KHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTV  108
            +++P  LT   + R  + +Q   E +TF   E+++MV    ++I   +    VK+ V+TV
Sbjct  107  EYFPYTLTKNLT-RGSVALQHSSE-HTFHAEELAAMVFGHAKQITNDFAEAPVKDWVITV  164

Query  109  PAYFNDLQR  117
            P YF + QR
Sbjct  165  PMYFAEPQR  173

>SPRG_06288
Length=869

 Score = 35.4 bits (80),  Expect = 0.072, Method: Composition-based stats.
 Identities = 22/69 (32%), Positives = 38/69 (55%), Gaps = 2/69 (3%)

Query  49   KHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTV  108
            +++P  LT   + R  + +Q   E +TF   E+++MV    ++I   +    VK+ V+TV
Sbjct  107  EYFPYTLTKNLT-RGSVALQHSSE-HTFHAEELAAMVFGHAKQITNDFAEGPVKDWVITV  164

Query  109  PAYFNDLQR  117
            P YF + QR
Sbjct  165  PMYFAEPQR  173

>PYAP_18643
Length=804

 Score = 35.0 bits (79),  Expect = 0.085, Method: Composition-based stats.
 Identities = 20/75 (27%), Positives = 38/75 (51%), Gaps = 1/75 (1%)

Query  44   LQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAY-IGKQVK  102
            +Q  +     K   + +  + + + +  E  TF   ++ +M+L KM+ IA A   G +  
Sbjct  80   VQKEIAQLAYKCVELPNGDVGVVLNYNDEPVTFTCEQVVAMILNKMQAIAAAANEGVRPA  139

Query  103  NAVMTVPAYFNDLQR  117
             AVM+ P ++ D+QR
Sbjct  140  YAVMSCPGFYTDVQR  154

>PYIR_24220
Length=908

 Score = 35.0 bits (79),  Expect = 0.096, Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 26/42 (62%), Gaps = 0/42 (0%)

Query  76   FQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQR  117
            F   E+ +MV    R+I +A+    VK+ V+TVP++F+  QR
Sbjct  139  FHAEELVAMVFSHARQITDAFAEAPVKDWVITVPSFFSQAQR  180

>H257_16484
Length=795

 Score = 35.0 bits (79),  Expect = 0.10, Method: Composition-based stats.
 Identities = 19/75 (25%), Positives = 39/75 (52%), Gaps = 1/75 (1%)

Query  44   LQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAE-AYIGKQVK  102
            +Q  ++++  K   + S ++ I + +     T+   ++ +M+L K++ IA  A  G    
Sbjct  80   VQEEIQNYGFKCVELPSGQVGIVLNYNDNPVTYSCEQVVAMMLNKLQNIAAVANDGVNPA  139

Query  103  NAVMTVPAYFNDLQR  117
              V++ P YF D+QR
Sbjct  140  YGVLSCPGYFTDVQR  154

>CCA15913
Length=857

 Score = 34.7 bits (78),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query  44   LQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIA-EAYIGKQVK  102
            +QA +     K   +A+  + I +++     TF   +I +M+L KM+ IA  A  G    
Sbjct  119  VQAEIAQLSFKCDEMANGDVGIVLKYNDADVTFSCEQIIAMILNKMQIIATSANEGVAPA  178

Query  103  NAVMTVPAYFNDLQR  117
              V++ P Y+ D QR
Sbjct  179  FCVVSCPGYYTDQQR  193

>H257_00287
Length=893

 Score = 34.7 bits (78),  Expect = 0.14, Method: Composition-based stats.
 Identities = 21/70 (30%), Positives = 37/70 (53%), Gaps = 4/70 (6%)

Query  49   KHWPLKLTSVASNRLQITVQFKRE-SNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMT  107
            +++P  LT    N  + +V  K +  +TF   E+ +MV    + I   +    V++ V+T
Sbjct  112  EYFPYTLTH---NETRGSVGLKHDDEHTFHAEELVAMVFTHAKTITNEFAEGPVRDWVVT  168

Query  108  VPAYFNDLQR  117
            VP+YF + QR
Sbjct  169  VPSYFAEAQR  178

>PYVX_18450
Length=386

 Score = 34.7 bits (78),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 27/41 (66%), Gaps = 1/41 (2%)

Query  78   PGEISSMVLIKMREIAEAYIG-KQVKNAVMTVPAYFNDLQR  117
            P  I S+V+  ++ +A+ ++G  Q+ NAV+ VP  FN+ QR
Sbjct  140  PVSIGSIVVRHLKTMAQRFVGHDQITNAVIAVPVDFNERQR  180

>PHYRA_82545
Length=806

 Score = 34.7 bits (78),  Expect = 0.14, Method: Composition-based stats.
 Identities = 20/75 (27%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query  44   LQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAY-IGKQVK  102
            +Q  +     K   +AS  + + + +  E  TF   ++ +M+L KM+ IA A   G    
Sbjct  80   VQQELAQLAYKCVELASGDVGVVLNYNDEPVTFSCEQVVAMILNKMQNIAAAANEGVNPA  139

Query  103  NAVMTVPAYFNDLQR  117
              V++ P ++ D+QR
Sbjct  140  YCVLSCPGFYTDVQR  154

>PHYKE_6664
Length=804

 Score = 34.3 bits (77),  Expect = 0.17, Method: Composition-based stats.
 Identities = 20/75 (27%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query  44   LQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAY-IGKQVK  102
            +Q  +     +   +AS  + I + +  E  TF   ++ +M+L KM+ IA A   G    
Sbjct  80   VQQEIAQLAYECVELASGDVGIVLSYNDEPVTFSCEQVVAMILNKMQSIAAAANEGVNPA  139

Query  103  NAVMTVPAYFNDLQR  117
              V++ P ++ D+QR
Sbjct  140  YCVLSCPGFYTDVQR  154

>PHALS_04095
Length=803

 Score = 34.3 bits (77),  Expect = 0.17, Method: Composition-based stats.
 Identities = 20/75 (27%), Positives = 36/75 (48%), Gaps = 1/75 (1%)

Query  44   LQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAY-IGKQVK  102
            +Q  +         +AS  + I + +  E  TF   ++ +M+L KM+ IA A   G    
Sbjct  80   VQKEIAQLAYTCVELASGDVGIVLNYNDEPVTFSCEQVVAMILNKMQNIASAANEGVNPA  139

Query  103  NAVMTVPAYFNDLQR  117
              V++ P ++ D+QR
Sbjct  140  YCVLSCPGFYTDVQR  154

>HYAP_04460
Length=818

 Score = 34.3 bits (77),  Expect = 0.20, Method: Composition-based stats.
 Identities = 20/75 (27%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query  44   LQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAY-IGKQVK  102
            +Q  ++        ++S  + I + +  E  TF   ++ +M+L KM+ IA A   G    
Sbjct  80   VQQELQQLAFTCVELSSGDVGIVLTYNDEPVTFSCEQVVAMILNKMQHIAAAANEGVTPA  139

Query  103  NAVMTVPAYFNDLQR  117
              V++ P Y+ D+QR
Sbjct  140  YCVLSCPGYYTDVQR  154

>PHYRA_79746
Length=665

 Score = 34.3 bits (77),  Expect = 0.21, Method: Composition-based stats.
 Identities = 23/61 (38%), Positives = 33/61 (54%), Gaps = 1/61 (2%)

Query  76   FQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQRTLSSLAQAYIEGNSKYTN  135
            FQ   ++  VLI  +       GKQV +  +  P Y N  +R L++ AQA IEGN KY +
Sbjct  251  FQKVAVAKTVLIHGQTKQMEAEGKQVWSLCVGEPDY-NPHERVLAAGAQAMIEGNIKYAH  309

Query  136  I  136
            +
Sbjct  310  M  310

>PHYRA_79751
Length=665

 Score = 33.9 bits (76),  Expect = 0.22, Method: Composition-based stats.
 Identities = 23/61 (38%), Positives = 33/61 (54%), Gaps = 1/61 (2%)

Query  76   FQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQRTLSSLAQAYIEGNSKYTN  135
            FQ   ++  VLI  +       GKQV +  +  P Y N  +R L++ AQA IEGN KY +
Sbjct  251  FQKVAVAKTVLIHGQTKQMEAEGKQVWSLCVGEPDY-NPHERVLAAGAQAMIEGNIKYAH  309

Query  136  I  136
            +
Sbjct  310  M  310

>PYAR_15468
Length=769

 Score = 33.9 bits (76),  Expect = 0.26, Method: Composition-based stats.
 Identities = 18/75 (24%), Positives = 39/75 (52%), Gaps = 1/75 (1%)

Query  44   LQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIAEAY-IGKQVK  102
            +Q  +         + +  + + +++  E+ TF   ++ +M+L KM+ IA A   G +  
Sbjct  80   VQKEIAQLAFPCVELPNGDVGVVLRYNDEAVTFTCEQVVAMILNKMQNIAAAANEGVRPA  139

Query  103  NAVMTVPAYFNDLQR  117
             AV++ P ++ D+QR
Sbjct  140  YAVLSCPGFYTDVQR  154

>H310_01493
Length=909

 Score = 33.9 bits (76),  Expect = 0.27, Method: Composition-based stats.
 Identities = 24/78 (31%), Positives = 41/78 (53%), Gaps = 6/78 (8%)

Query  43   VLQANVK--HWPLKLTSVASNRLQITVQFKRESN-TFQPGEISSMVLIKMREIAEAYIGK  99
            V+++ VK  ++P  LT    N  + +V  K +   TF   E+ +MV    + I   +   
Sbjct  104  VVESMVKSEYFPYTLTH---NDTRGSVALKHDDQFTFHAEELVAMVFTHAKTITNEFAES  160

Query  100  QVKNAVMTVPAYFNDLQR  117
             V++ V+TVP+YF + QR
Sbjct  161  PVRDWVVTVPSYFVEAQR  178

>H310_01496
Length=904

 Score = 33.9 bits (76),  Expect = 0.28, Method: Composition-based stats.
 Identities = 24/78 (31%), Positives = 41/78 (53%), Gaps = 6/78 (8%)

Query  43   VLQANVK--HWPLKLTSVASNRLQITVQFKRESN-TFQPGEISSMVLIKMREIAEAYIGK  99
            V+++ VK  ++P  LT    N  + +V  K +   TF   E+ +MV    + I   +   
Sbjct  104  VVESMVKSEYFPYTLTH---NDTRGSVALKHDDQFTFHAEELVAMVFTHAKTITNEFAES  160

Query  100  QVKNAVMTVPAYFNDLQR  117
             V++ V+TVP+YF + QR
Sbjct  161  PVRDWVVTVPSYFVEAQR  178

>CCI46709
Length=819

 Score = 33.5 bits (75),  Expect = 0.32, Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query  44   LQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVLIKMREIA-EAYIGKQVK  102
            +QA +     +   +A+  + I +++     TF   +I +M+L KM+ IA  A  G    
Sbjct  80   VQAEIAQLSFRCEEMANGDVGIVLKYNDADVTFSCEQIIAMILNKMQIIATTANEGVAPA  139

Query  103  NAVMTVPAYFNDLQR  117
              V++ P Y+ D QR
Sbjct  140  FCVVSCPGYYTDQQR  154

>CCI45987
Length=939

 Score = 33.5 bits (75),  Expect = 0.32, Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 30/58 (52%), Gaps = 1/58 (2%)

Query  61   NRLQITVQFKRE-SNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQR  117
            N  + T+  + E    +   E+ +MV   +R+I + +    VK+ V+TVP Y+   QR
Sbjct  133  NEKRGTIHLEHEIEQLYHAEEVVAMVFSHVRQITDVFAESDVKDYVITVPDYYTQAQR  190

>PITG_17383
Length=438

 Score = 33.5 bits (75),  Expect = 0.35, Method: Composition-based stats.
 Identities = 16/53 (30%), Positives = 28/53 (53%), Gaps = 1/53 (2%)

Query  66   TVQFKRESNTFQPGEISSMVLIKMREIAEAYIG-KQVKNAVMTVPAYFNDLQR  117
            T+  +       P  I + V+  +R +A  ++G +Q+  AV+ VP  FN+ QR
Sbjct  144  TLDLQDHPKCVTPVNIGTAVVQHLRSMAHQFVGHEQITKAVIAVPVDFNNRQR  196

>PHALS_09281
Length=465

 Score = 33.1 bits (74),  Expect = 0.41, Method: Composition-based stats.
 Identities = 24/98 (24%), Positives = 45/98 (46%), Gaps = 5/98 (5%)

Query  27   IGNTLINVLIKKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPGEISSMVL  86
            IG +  +V+  +  ++  + N+K  PL+      + +   +          P EI + ++
Sbjct  138  IGQSYDDVIKSENGTMPYEFNIK--PLQRNEY--DGICFALNLPNHPECVTPVEIGTAIV  193

Query  87   IKMREIAEAYIG-KQVKNAVMTVPAYFNDLQRTLSSLA  123
              +  +A  Y+G  QV  AV+ VP  FN+ QR  +  A
Sbjct  194  RHLHFMAHRYVGHNQVTKAVVAVPVDFNEKQRNATKAA  231

>CCI47582
Length=582

 Score = 32.7 bits (73),  Expect = 0.58, Method: Composition-based stats.
 Identities = 25/101 (25%), Positives = 43/101 (43%), Gaps = 4/101 (4%)

Query  31   LINVLIKKEASLVLQANVKHWPLKLTSVASNRLQITVQFKRESNTFQPG--EISSMVLIK  88
            L  +L KK   +    +V  W  K+     +  Q     KR    ++    E  +++L  
Sbjct  67   LRRLLGKKYEEIAENPHVNEWFFKVEKDGKDEAQTVAVTKRNGEVYKIAAVEFVTLLLRN  126

Query  89   MREIAEAYIGKQVKNAVMTVPAYFNDLQRTLSSLAQAYIEG  129
            ++ +A+ Y G  +  AV+T   +  D Q+ L  L QA  E 
Sbjct  127  LKTLAQDYTGLTIDKAVLTTSIHCTDRQQQL--LTQAAKEA  165

>PITG_01195
Length=666

 Score = 32.0 bits (71),  Expect = 1.0, Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 33/61 (54%), Gaps = 1/61 (2%)

Query  76   FQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQRTLSSLAQAYIEGNSKYTN  135
            FQ   ++  VLI  +       GKQV +  +  P Y N  +R L++ A+A IEGN KY +
Sbjct  252  FQKVTVAKTVLIHGQTKQMEAEGKQVWSLCVGEPDY-NPNERVLAAGAKAMIEGNIKYAH  310

Query  136  I  136
            +
Sbjct  311  M  311

>PHYCA_120845
Length=444

 Score = 31.2 bits (69),  Expect = 1.7, Method: Composition-based stats.
 Identities = 18/66 (27%), Positives = 36/66 (55%), Gaps = 3/66 (5%)

Query  66   TVQFKRESNTFQPGEISSMVLIKMREIAEAYIG-KQVKNAVMTVPAYFNDLQR--TLSSL  122
            ++  + + +   P +I + V+  +R +A  ++G  Q+  AV+ VP  FN  QR  T+++ 
Sbjct  156  SLSLQGQPDCVTPVQIGTSVVKHLRLMAHQFVGHDQITKAVIAVPVDFNQKQREATVAAF  215

Query  123  AQAYIE  128
              A +E
Sbjct  216  RGAGLE  221

>PYIW_23317
Length=766

 Score = 31.2 bits (69),  Expect = 1.9, Method: Composition-based stats.
 Identities = 15/46 (33%), Positives = 25/46 (54%), Gaps = 3/46 (7%)

Query  12   GQQPKRSSKGRSIASIGNTLINVLIKKEASLVLQANVKHWPLKLTS  57
            GQQP+R S GRSI  +    +   +K+  SL  +  V  W +++ +
Sbjct  463  GQQPRRHSDGRSINGVAAMAV---VKRFGSLRDETRVIQWKIQMVA  505

>PYU1_G006843
Length=481

 Score = 31.2 bits (69),  Expect = 1.9, Method: Composition-based stats.
 Identities = 15/47 (32%), Positives = 27/47 (57%), Gaps = 1/47 (2%)

Query  78   PGEISSMVLIKMREIAEAYIG-KQVKNAVMTVPAYFNDLQRTLSSLA  123
            P  I + ++  +R +A A++G  Q+  AV+ VP  F+ +QR  +  A
Sbjct  194  PIAIGATIVGHLRAMAHAFVGHNQITKAVIAVPVDFDGVQRAATQKA  240

>PPTG_22091
Length=53

 Score = 28.9 bits (63),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 25/39 (64%), Gaps = 3/39 (8%)

Query  67   VQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAV  105
            +Q K ES TF   EISSM   ++ E+ EA+I K  ++A+
Sbjct  1    MQVKGESKTFNLEEISSM---ELGEVVEAFITKGSEDAI  36

>PPTG_05521
Length=53

 Score = 28.9 bits (63),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 25/39 (64%), Gaps = 3/39 (8%)

Query  67   VQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAV  105
            +Q K ES TF   EISSM   ++ E+ EA+I K  ++A+
Sbjct  1    MQVKGESKTFNLEEISSM---ELGEVVEAFITKGSEDAI  36

>PPTG_10700
Length=150

 Score = 30.0 bits (66),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 14/16 (88%), Gaps = 0/16 (0%)

Query  101  VKNAVMTVPAYFNDLQ  116
            +KN V+TVPAYFND Q
Sbjct  1    MKNIVVTVPAYFNDSQ  16

>PHYCA_528722
Length=659

 Score = 30.4 bits (67),  Expect = 4.2, Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 31/61 (51%), Gaps = 1/61 (2%)

Query  76   FQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQRTLSSLAQAYIEGNSKYTN  135
            FQ   ++  VLI  +       G QV +  +  P Y N  +R L++ AQA  EGN KY +
Sbjct  245  FQKVTVAKTVLIHGQTKQMEAEGNQVWSLCVGEPDY-NPHERVLAAGAQAMTEGNIKYAH  303

Query  136  I  136
            +
Sbjct  304  M  304

>PHYRA_47873
Length=396

 Score = 30.0 bits (66),  Expect = 5.2, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 17/23 (74%), Gaps = 0/23 (0%)

Query  116  QRTLSSLAQAYIEGNSKYTNIYF  138
            +RTLSS AQAYIE +S Y  + F
Sbjct  16   KRTLSSSAQAYIEIDSLYDGVDF  38

>PHALS_01890
Length=493

 Score = 30.0 bits (66),  Expect = 5.4, Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 1/61 (2%)

Query  76   FQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQRTLSSLAQAYIEGNSKYTN  135
            FQ   ++  VLI  +       GK+V +  +  P Y N   R L++ A+A IEGN KY +
Sbjct  79   FQKVTVAKTVLIHGQTKQMEAEGKKVWSLCVGEPDY-NPHDRVLAAGAKAMIEGNIKYAH  137

Query  136  I  136
            +
Sbjct  138  M  138

>PHYKE_51
Length=663

 Score = 29.6 bits (65),  Expect = 6.8, Method: Composition-based stats.
 Identities = 20/61 (33%), Positives = 32/61 (52%), Gaps = 1/61 (2%)

Query  76   FQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQRTLSSLAQAYIEGNSKYTN  135
            FQ   ++  VLI  +       GKQV +  +  P Y    +R L++ A+A +EGN KY +
Sbjct  249  FQKVMVAKTVLIHGQTKQMEAEGKQVWSLCVGEPDYLPS-ERVLAAGAKAMLEGNIKYAH  307

Query  136  I  136
            +
Sbjct  308  M  308

Lambda      K        H        a         alpha
   0.316    0.128    0.345    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3593167830

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40