Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
H310_09224147551231236474e-88
H257_06293147551231235279e-70
SDRG_01782147551231243585e-44
SPRG_06335147551231263542e-43
PHYSO_321155147551361232944e-34
PHYCA_11834147551341232901e-33
PHYRA_95903147551341232813e-32
PPTG_17126147551361232771e-31
PHYKE_8392147551381252753e-31
PHALS_06479147551361232735e-31
PITG_18455147551321212674e-30
PYU1_G001736147551231192649e-30
CCA17542147551201182612e-29
PYIW_19970147551301192604e-29
PYVX_18180147551351202466e-27
HYAP_07103147551641562452e-26
PYAP_17747147551341202381e-25
CCI44820147551231192343e-25
PYIR_13454147551291192232e-23
PHALS_115641114710761770.056
CCA175211114710453700.45
PHYCA_5082308676116475720.60
PYVX_208541114710453652.3
PHYKE_58411114712159652.7
PYIR_16217298743778663.8
PYIW_1411916535856146664.0
H257_0299813954274033655.6
PYAR_220354934066545646.5
PHYCA_5324961198769253647.4
PYVX_2195212601115223639.7
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= H310_09224

Length=123
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

H310_09224                                                            253        4e-88
H257_06293                                                            207        9e-70
SDRG_01782                                                            142        5e-44
SPRG_06335                                                            140        2e-43
PHYSO_321155                                                          117        4e-34
PHYCA_11834                                                           116        1e-33
PHYRA_95903                                                           112        3e-32
PPTG_17126                                                            111        1e-31
PHYKE_8392                                                            110        3e-31
PHALS_06479                                                           109        5e-31
PITG_18455                                                            107        4e-30
PYU1_G001736                                                          106        9e-30
CCA17542                                                              105        2e-29
PYIW_19970                                                            104        4e-29
PYVX_18180                                                            99.4       6e-27
HYAP_07103                                                            99.0       2e-26
PYAP_17747                                                            96.3       1e-25
CCI44820                                                              94.7       3e-25
PYIR_13454                                                            90.5       2e-23
PHALS_11564                                                           34.3       0.056
CCA17521                                                              31.6       0.45 
PHYCA_508230                                                          32.3       0.60 
PYVX_20854                                                            29.6       2.3  
PHYKE_5841                                                            29.6       2.7  
PYIR_16217                                                            30.0       3.8  
PYIW_14119                                                            30.0       4.0  
H257_02998                                                            29.6       5.6  
PYAR_22035                                                            29.3       6.5  
PHYCA_532496                                                          29.3       7.4  
PYVX_21952                                                            28.9       9.7  

>H310_09224
Length=123

 Score = 253 bits (647),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%)

Query  1    MEKSVRTAYKKLIKLAQSLPAEQKPVALDKVRHEFRSHGVITSSDQLDKIVMKAQSKISY  60
            MEKSVRTAYKKLIKLAQSLPAEQKPVALDKVRHEFRSHGVITSSDQLDKIVMKAQSKISY
Sbjct  1    MEKSVRTAYKKLIKLAQSLPAEQKPVALDKVRHEFRSHGVITSSDQLDKIVMKAQSKISY  60

Query  61   LKIVTPKRAPQTSPQRYIYKDGKRLDPGCIDQSTNATIKTVDFNAMMERHVKLVRRQHFM  120
            LKIVTPKRAPQTSPQRYIYKDGKRLDPGCIDQSTNATIKTVDFNAMMERHVKLVRRQHFM
Sbjct  61   LKIVTPKRAPQTSPQRYIYKDGKRLDPGCIDQSTNATIKTVDFNAMMERHVKLVRRQHFM  120

Query  121  DRK  123
            DRK
Sbjct  121  DRK  123

>H257_06293
Length=123

 Score = 207 bits (527),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 110/123 (89%), Gaps = 0/123 (0%)

Query  1    MEKSVRTAYKKLIKLAQSLPAEQKPVALDKVRHEFRSHGVITSSDQLDKIVMKAQSKISY  60
            MEKSVRTAYKKLIKLAQSLPA+QKP ALDK+RH+FRS GVI+++++LDK+VMKAQSKISY
Sbjct  1    MEKSVRTAYKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEELDKLVMKAQSKISY  60

Query  61   LKIVTPKRAPQTSPQRYIYKDGKRLDPGCIDQSTNATIKTVDFNAMMERHVKLVRRQHFM  120
            LKIVTPKR PQ+ PQR+IYKDGKRLD   +D   N TIKT D NAMMERHVKL+RRQHFM
Sbjct  61   LKIVTPKRTPQSGPQRFIYKDGKRLDSQSLDDGGNRTIKTTDVNAMMERHVKLIRRQHFM  120

Query  121  DRK  123
            DRK
Sbjct  121  DRK  123

>SDRG_01782
Length=123

 Score = 142 bits (358),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 97/124 (78%), Gaps = 2/124 (2%)

Query  1    MEKSVRTAYKKLIKLAQSLPAEQKPVALDKVRHEFRSHGVITSSDQLDKIVMKAQSKISY  60
            M+ ++R AYKKL+KLA+S+P EQ+   L+KVRHEFR+H    + ++LD+++ KAQSKISY
Sbjct  1    MDATIRAAYKKLLKLAKSVPQEQRAQTLEKVRHEFRAHEGAATPEELDQLLRKAQSKISY  60

Query  61   LKIVTPKR-APQTSPQRYIYKDGKRLDPGCIDQSTNATIKTVDFNAMMERHVKLVRRQHF  119
            LKIVTPK+ +  T    ++YK+G+R+D G    + +ATIKT D+NAMM +HV+LVRRQHF
Sbjct  61   LKIVTPKKSSSSTQGSHFVYKNGQRID-GRELSADSATIKTHDYNAMMTKHVQLVRRQHF  119

Query  120  MDRK  123
            MDRK
Sbjct  120  MDRK  123

>SPRG_06335
Length=123

 Score = 140 bits (354),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 98/126 (78%), Gaps = 6/126 (5%)

Query  1    MEKSVRTAYKKLIKLAQSLPAEQKPVALDKVRHEFRSHGVITSSDQLDKIVMKAQSKISY  60
            M+ ++R AYKKL+KLA+S+P EQ+   L+KVR EFR+H    + ++LD+++ KAQSKISY
Sbjct  1    MDTTIRAAYKKLLKLAKSVPQEQRAQTLEKVRTEFRAHTGAATPEELDQLLRKAQSKISY  60

Query  61   LKIVTPKRAPQTSP---QRYIYKDGKRLDPGCIDQSTNATIKTVDFNAMMERHVKLVRRQ  117
            LKIVTPK++P  SP     ++YK+G+R+D G    + +ATIKT D+NAMM +HV+LVRRQ
Sbjct  61   LKIVTPKKSP--SPGQGNHFVYKNGQRID-GRELSADSATIKTADYNAMMTKHVQLVRRQ  117

Query  118  HFMDRK  123
            HFMDRK
Sbjct  118  HFMDRK  123

>PHYSO_321155
Length=136

 Score = 117 bits (294),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 85/123 (69%), Gaps = 2/123 (2%)

Query  3    KSVRTAYKKLIKLAQSLPAEQKPVALDKVRHEFRSHGVITSSDQLDKIVMKAQSKISYLK  62
            + +R  YKKL++LAQSLP  ++  +LD++R EFRSHG +T  + +  ++ +AQS +SYLK
Sbjct  6    RELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSSLSYLK  65

Query  63   IVTPKRAPQTSPQRYIYKDGKRLDPGCIDQ--STNATIKTVDFNAMMERHVKLVRRQHFM  120
            IVTP+    T  QR+IY++G+R++    +     NA  KT D  A ++RH +L+RRQ+FM
Sbjct  66   IVTPRGESNTGVQRFIYRNGQRVNAAEFEAKGEENARYKTQDIEAGLKRHHQLLRRQYFM  125

Query  121  DRK  123
            DRK
Sbjct  126  DRK  128

>PHYCA_11834
Length=134

 Score = 116 bits (290),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 85/123 (69%), Gaps = 2/123 (2%)

Query  3    KSVRTAYKKLIKLAQSLPAEQKPVALDKVRHEFRSHGVITSSDQLDKIVMKAQSKISYLK  62
            + +R  YKKL++LAQSLP  ++  ++D++R EFRSH  +T   ++ K++ +AQS + YLK
Sbjct  4    RELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGYLK  63

Query  63   IVTPKRAPQTSPQRYIYKDGKRLDPGCID--QSTNATIKTVDFNAMMERHVKLVRRQHFM  120
            IVTP+    T  QR+IY+DGKR++   ++     NA  KT D  A ++RH +L+RRQ+FM
Sbjct  64   IVTPRAESNTGVQRFIYRDGKRVNAEELEGKGEENARWKTQDMEAGLKRHHQLLRRQYFM  123

Query  121  DRK  123
            DRK
Sbjct  124  DRK  126

>PHYRA_95903
Length=134

 Score = 112 bits (281),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 54/123 (44%), Positives = 82/123 (67%), Gaps = 2/123 (2%)

Query  3    KSVRTAYKKLIKLAQSLPAEQKPVALDKVRHEFRSHGVITSSDQLDKIVMKAQSKISYLK  62
            + +R  YKKL++LAQSLP  ++  +LD++R EFRSH  +T   ++  ++ +AQS + YLK
Sbjct  4    RELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLGYLK  63

Query  63   IVTPKRAPQTSPQRYIYKDGKRLDPGCIDQ--STNATIKTVDFNAMMERHVKLVRRQHFM  120
            IVTP+       QRYIY++G+R++   ++     NA  KT D    ++RH +L+RRQHFM
Sbjct  64   IVTPRAESNKGIQRYIYRNGQRVNADEVEAHGEENARYKTQDIEGGLKRHHQLLRRQHFM  123

Query  121  DRK  123
            DRK
Sbjct  124  DRK  126

>PPTG_17126
Length=136

 Score = 111 bits (277),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 83/123 (67%), Gaps = 2/123 (2%)

Query  3    KSVRTAYKKLIKLAQSLPAEQKPVALDKVRHEFRSHGVITSSDQLDKIVMKAQSKISYLK  62
            + +R  YKKL++LAQSLP  ++  ++D++R +FR+HG +T   ++  ++ +AQS +SYLK
Sbjct  6    RELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLSYLK  65

Query  63   IVTPKRAPQTSPQRYIYKDGKRLDPGCIDQ--STNATIKTVDFNAMMERHVKLVRRQHFM  120
            IVTP+       QRYIY++G+R++    ++    NA  KT D    + RH +L+RRQ+F+
Sbjct  66   IVTPRAESNMGVQRYIYRNGQRVNADEFEEKGEENARWKTQDMEGGLRRHHQLLRRQYFL  125

Query  121  DRK  123
            DRK
Sbjct  126  DRK  128

>PHYKE_8392
Length=138

 Score = 110 bits (275),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 88/125 (70%), Gaps = 4/125 (3%)

Query  3    KSVRTAYKKLIKLAQSLPAEQKPVALDKVRHEFRSHGVITSSDQLDKIVMKAQSKISYLK  62
            + +R  YKKL+++AQ+LP  ++  +L ++R EFR+HG ++   ++ K++  AQS +SYLK
Sbjct  6    RELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEVSKLLQLAQSSLSYLK  65

Query  63   IVTPKRAPQTSP--QRYIYKDGKRLDPGCIDQ--STNATIKTVDFNAMMERHVKLVRRQH  118
            IVTP+   +++   QRYIY++G+R++   +++    NA  KT D  A ++RH +L+RRQH
Sbjct  66   IVTPRDETESNSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQLMRRQH  125

Query  119  FMDRK  123
            FMDRK
Sbjct  126  FMDRK  130

>PHALS_06479
Length=136

 Score = 109 bits (273),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 84/123 (68%), Gaps = 2/123 (2%)

Query  3    KSVRTAYKKLIKLAQSLPAEQKPVALDKVRHEFRSHGVITSSDQLDKIVMKAQSKISYLK  62
            + +R  YKKL++LAQ+LP  ++  ++D++R EFR H  +T   ++ + + +AQS +SYLK
Sbjct  6    RELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSYLK  65

Query  63   IVTPKRAPQTSPQRYIYKDGKRLDPGCIDQ--STNATIKTVDFNAMMERHVKLVRRQHFM  120
            I+TP+    T  QR+IY++G+R++    ++  + NA  KT D  A  +RH +L+RRQ+FM
Sbjct  66   IITPRTESNTGVQRFIYRNGQRVNAADFEKKGNENARWKTQDMEAGYKRHHQLLRRQYFM  125

Query  121  DRK  123
            DRK
Sbjct  126  DRK  128

>PITG_18455
Length=132

 Score = 107 bits (267),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 82/121 (68%), Gaps = 2/121 (2%)

Query  5    VRTAYKKLIKLAQSLPAEQKPVALDKVRHEFRSHGVITSSDQLDKIVMKAQSKISYLKIV  64
            +R  YKKL++LAQSLP  ++  ++D++R +FRSHG  T   ++  ++ +AQS +SYLKIV
Sbjct  4    LRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYLKIV  63

Query  65   TPKRAPQTSPQRYIYKDGKRLDPGCIDQST--NATIKTVDFNAMMERHVKLVRRQHFMDR  122
            TP+    T  QRYIY++G+R++    ++    NA  K  D    ++RH +L++RQ+FM+R
Sbjct  64   TPRAESNTGVQRYIYRNGQRVNAAEFEEKGVENARWKMQDMEGGLKRHHQLLQRQYFMNR  123

Query  123  K  123
            K
Sbjct  124  K  124

>PYU1_G001736
Length=123

 Score = 106 bits (264),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 78/119 (66%), Gaps = 1/119 (1%)

Query  5    VRTAYKKLIKLAQSLPAEQKPVALDKVRHEFRSHGVITSSDQLDKIVMKAQSKISYLKIV  64
            +R  YKKL+KLAQ+LPA+++   ++++R EFR+H       ++  ++ +AQS I YLKIV
Sbjct  6    LRPMYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGYLKIV  65

Query  65   TPKRAPQTSPQRYIYKDGKRLDPGCIDQSTNATIKTVDFNAMMERHVKLVRRQHFMDRK  123
            TP+       + Y+Y  GKR++         A  KT D+NA M+RHV+L+RRQHFMDRK
Sbjct  66   TPRATSDAGVKNYVYIKGKRVEA-AGAAEDGARYKTADYNAQMQRHVQLLRRQHFMDRK  123

>CCA17542
Length=120

 Score = 105 bits (261),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 78/118 (66%), Gaps = 1/118 (1%)

Query  5    VRTAYKKLIKLAQSLPAEQKPVALDKVRHEFRSHGVITSSDQLDKIVMKAQSKISYLKIV  64
             R+ YK+LI+LA+SLPAE++   L  +R EFR H  I+   QL +++ +AQS I YLKIV
Sbjct  4    TRSIYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTIGYLKIV  63

Query  65   TPKRAPQTSPQRYIYKDGKRLDPGCIDQSTNATIKTVDFNAMMERHVKLVRRQHFMDR  122
            TP +   +  +R+++KDG+R++   +  S  A  K  D    ++RH +L+RRQHFMDR
Sbjct  64   TPHKRSDSGVKRFMFKDGERIEEN-LKASERARFKVQDIGEGLKRHHQLLRRQHFMDR  120

>PYIW_19970
Length=130

 Score = 104 bits (260),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 78/119 (66%), Gaps = 1/119 (1%)

Query  5    VRTAYKKLIKLAQSLPAEQKPVALDKVRHEFRSHGVITSSDQLDKIVMKAQSKISYLKIV  64
            +R  YKKL++LA++LP  ++     ++R EFRS   ++   +L+ ++ +AQS ISYLKIV
Sbjct  13   LRPVYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKIV  72

Query  65   TPKRAPQTSPQRYIYKDGKRLDPGCIDQSTNATIKTVDFNAMMERHVKLVRRQHFMDRK  123
            TP+++     + YIYK+G+R++   +     A  +  D+N  M RH KL+RRQHFMDRK
Sbjct  73   TPRKSSDAGVKNYIYKNGQRVEAAAV-MEDGAKYQLPDYNGQMLRHQKLLRRQHFMDRK  130

>PYVX_18180
Length=135

 Score = 99.4 bits (246),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 80/120 (67%), Gaps = 2/120 (2%)

Query  5    VRTAYKKLIKLAQSLPAEQKPVALDKVRHEFRSHGVITSSDQLDKIVMKAQSKISYLKIV  64
            +R  YKKL++LAQSLP  ++   + ++R EFRSH  +T + ++ K++ +AQS++ YLKIV
Sbjct  7    LRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQLGYLKIV  66

Query  65   TPKRAPQTSPQRYIYKDGKRLDPGCIDQSTNAT--IKTVDFNAMMERHVKLVRRQHFMDR  122
            TP+    +  +RYIY++G+R+D    + +       KT D    ++RH +L+RRQHFMDR
Sbjct  67   TPRGPSASGVKRYIYRNGQRVDADAAEAAGEDGARYKTPDMEGALKRHHQLLRRQHFMDR  126

>HYAP_07103
Length=164

 Score = 99.0 bits (245),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 83/156 (53%), Gaps = 37/156 (24%)

Query  5    VRTAYKKLIKLAQSLPAEQKPVALDKVRHEFRSHGVITSSDQLDKIVMKAQSKISYLKIV  64
            +R  YKKL++LAQSLP  ++  +LD++R EFR HG +T   ++  ++ +AQS I +LKIV
Sbjct  1    MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKIV  60

Query  65   TPKRA-----------------------------------PQTSPQRYIYKDGKRLDPGC  89
            TP+                                       T  QR++Y+DGKR+D   
Sbjct  61   TPRAESGGFMASLAFSIMCLTLSLFSVLLLLLHHYFSCFFSDTGIQRFVYRDGKRIDAAE  120

Query  90   IDQ--STNATIKTVDFNAMMERHVKLVRRQHFMDRK  123
            + +    NA  KT D  A M+RH +L+RRQHFMDRK
Sbjct  121  LKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRK  156

>PYAP_17747
Length=134

 Score = 96.3 bits (238),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 75/120 (63%), Gaps = 2/120 (2%)

Query  5    VRTAYKKLIKLAQSLPAEQKPVA-LDKVRHEFRSHGVITSSDQLDKIVMKAQSKISYLKI  63
            +R  YK+L++LA+SLP E K  A + ++R EFRS        ++  +V +AQ+KI YLKI
Sbjct  6    LRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIGYLKI  65

Query  64   VTPKRAPQTSPQRYIYKDGKRLDPGCID-QSTNATIKTVDFNAMMERHVKLVRRQHFMDR  122
            VTP+       + ++Y +GKR+D   +  +   A  KT+DF   M RH +L+RRQHFMDR
Sbjct  66   VTPRSTADAGVKSFVYVNGKRVDSSDVQTREEGARYKTIDFEGNMRRHNQLLRRQHFMDR  125

>CCI44820
Length=123

 Score = 94.7 bits (234),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 73/119 (61%), Gaps = 1/119 (1%)

Query  4    SVRTAYKKLIKLAQSLPAEQKPVALDKVRHEFRSHGVITSSDQLDKIVMKAQSKISYLKI  63
              R  +KK++KLA+SLP E++   L  +R EFR H  I    QL +++ +AQS I YLKI
Sbjct  6    ETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTIGYLKI  65

Query  64   VTPKRAPQTSPQRYIYKDGKRLDPGCIDQSTNATIKTVDFNAMMERHVKLVRRQHFMDR  122
            VTP +   +  + ++YKDG+R++   +     A  K  D    ++RH +L+RRQ+FMDR
Sbjct  66   VTPHKRSDSGVKHFVYKDGERIEK-SLQAGEKAKFKVQDMEEGLKRHNQLIRRQYFMDR  123

>PYIR_13454
Length=129

 Score = 90.5 bits (223),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 80/119 (67%), Gaps = 1/119 (1%)

Query  5    VRTAYKKLIKLAQSLPAEQKPVALDKVRHEFRSHGVITSSDQLDKIVMKAQSKISYLKIV  64
            +R  YKKL+KLA++LP  ++   L ++R EFR+   ++   +L+ ++ +AQS I YLKIV
Sbjct  12   LRPVYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSIGYLKIV  71

Query  65   TPKRAPQTSPQRYIYKDGKRLDPGCIDQSTNATIKTVDFNAMMERHVKLVRRQHFMDRK  123
            TP+++     + YIYK+G+R++   + +   A     D+NA M+RH KL+RRQHFMDRK
Sbjct  72   TPRKSSDAGVKNYIYKNGQRVEATSVLED-GAKYSIPDYNAQMQRHQKLLRRQHFMDRK  129

>PHALS_11564
Length=107

 Score = 34.3 bits (77),  Expect = 0.056, Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 35/61 (57%), Gaps = 0/61 (0%)

Query  3   KSVRTAYKKLIKLAQSLPAEQKPVALDKVRHEFRSHGVITSSDQLDKIVMKAQSKISYLK  62
           K V   Y++L+KLAQ  P+ ++   +  ++ EF ++ +IT + ++ + +  A + I  L 
Sbjct  5   KQVLRVYRRLLKLAQHYPSIKREAIIRDIKEEFHANAIITDAQKICEAMASAHAGIKELS  64

Query  63  I  63
           +
Sbjct  65  M  65

>CCA17521
Length=104

 Score = 31.6 bits (70),  Expect = 0.45, Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 31/53 (58%), Gaps = 0/53 (0%)

Query  9   YKKLIKLAQSLPAEQKPVALDKVRHEFRSHGVITSSDQLDKIVMKAQSKISYL  61
           Y+++++LA+  P+ ++   ++ +R EFR    IT++  +D  +  A + I  L
Sbjct  10  YRRILRLARRYPSIKRDAIINDIRMEFRESRDITTAAIIDHKIASANAGIKEL  62

>PHYCA_508230
Length=1164

 Score = 32.3 bits (72),  Expect = 0.60, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 35/75 (47%), Gaps = 2/75 (3%)

Query  29   DKVRHEFRSHGVITSSDQLDKIVMKAQSKISYLKIVTPKRAPQTSPQRYIYKDGKRLDPG  88
            DK   + RSH VI++SD++    ++  SKIS  +I TP R    SP         R  P 
Sbjct  38   DKQSIDGRSHLVISTSDRVPGSKLRTPSKIS--RIPTPGRTSTASPSSSRLGMAARTTPR  95

Query  89   CIDQSTNATIKTVDF  103
             +++       T DF
Sbjct  96   ALEKKVQRVGSTSDF  110

>PYVX_20854
Length=104

 Score = 29.6 bits (65),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 13/53 (25%), Positives = 32/53 (60%), Gaps = 0/53 (0%)

Query  9   YKKLIKLAQSLPAEQKPVALDKVRHEFRSHGVITSSDQLDKIVMKAQSKISYL  61
           Y++++KLAQ  P+ ++   +  ++ EF  +  ++ + Q+ + +M A++ I  L
Sbjct  11  YRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGIQEL  63

>PHYKE_5841
Length=121

 Score = 29.6 bits (65),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 15/59 (25%), Positives = 34/59 (58%), Gaps = 0/59 (0%)

Query  3   KSVRTAYKKLIKLAQSLPAEQKPVALDKVRHEFRSHGVITSSDQLDKIVMKAQSKISYL  61
           K V   Y++++KLAQ  P+ ++   +  ++ EF +H  +T + ++ + +  A++ I  L
Sbjct  5   KEVTRMYRRILKLAQRYPSVKRDSIIRDIKTEFHAHKGLTDAQKIREELASARAGIKEL  63

>PYIR_16217
Length=437

 Score = 30.0 bits (66),  Expect = 3.8, Method: Composition-based stats.
 Identities = 27/78 (35%), Positives = 37/78 (47%), Gaps = 12/78 (15%)

Query  3    KSVRTAYKKLIKL---AQSLPAEQKPVALDKVR--------HEFRSHGVITSSDQLDKIV  51
            K VRTAY KL +L   A SL     P  L  +          EF++H   ++ ++  K  
Sbjct  288  KDVRTAYFKLSQLILGANSLVQSAIPDLLTPIPGSAEADSLAEFKAH-YFSTLEKNSKFT  346

Query  52   MKAQSKISYLKIVTPKRA  69
              A SKI  LK+V P+ A
Sbjct  347  TNALSKIPGLKVVVPQGA  364

>PYIW_14119
Length=561

 Score = 30.0 bits (66),  Expect = 4.0, Method: Composition-based stats.
 Identities = 13/46 (28%), Positives = 22/46 (48%), Gaps = 0/46 (0%)

Query  37  SHGVITSSDQLDKIVMKAQSKISYLKIVTPKRAPQTSPQRYIYKDG  82
           S GVI+    L K +    + +   K  +  R+P   P+ + Y+DG
Sbjct  53  SSGVISLGSMLGKTIQSNYNSLQEAKFTSASRSPWPGPEWFAYQDG  98

>H257_02998
Length=740

 Score = 29.6 bits (65),  Expect = 5.6, Method: Composition-based stats.
 Identities = 12/33 (36%), Positives = 16/33 (48%), Gaps = 0/33 (0%)

Query  74   PQRYIYKDGKRLDPGCIDQSTNATIKTVDFNAM  106
            P+R+ Y +G  L P C D     TI   DF  +
Sbjct  50   PRRHEYSEGVALGPTCFDADDGTTISRRDFTTL  82

>PYAR_22035
Length=665

 Score = 29.3 bits (64),  Expect = 6.5, Method: Composition-based stats.
 Identities = 13/45 (29%), Positives = 22/45 (49%), Gaps = 0/45 (0%)

Query  52   MKAQSKISYLKIVTPKRAPQTSPQRYIYKDGKRLDPGCIDQSTNA  96
            M AQS+ S L +  P+RAP   P   +  +  R  P  +  ++ +
Sbjct  211  MPAQSQTSALNMAPPRRAPAQQPTALVPANPSRAAPSSMSMASES  255

>PHYCA_532496
Length=692

 Score = 29.3 bits (64),  Expect = 7.4, Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 26/53 (49%), Gaps = 0/53 (0%)

Query  13   IKLAQSLPAEQKPVALDKVRHEFRSHGVITSSDQLDKIVMKAQSKISYLKIVT  65
            + L Q+LP+EQK + L ++R        +  SD  D+  M+   K  ++ I  
Sbjct  639  MALHQNLPSEQKKMHLFEIRETMLFEDGLEFSDDTDEFGMRLAQKFQWIAITN  691

>PYVX_21952
Length=1152

 Score = 28.9 bits (63),  Expect = 9.7, Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 14/23 (61%), Gaps = 0/23 (0%)

Query  25   PVALDKVRHEFRSHGVITSSDQL  47
            P A+D  RHE   HGVI  S +L
Sbjct  776  PTAIDDTRHELDEHGVILESTRL  798

Lambda      K        H        a         alpha
   0.319    0.131    0.364    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3408016320

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40