Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
HYAP_01509102082088503e-116
PPTG_16671102092114798e-60
PITG_00012101852114263e-52
PHYSO_554653102202174172e-50
PHYCA_104436101812024054e-49
PHYRA_78819102002033859e-46
PHYCA_97367203391912122995e-33
PPTG_0727520339184862361e-23
PHALS_10836102042092273e-22
PYVX_15869103311912231e-20
PYAP_203999980113566890.005
PYU1_G0032268196820670870.017
PYAR_194629980111664800.053
PYIR_144998196818659780.19
PYIW_191578196826267770.39
PHYKE_57191113062720.80
SPRG_069426891292174713.4
PYIW_249449318241561694.2
PHYSO_2965561113674674.7
PHYRA_788181113464666.2
PPTG_055841692622749667.8
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= HYAP_01509

Length=208
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

HYAP_01509                                                            332        3e-116
PPTG_16671                                                            189        8e-60 
PITG_00012                                                            168        3e-52 
PHYSO_554653                                                          165        2e-50 
PHYCA_104436                                                          160        4e-49 
PHYRA_78819                                                           152        9e-46 
PHYCA_97367                                                           119        5e-33 
PPTG_07275                                                            95.5       1e-23 
PHALS_10836                                                           92.0       3e-22 
PYVX_15869                                                            90.5       1e-20 
PYAP_20399                                                            38.9       0.005 
PYU1_G003226                                                          38.1       0.017 
PYAR_19462                                                            35.4       0.053 
PYIR_14499                                                            34.7       0.19  
PYIW_19157                                                            34.3       0.39  
PHYKE_5719                                                            32.3       0.80  
SPRG_06942                                                            32.0       3.4   
PYIW_24944                                                            31.2       4.2   
PHYSO_296556                                                          30.4       4.7   
PHYRA_78818                                                           30.0       6.2   
PPTG_05584                                                            30.0       7.8   

>HYAP_01509
Length=208

 Score = 332 bits (850),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)

Query  1    MGVSEVLYAIGHFVCRPFSDCSSCVDVLDRSYYSKTSPGVYASPQMFNRWENDVKHGYtr  60
            MGVSEVLYAIGHFVCRPFSDCSSCVDVLDRSYYSKTSPGVYASPQMFNRWENDVKHGYTR
Sbjct  1    MGVSEVLYAIGHFVCRPFSDCSSCVDVLDRSYYSKTSPGVYASPQMFNRWENDVKHGYTR  60

Query  61   srplpsrlpppppprtrKKGLTKRstssssrprsesssnnpsyysFEDEEERDRRVQFLF  120
            SRPLPSRLPPPPPPRTRKKGLTKRSTSSSSRPRSESSSNNPSYYSFEDEEERDRRVQFLF
Sbjct  61   SRPLPSRLPPPPPPRTRKKGLTKRSTSSSSRPRSESSSNNPSYYSFEDEEERDRRVQFLF  120

Query  121  YGGSDPPTPTSRGGLAASTGYRSDMISDAVSLTSIRSPQINHEIPCFFSPRDTPRSSVSA  180
            YGGSDPPTPTSRGGLAASTGYRSDMISDAVSLTSIRSPQINHEIPCFFSPRDTPRSSVSA
Sbjct  121  YGGSDPPTPTSRGGLAASTGYRSDMISDAVSLTSIRSPQINHEIPCFFSPRDTPRSSVSA  180

Query  181  SMYSPHVFKITEQKQRRNARLRSMRSFK  208
            SMYSPHVFKITEQKQRRNARLRSMRSFK
Sbjct  181  SMYSPHVFKITEQKQRRNARLRSMRSFK  208

>PPTG_16671
Length=209

 Score = 189 bits (479),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 114/211 (54%), Positives = 142/211 (67%), Gaps = 11/211 (5%)

Query  1    MGVSEVLYAIGHFVCRPFSDCSSCVDVLDRSYYSKTSPGVYASPQMFNRWENDVKHGYtr  60
            MG+S+  +++  FVCRPF DC+SC DVLD  YY KTSPGV  SPQMFNRWE+DVK+    
Sbjct  1    MGLSDFFHSVWDFVCRPFEDCTSCCDVLDPDYYRKTSPGVRRSPQMFNRWEHDVKYN---  57

Query  61   srplpsrlpppppprtrKKGLTKRstssssrprsesssnnpsyysFEDEEERDRRVQFLF  120
                       PP  + + G  +  + + S   S S SN+ S  ++  EEE +R+VQFLF
Sbjct  58   -ITPSRPPSSLPPFASSQVGTREHQSKTLSSSGSRSGSNSDSPSNYSYEEEDERQVQFLF  116

Query  121  YGGSDPPTPTSRGGLAASTGYRSDMISDAVS----LTSIRSPQINHEIPCFFSPRDTP-R  175
            YGGSDPPTPTS GGL  S GYRSDMIS+ V       SI SP+INHE+PCFFSPRDTP +
Sbjct  117  YGGSDPPTPTSAGGL-YSNGYRSDMISNYVEPMSPAASIESPRINHEMPCFFSPRDTPLQ  175

Query  176  SSVSASMYSPHVFKITEQK-QRRNARLRSMR  205
            S +SA +YSPH+FKI+EQ+  RR+    SMR
Sbjct  176  SPMSAPIYSPHLFKISEQRTSRRSTGYYSMR  206

>PITG_00012
Length=185

 Score = 168 bits (426),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 105/211 (50%), Positives = 130/211 (62%), Gaps = 35/211 (17%)

Query  1    MGVSEVLYAIGHFVCRPFSDCSSCVDVLDRSYYSKTSPGVYASPQMFNRWENDVKHGYtr  60
            MG+SE  +++  FVCRPF DC+SC DVLD  YY KTSPGV+ SPQMFNRWE+ V      
Sbjct  1    MGLSEFFHSVWDFVCRPFEDCTSCCDVLDPDYYRKTSPGVHRSPQMFNRWEHGV------  54

Query  61   srplpsrlpppppprtrKKGLTKRstssssrprsesssnnpsyysFEDEEERDRRVQFLF  120
                             K  +T     SS       S+ +        EEE +R+VQFLF
Sbjct  55   -----------------KYNITSSRPPSSGSRSDSPSNYSYE------EEEEERQVQFLF  91

Query  121  YGGSDPPTPTSRGGLAASTGYRSDMISDAVS----LTSIRSPQINHEIPCFFSPRDTP-R  175
            YGGSDPPTPTS G L  S GYRSDMIS+ V       SI SP+I+HE+PCFFSPR+TP +
Sbjct  92   YGGSDPPTPTSVGDLYPSGGYRSDMISNYVEPMSPAASIESPRISHEMPCFFSPRNTPLQ  151

Query  176  SSVSASMYSPHVFKITEQKQ-RRNARLRSMR  205
            S +SA +YSPH+FKI+EQ+  RR+    +MR
Sbjct  152  SPMSAPIYSPHLFKISEQRMSRRSTGYYNMR  182

>PHYSO_554653
Length=220

 Score = 165 bits (417),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 107/217 (49%), Positives = 130/217 (60%), Gaps = 17/217 (8%)

Query  1    MGVSEVLYAIGHFVCRPFSDCSSCVDVLDRSYYSKTSPGVYASPQMFNRWENDVKH--GY  58
            MG+SE    +   V  PF DC+SC DVLD  YY KTSPGV  +PQMFNRW++DVK   G 
Sbjct  1    MGLSEFFRDLWDLVRSPFEDCTSCCDVLDPDYYRKTSPGVRRTPQMFNRWDHDVKFDVGS  60

Query  59   trsrplpsrlpppppprtrKKGLTKRstssssrprsesssnnpsyysFED-------EEE  111
                 LP      P   +   G T+RS +S +     S S+     S          EEE
Sbjct  61   NPPSRLPPSFSFSPVISSSHAGRTQRSFTSPASLSGSSPSSGSGSASRSQSPSSYSYEEE  120

Query  112  RDRRVQFLFYGGSDPPTPTSRGGLAASTGYRSDMIS------DAVSLTSIRSPQINHEIP  165
             +R+VQFLFYGGSDPPTPT  GG A  +GYRSDMIS      + +S  SI SP+I+HE+P
Sbjct  121  DERQVQFLFYGGSDPPTPT--GGGAYPSGYRSDMISKYIQPTEPISPASIASPRISHEMP  178

Query  166  CFFSPRDTPRSSVSASMYSPHVFKITEQKQRRNARLR  202
            CFFSPR TP S +SA +YSPH+FKITEQ+ R     R
Sbjct  179  CFFSPRTTPTSPMSAPIYSPHLFKITEQRTRNAEYYR  215

>PHYCA_104436
Length=181

 Score = 160 bits (405),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 100/202 (50%), Positives = 120/202 (59%), Gaps = 36/202 (18%)

Query  1    MGVSEVLYAIGHFVCRPFSDCSSCVDVLDRSYYSKTSPGVYASPQMFNRWENDVKHGYtr  60
            MGVS     I   V +PF DC+SC DVLD  YY KTSPGV  SPQMFNRWE DV+     
Sbjct  1    MGVSGFFRYIWDLVRQPFEDCTSCCDVLDPDYYRKTSPGVRRSPQMFNRWEYDVQ-----  55

Query  61   srplpsrlpppppprtrKKGLTKRstssssrprsesssnnpsyysFEDEEERDRRVQFLF  120
                              K L+   + S S   S  +        +  EEE +R+VQFLF
Sbjct  56   -----------------SKTLSSSGSRSGSSANSPLN--------YSYEEEDERQVQFLF  90

Query  121  YGGSDPPTPTSRGGLAASTGYRSDMISDAVS----LTSIRSPQINHEIPCFFSPRDTP-R  175
            YGGSDPPTP S GGL  + GYRSDMIS+ V       SI SP+I+HE+PCFFSPR+TP +
Sbjct  91   YGGSDPPTPNSVGGLHQN-GYRSDMISNYVEPMSPAASIESPRISHEMPCFFSPRNTPIQ  149

Query  176  SSVSASMYSPHVFKITEQKQRR  197
            S +SA +YSPH+FKI EQ+  R
Sbjct  150  SPMSAPIYSPHLFKIAEQRTTR  171

>PHYRA_78819
Length=200

 Score = 152 bits (385),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 136/203 (67%), Gaps = 15/203 (7%)

Query  1    MGVSEVLYAIGHFVCRPFSDCSSCVDVLDRSYYSKTSPGVYASPQMFNRWENDVKHGYtr  60
            MGVSE  +++   + RPF +C+SC DVLD +YY KTSPGV  SPQMFNR+ NDVK+ +++
Sbjct  1    MGVSEFFHSVWDLLRRPFEECTSCCDVLDPNYYRKTSPGVRRSPQMFNRF-NDVKYDFSK  59

Query  61   srplpsrlpppppprtrKKGLTKRstssssrprsesssnnpsyysFEDEEERDRRVQFLF  120
            SRP  S  P           +T+RS  SS      +S  N SY     EEE +R VQFLF
Sbjct  60   SRPPSSLPPSSSNS---HADITQRSNMSSGSGSRSASPMNYSYE----EEEEERHVQFLF  112

Query  121  YGGSDPPTPTSRGGLAASTGYRSDMISDAV---SLTSIRSPQINHEIPCFFSPRDTP-RS  176
            YGGSDPPTPTS GG     GYRSDMIS+ V   S  +  SP+INHE+PCFFSPR+TP +S
Sbjct  113  YGGSDPPTPTSAGGPG---GYRSDMISNYVEPISPAAFASPRINHEMPCFFSPRNTPAQS  169

Query  177  SVSASMYSPHVFKITEQKQRRNA  199
             +SA +YSPH+FKI EQ+ R +A
Sbjct  170  PMSAPIYSPHLFKIAEQRHRHSA  192

>PHYCA_97367
Length=191

 Score = 119 bits (299),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 86/212 (41%), Positives = 112/212 (53%), Gaps = 32/212 (15%)

Query  1    MGVSEVLYAIGHFVCRPFSDCSSCVDVLDRS----YYSKTSPGVYASPQMFNR--WENDV  54
            MGVS+    +  FVCRPF DC SC +VLD      YY KTSPGV  +P  F+R  W+ND+
Sbjct  1    MGVSDFFQDVWDFVCRPFEDCKSCSEVLDNVLDPYYYGKTSPGVRRTPPTFDRTRWDNDL  60

Query  55   KHGYtrsrplpsrlpppppprtrKKGLTKRstssssrprsesssnnpsyysFEDEEERDR  114
            K+ ++ SRP PS+ P               S S                       E D 
Sbjct  61   KYDFSLSRPPPSQSPANSRVVFPLSRSRSLSASR--------------------SLEEDE  100

Query  115  RVQFLFYGGSDPPTPTSRGGLAASTGYRSDMISDAVSLTSIRSPQINHEIPCFFSPRDTP  174
            ++QFLFY GSD     S      S+GYRSD IS  +   +   P+++HEIPCFFSPRD P
Sbjct  101  QIQFLFYSGSD----ISTSDRLCSSGYRSDAISRPLQPIT-EPPRLSHEIPCFFSPRDAP  155

Query  175  -RSSVSASMYSPHVFKITEQKQRRNARLRSMR  205
              + +SA +YSPH+F I+EQ+ R  +R  S R
Sbjct  156  LMAPMSAPIYSPHLFMISEQRGRSPSRHYSNR  187

>PPTG_07275
Length=184

 Score = 95.5 bits (236),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 63/86 (73%), Gaps = 3/86 (3%)

Query  116  VQFLFYGGSDPPTPTSRGGLAASTGYRSDMISDAVSLTSIRSPQINHEIPCFFSPRDTP-  174
            VQFLFYGGSD  TP S G L +S GYRSD+I   + L S + P+I+HEIPCFFSPRDTP 
Sbjct  94   VQFLFYGGSDISTPVSVGKLCSS-GYRSDVICTPMRLVS-QPPRISHEIPCFFSPRDTPM  151

Query  175  RSSVSASMYSPHVFKITEQKQRRNAR  200
             S +SA +YSPH+F+I EQ+ R   R
Sbjct  152  MSPMSAPIYSPHLFQINEQRWRLRPR  177

 Score = 56.2 bits (134),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 34/48 (71%), Gaps = 2/48 (4%)

Query  13  FVCRPFSDCSSCVDVLDRSYYSKTSPGVYASPQMFNR--WENDVKHGY  58
           F+ RPF DC S  DVLD  YYSKTSPGV  +P  F+R  WEND+K+ +
Sbjct  4   FLRRPFEDCKSYCDVLDPYYYSKTSPGVRRNPPKFDRACWENDLKYDF  51

>PHALS_10836
Length=204

 Score = 92.0 bits (227),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 69/209 (33%), Positives = 99/209 (47%), Gaps = 14/209 (7%)

Query  3    VSEVLYAIGHFVCRPFSDCSSCVDVLDRSYYSKTSPGVYASPQMFNRWENDVKHGYtrsr  62
            +S  +  +   VC+PF  C +C DVLD +YY K SPG   +PQMFN W+ND         
Sbjct  1    MSRFIRILWDLVCQPFEYCRNCCDVLDPAYYRKMSPGGRRNPQMFNCWDNDKNTLTPSYP  60

Query  63   plpsrlpppppprtrKKGLTKRstssssrprsesssnnpsyysFEDEEERDRRVQFLFYG  122
                            +    +  + S+      SS          EEE + ++ FLFYG
Sbjct  61   TSSFPTLSSSNLEYSCRANDNKFITLSTSRSRSVSSTPSESAH---EEEGENQLHFLFYG  117

Query  123  GSDPPTPTSRGGLAASTGYRSDMISDAVS----LTSIRSPQINHEIPCFFSPRDTP-RSS  177
            GSD  +P + G       YR D+ISD       + SI SP+I+H++PCFFS    P +  
Sbjct  118  GSDSLSPKAVG-----KRYRRDIISDCQEPTSPVVSIESPRIDHKMPCFFSSTIAPLQFP  172

Query  178  VSASMYSPHVF-KITEQKQRRNARLRSMR  205
            +S S+YS ++   I +Q QR      +MR
Sbjct  173  MSDSIYSANLLGDIDQQGQRSGTGHCNMR  201

>PYVX_15869
Length=331

 Score = 90.5 bits (223),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 68/191 (36%), Positives = 93/191 (49%), Gaps = 29/191 (15%)

Query  13   FVCRPFSDCSSCVDVLDRSY-YSKTSPGVYASPQMFNRWENDVKHGYtrsrplpsrlppp  71
            F+  PF DC +  D L+R +  S  SPGV   PQ F R + D+K+ +T      S     
Sbjct  151  FLRHPFRDCYNMCD-LERPFGASPGSPGVTVLPQHFPRMDRDLKYDFTAGPISSSAASKS  209

Query  72   ppprtrKKGLTKRstssssrprsesssnnpsyysFEDEEERDRRVQFLFYGGSDPPTPTS  131
              P    +  T                   S      ++  D+  QFLFY GSDP TPTS
Sbjct  210  SSPARSTRSKTS------------------SDSFLSYDDPYDQPTQFLFYCGSDPLTPTS  251

Query  132  RGGLAASTGYRSDMISDAVSL--------TSIRSPQINHEIPCFFSPRDTPRSSVSASMY  183
               LAA  G ++D IS             T + SP+I+H+IP FFSPR+ P S  +A +Y
Sbjct  252  -AQLAARNGLKTDTISGYTPTAGAEPQVHTPLASPRISHQIPVFFSPRNAPTSPAAAPLY  310

Query  184  SPHVFKITEQK  194
            SPH+F+ITE++
Sbjct  311  SPHLFRITERE  321

>PYAP_20399
Length=135

 Score = 38.9 bits (89),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 38/66 (58%), Gaps = 17/66 (26%)

Query  117  QFLFYGGSDPPTPTSRGGLAAS--TGYRS---------DMISDAVSLTSIRSPQINHEIP  165
            QFLF+ GSD        G+AA   TGY++         ++ + A   + I++PQI+H+IP
Sbjct  68   QFLFFCGSD------NSGVAAGRRTGYQTNHDFSFANAEVQARASRASEIQAPQISHKIP  121

Query  166  CFFSPR  171
             FF+P+
Sbjct  122  VFFAPQ  127

>PYU1_G003226
Length=206

 Score = 38.1 bits (87),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 23/70 (33%), Positives = 37/70 (53%), Gaps = 11/70 (16%)

Query  114  RRVQFLFYGGSDPPTPTS------RGGLAASTGYRSDMISDAVSLTS-----IRSPQINH  162
            +   F+FY GSD PT  +       G  + S+   +   S+A  + S     + +P+I+H
Sbjct  96   KNTDFMFYCGSDTPTSDAGQRNSFNGAASFSSTASASEFSEAAEVASEERAKVATPKISH  155

Query  163  EIPCFFSPRD  172
            +IP FFSPR+
Sbjct  156  QIPVFFSPRN  165

>PYAR_19462
Length=116

 Score = 35.4 bits (80),  Expect = 0.053, Method: Compositional matrix adjust.
 Identities = 21/64 (33%), Positives = 31/64 (48%), Gaps = 17/64 (27%)

Query  109  EEERDRRVQFLFYGGSDPPTPTSRGGLAASTGYRSDMISDAVSLTSIRSPQINHEIPCFF  168
            E   + R QFLF+ GSD  T  +R  L +S                I +P I+H +P FF
Sbjct  63   ESSVNERPQFLFFCGSD--TSAARASLKSS---------------KIETPMISHRMPVFF  105

Query  169  SPRD  172
            +P++
Sbjct  106  NPQN  109

>PYIR_14499
Length=186

 Score = 34.7 bits (78),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 20/59 (34%), Positives = 31/59 (53%), Gaps = 8/59 (14%)

Query  114  RRVQFLFYGGSDPPTPTSRGGLAASTGYRSDMISDAVSLTSIRSPQINHEIPCFFSPRD  172
            ++  F+FY G D P  T+   L        +M  +  SL  + +P+I+  IP FFSPR+
Sbjct  95   KKTDFMFYCGFDTPNSTAPSDLD------EEMHEERASL--VATPKISRNIPVFFSPRN  145

>PYIW_19157
Length=262

 Score = 34.3 bits (77),  Expect = 0.39, Method: Compositional matrix adjust.
 Identities = 22/67 (33%), Positives = 34/67 (51%), Gaps = 13/67 (19%)

Query  118  FLFYGGSDPPTPTSR------GGLAASTGYRSDMISD-----AVSLTSIRSPQINHEIPC  166
            F+FY G D  TP S       GG + S+       SD     ++    + +P+++H+IP 
Sbjct  99   FMFYCGFD--TPKSEHGRGEGGGFSFSSSTAPSEFSDDGERASMDRVHVTTPKLSHQIPV  156

Query  167  FFSPRDT  173
            FFSPR+ 
Sbjct  157  FFSPRNA  163

>PHYKE_5719
Length=130

 Score = 32.3 bits (72),  Expect = 0.80, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 32/62 (52%), Gaps = 5/62 (8%)

Query  115  RVQFLFYGGSDPPTPTSRGGLAASTGYRSDMISDAVSLT--SIRSPQINHEIPCFFSPRD  172
            R QFLF+ GSD     S G L +  G  S + S   S+T  +   P INH +P FF P  
Sbjct  67   RPQFLFFCGSDTSAFPS-GELTSPNG--STLASRLASITCPTPAQPAINHHMPVFFMPPL  123

Query  173  TP  174
            +P
Sbjct  124  SP  125

>SPRG_06942
Length=2921

 Score = 32.0 bits (71),  Expect = 3.4, Method: Composition-based stats.
 Identities = 22/74 (30%), Positives = 37/74 (50%), Gaps = 2/74 (3%)

Query  106  FEDEEERDRRVQFLFYGGSDPPTPTSRGGLAASTGYR-SDMISDAVSLTSIRSPQINHEI  164
            F  +++   ++ F+ +    P  PT   GLA+ +  R +   S  V  TS++SP+   +I
Sbjct  21   FTLQQDPAYQLHFVNHEKPKPERPT-HAGLASPSSLRYATRSSTPVQATSVKSPKKVLDI  79

Query  165  PCFFSPRDTPRSSV  178
            P   SP    R+SV
Sbjct  80   PLLKSPPKEKRTSV  93

>PYIW_24944
Length=415

 Score = 31.2 bits (69),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 18/61 (30%), Positives = 27/61 (44%), Gaps = 7/61 (11%)

Query  118  FLFYGGSDP-------PTPTSRGGLAASTGYRSDMISDAVSLTSIRSPQINHEIPCFFSP  170
             LFY G+ P       P  T+ GG+  S  Y  D + +  S TS+ SP +   +    S 
Sbjct  301  LLFYSGTGPSLSGLVKPDVTAPGGVVFSASYTGDAVYENKSGTSMASPHVAGAVALLLSA  360

Query  171  R  171
            +
Sbjct  361  K  361

>PHYSO_296556
Length=136

 Score = 30.4 bits (67),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 36/74 (49%), Gaps = 10/74 (14%)

Query  109  EEERDRRV-------QFLFYGGSDPP-TPTSRGGLAASTGYRSDMISDAVSLTSIRSPQI  160
            E  R RR+       QFLF+ G+D   +P++    A  T   S + S  ++  +   P I
Sbjct  53   EARRSRRISSTNERPQFLFFCGTDSSGSPSAELTAANGTTLASRIAS--MNAPAPAQPAI  110

Query  161  NHEIPCFFSPRDTP  174
            +H +P FF P  +P
Sbjct  111  DHHMPVFFMPPLSP  124

>PHYRA_78818
Length=134

 Score = 30.0 bits (66),  Expect = 6.2, Method: Compositional matrix adjust.
 Identities = 23/64 (36%), Positives = 33/64 (52%), Gaps = 5/64 (8%)

Query  113  DRRVQFLFYGGSDPPTPTSRGGLAASTGYRSDMISDAVSLTSIR--SPQINHEIPCFFSP  170
            + R QFLF+ GSD     S G L +  G  S + S   ++T+     P I+H +P FF P
Sbjct  62   NERPQFLFFCGSDTSAFPS-GELTSPNG--STLASRLANMTAPTPAQPAIDHHMPVFFMP  118

Query  171  RDTP  174
              +P
Sbjct  119  PLSP  122

>PPTG_05584
Length=227

 Score = 30.0 bits (66),  Expect = 7.8, Method: Compositional matrix adjust.
 Identities = 15/49 (31%), Positives = 23/49 (47%), Gaps = 0/49 (0%)

Query  141  YRSDMISDAVSLTSIRSPQINHEIPCFFSPRDTPRSSVSASMYSPHVFK  189
            Y  D+ S    +   R  Q   ++  F   R  P+S+VSA + S H+ K
Sbjct  97   YIQDLESKREDVERKRQAQHEEDLAQFLVARGAPKSTVSAQLSSQHLLK  145

Lambda      K        H        a         alpha
   0.319    0.133    0.403    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 9841431558

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40