Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
H310_092231475633333315000.0
H257_062941475635835812152e-167
SDRG_01781147563353306974e-89
SPRG_06336147563353306941e-88
PYU1_G001735147563423234192e-47
PHYSO_471523147563483364001e-44
PHYCA_556162147563513413974e-44
PITG_18456147563513383956e-44
PHYRA_81100147563493383941e-43
PYVX_18171147562942203855e-43
PYAP_17762147563483203791e-41
PPTG_17127147563513383749e-41
CCA18899147563432303669e-40
PHALS_06478147563452303633e-39
PYIR_13451147563592323531e-37
PYIW_19971147563483343223e-33
PHYKE_8393147563263342961e-29
PYAR_13570147563222172881e-28
CCI45123147563011942582e-24
PPTG_188981612815591061601e-10
PITG_205621612815591061591e-10
PYU1_G0063471612810951231562e-10
PYAR_23286161286071031553e-10
PYIW_17381161289521121553e-10
PYIR_215891612815681221554e-10
SPRG_0605912510913121221501e-09
H257_067221612814821041502e-09
PHYRA_849161612815411041492e-09
H310_002311612814951221492e-09
SPRG_060581612812581151483e-09
SDRG_127621612813921241465e-09
PHYSO_3617471612815231041465e-09
HYAP_086451612815141041457e-09
SDRG_1276312510913171081431e-08
PHYKE_19901612814991031402e-08
PYVX_204381612813461031385e-08
PHYKE_2479144591711071281e-07
PYAP_169971612810181001332e-07
CCI447521612815261071323e-07
PYVX_13574144599501031304e-07
PYIW_13172144599391031287e-07
CCA188751612815141071288e-07
PYIR_15309144599371031288e-07
PHYSO_5445981526711631091288e-07
H310_0023012510912481231289e-07
PHYRA_825431526711991091271e-06
PPTG_193711526711951091271e-06
PHYCA_503112152926214971221e-06
PYAP_186361526710091091252e-06
SDRG_14487123428964561242e-06
SPRG_02752123428831541243e-06
SPRG_003641222722551061203e-06
PITG_192131526712011091233e-06
H257_163491222722621051204e-06
PHALS_06533144599301041224e-06
PYIR_23372158351415981224e-06
PYIW_18491158351684981225e-06
PYU1_G001063144597831031225e-06
PYAR_154631526710911091225e-06
SPRG_05449144597231001215e-06
H257_0672112510912381231216e-06
PHYRA_77834144599361051216e-06
PHALS_040981526711831091216e-06
PYAR_25500158354731011198e-06
PPTG_1340114459927971208e-06
PITG_1806714459924971198e-06
SDRG_035311222722551031169e-06
SDRG_0880014459881991199e-06
H310_04843152679681171199e-06
PYU1_G012859185011831471199e-06
PYAP_241441583510221081181e-05
CCA180231526711381241181e-05
PHYKE_6662152677651091181e-05
PITG_113039318293421151e-05
CCA2453118533741801162e-05
CCA171021529268841041172e-05
CCI462351526711551091162e-05
PITG_201031583513011151163e-05
PYIR_183821526711541091153e-05
HYAP_044571526712031251153e-05
PYU1_G008848152677651091153e-05
SDRG_00080124544298461133e-05
PHYRA_793481583512401131153e-05
H310_054571222722691051123e-05
PYU1_G00950895765328341133e-05
H257_03093152679751181144e-05
PHYKE_56782417809461144e-05
PYIW_16987152678211091144e-05
CCI41225144599811111135e-05
PPTG_068231583513211151135e-05
SPRG_16312131322261461106e-05
PHYCA_5061372417810461126e-05
PHYCA_504712162081061087e-05
H257_03361123428699611127e-05
PHYRA_792812417809461127e-05
PYAR_1461586325171061118e-05
PYAR_19914144597881031128e-05
CCA190971856688391101e-04
PPTG_055192417810441111e-04
PHYSO_3441122417813441101e-04
PYVX_133121526710161091111e-04
PITG_027622417810441101e-04
CCI104891587097771241101e-04
PYAP_17290144598351011101e-04
PYAP_2219586329011061101e-04
PYIR_151181347912221521101e-04
PYAP_1665895765294341081e-04
CCA16487144599751051091e-04
PYU1_G00673286329541061091e-04
PYIW_18911134791196341092e-04
SPRG_00890152678831451092e-04
PYIR_2301286329651191092e-04
PYAR_1988324178331231092e-04
CCI424571529269061051092e-04
PHYKE_491118534639962e-04
CCI4714518533901951072e-04
PYIW_184802417755421082e-04
CCA217152417782431082e-04
CCA21860155078782431082e-04
H310_0637814459837971082e-04
PHYSO_3152551583513011131082e-04
HYAP_080262417798441082e-04
CCA25510134791139341083e-04
PYIW_21944288513171851083e-04
SDRG_01407152678151451073e-04
PYVX_16714863210301061073e-04
CCI4345611092126641003e-04
PYVX_183382417746491073e-04
PHYSO_484541169111211073e-04
PYVX_1903012554556911063e-04
SPRG_1702213189210741983e-04
H310_002091583511981061073e-04
H310_12448125545551131063e-04
PYVX_225891583513751151064e-04
PHALS_036452417830441064e-04
PYIR_13168288513531021055e-04
PYVX_1452760301269521055e-04
PHALS_0972986329491341055e-04
PYU1_G012274158358731151055e-04
H257_09028125545561431045e-04
PPTG_16659169161051055e-04
H257_0818216859541055e-04
PITG_10462863210281081056e-04
SDRG_024381354502241351016e-04
PYIR_131202417814421046e-04
PYIW_21108951125932061056e-04
HYAP_095111583512951011056e-04
PHYRA_78815169191051046e-04
PHYCA_56429686329571081046e-04
CCI4190977002821141026e-04
PHYRA_82040863210541081046e-04
SPRG_04912124544261461026e-04
PHALS_03540169041061046e-04
CCA191181109212564976e-04
PYAP_226462417815421046e-04
PPTG_0878586329441081047e-04
SPRG_008891225189941271047e-04
PHYKE_104486325211091037e-04
H257_066981583511991181047e-04
PHYSO_55849886329671081047e-04
PYIR_17453951126191291047e-04
PITG_00020169271051047e-04
PYAR_2432361478831101039e-04
PHYSO_35019712554557911020.001
CCA19033951118831161030.001
CCI43793134791117341020.001
PPTG_146301853398461010.001
H310_019211853341461000.001
PYAP_19753614713401171020.001
CCI4512716098720274980.001
PYU1_G0043862417837421020.001
PYAP_16161986618891061020.001
PITG_021091853522461010.001
H257_1356714459836351010.001
PYVX_13084134791267341020.001
PYIW_2152686329631351010.001
H310_0880316916481010.001
CCA22329132529352191010.002
PYIR_2224612554559911000.002
PYIW_1781818501188271010.002
PYAP_13695185334853990.002
SDRG_05150241778741990.002
SPRG_08346241779741990.002
H257_03363185331646980.003
SPRG_119001660549990.003
H310_07701241781141990.003
PYIR_13555185335544970.003
PHALS_11367158351329113990.003
H257_10913131211650120990.003
H257_07514241781041980.003
PHALS_06568185338845970.003
PHYRA_7343218501313104980.003
PYU1_G012870185335234970.004
SDRG_062881664154970.004
HYAP_073488632973108980.004
HYAP_117121255455894970.004
PHYKE_55881675137970.004
PYAP_2268528851104131970.005
PYU1_G0091781151733681960.005
PHALS_0558728851361128970.005
SDRG_021352194430633950.005
PITG_036523199710103960.006
PHYCA_504801185339852950.006
SPRG_085322885129299960.006
SDRG_063422885129299960.006
SPRG_02753185330949950.006
SDRG_01408122518916114960.006
H257_06469219447630870.006
SDRG_14486185330849940.006
SPRG_139757700331107950.006
PHYKE_91461255455799950.007
SDRG_070127700331107940.007
PHYSO_5334224131721124950.007
HYAP_1401316398106950.007
HYAP_0930413479114434960.007
PHYCA_5399813199712103950.007
H257_05679770036798940.007
H310_139117700369113940.008
PYU1_G0032291681050950.008
PYU1_G0007249278718940920.008
PITG_080086681712115950.008
HYAP_117131764541794940.008
PPTG_1915381951219171950.009
PHYRA_847863199716103940.010
PHYSO_3436291445997730940.010
PPTG_1898913479121334940.011
CCI46733154577889167940.011
PYU1_G0012687700263106920.012
H257_039319639695110940.012
SPRG_143129639661102930.012
PHALS_0793013479120034940.012
CCI4589595111721105940.013
PYVX_2189428851365100940.013
HYAP_137571151726268910.013
PPTG_09008139341660173940.013
PHYSO_478611185352235930.013
PYIW_20891185329134920.013
PHYRA_8194413479114934930.014
SPRG_0832612631050152930.014
PHYRA_73430185339539920.014
PYAR_1869095112455115930.015
PYU1_G01126161471328122930.015
PYIW_248697700269106910.015
SDRG_0512812631051251920.015
H310_09363140947195456930.016
PHYRA_944092885127033930.016
CCI452901325293965930.017
CCA271571255455399920.018
PITG_033182885134333920.018
PHYSO_2484812885128333920.018
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= H310_09223

Length=333
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

H310_09223                                                            582        0.0   
H257_06294                                                            472        2e-167
SDRG_01781                                                            273        4e-89 
SPRG_06336                                                            271        1e-88 
PYU1_G001735                                                          166        2e-47 
PHYSO_471523                                                          158        1e-44 
PHYCA_556162                                                          157        4e-44 
PITG_18456                                                            156        6e-44 
PHYRA_81100                                                           156        1e-43 
PYVX_18171                                                            152        5e-43 
PYAP_17762                                                            150        1e-41 
PPTG_17127                                                            148        9e-41 
CCA18899                                                              145        9e-40 
PHALS_06478                                                           144        3e-39 
PYIR_13451                                                            140        1e-37 
PYIW_19971                                                            128        3e-33 
PHYKE_8393                                                            118        1e-29 
PYAR_13570                                                            115        1e-28 
CCI45123                                                              103        2e-24 
PPTG_18898                                                            66.2       1e-10 
PITG_20562                                                            65.9       1e-10 
PYU1_G006347                                                          64.7       2e-10 
PYAR_23286                                                            64.3       3e-10 
PYIW_17381                                                            64.3       3e-10 
PYIR_21589                                                            64.3       4e-10 
SPRG_06059                                                            62.4       1e-09 
H257_06722                                                            62.4       2e-09 
PHYRA_84916                                                           62.0       2e-09 
H310_00231                                                            62.0       2e-09 
SPRG_06058                                                            61.6       3e-09 
SDRG_12762                                                            60.8       5e-09 
PHYSO_361747                                                          60.8       5e-09 
HYAP_08645                                                            60.5       7e-09 
SDRG_12763                                                            59.7       1e-08 
PHYKE_1990                                                            58.5       2e-08 
PYVX_20438                                                            57.8       5e-08 
PHYKE_2479                                                            53.9       1e-07 
PYAP_16997                                                            55.8       2e-07 
CCI44752                                                              55.5       3e-07 
PYVX_13574                                                            54.7       4e-07 
PYIW_13172                                                            53.9       7e-07 
CCA18875                                                              53.9       8e-07 
PYIR_15309                                                            53.9       8e-07 
PHYSO_544598                                                          53.9       8e-07 
H310_00230                                                            53.9       9e-07 
PHYRA_82543                                                           53.5       1e-06 
PPTG_19371                                                            53.5       1e-06 
PHYCA_503112                                                          51.6       1e-06 
PYAP_18636                                                            52.8       2e-06 
SDRG_14487                                                            52.4       2e-06 
SPRG_02752                                                            52.4       3e-06 
SPRG_00364                                                            50.8       3e-06 
PITG_19213                                                            52.0       3e-06 
H257_16349                                                            50.8       4e-06 
PHALS_06533                                                           51.6       4e-06 
PYIR_23372                                                            51.6       4e-06 
PYIW_18491                                                            51.6       5e-06 
PYU1_G001063                                                          51.6       5e-06 
PYAR_15463                                                            51.6       5e-06 
SPRG_05449                                                            51.2       5e-06 
H257_06721                                                            51.2       6e-06 
PHYRA_77834                                                           51.2       6e-06 
PHALS_04098                                                           51.2       6e-06 
PYAR_25500                                                            50.4       8e-06 
PPTG_13401                                                            50.8       8e-06 
PITG_18067                                                            50.4       8e-06 
SDRG_03531                                                            49.3       9e-06 
SDRG_08800                                                            50.4       9e-06 
H310_04843                                                            50.4       9e-06 
PYU1_G012859                                                          50.4       9e-06 
PYAP_24144                                                            50.1       1e-05 
CCA18023                                                              50.1       1e-05 
PHYKE_6662                                                            50.1       1e-05 
PITG_11303                                                            48.9       1e-05 
CCA24531                                                              49.3       2e-05 
CCA17102                                                              49.7       2e-05 
CCI46235                                                              49.3       2e-05 
PITG_20103                                                            49.3       3e-05 
PYIR_18382                                                            48.9       3e-05 
HYAP_04457                                                            48.9       3e-05 
PYU1_G008848                                                          48.9       3e-05 
SDRG_00080                                                            48.1       3e-05 
PHYRA_79348                                                           48.9       3e-05 
H310_05457                                                            47.8       3e-05 
PYU1_G009508                                                          48.1       3e-05 
H257_03093                                                            48.5       4e-05 
PHYKE_5678                                                            48.5       4e-05 
PYIW_16987                                                            48.5       4e-05 
CCI41225                                                              48.1       5e-05 
PPTG_06823                                                            48.1       5e-05 
SPRG_16312                                                            47.0       6e-05 
PHYCA_506137                                                          47.8       6e-05 
PHYCA_504712                                                          46.2       7e-05 
H257_03361                                                            47.8       7e-05 
PHYRA_79281                                                           47.8       7e-05 
PYAR_14615                                                            47.4       8e-05 
PYAR_19914                                                            47.8       8e-05 
CCA19097                                                              47.0       1e-04 
PPTG_05519                                                            47.4       1e-04 
PHYSO_344112                                                          47.0       1e-04 
PYVX_13312                                                            47.4       1e-04 
PITG_02762                                                            47.0       1e-04 
CCI10489                                                              47.0       1e-04 
PYAP_17290                                                            47.0       1e-04 
PYAP_22195                                                            47.0       1e-04 
PYIR_15118                                                            47.0       1e-04 
PYAP_16658                                                            46.2       1e-04 
CCA16487                                                              46.6       1e-04 
PYU1_G006732                                                          46.6       1e-04 
PYIW_18911                                                            46.6       2e-04 
SPRG_00890                                                            46.6       2e-04 
PYIR_23012                                                            46.6       2e-04 
PYAR_19883                                                            46.6       2e-04 
CCI42457                                                              46.6       2e-04 
PHYKE_4911                                                            41.6       2e-04 
CCI47145                                                              45.8       2e-04 
PYIW_18480                                                            46.2       2e-04 
CCA21715                                                              46.2       2e-04 
CCA21860                                                              46.2       2e-04 
H310_06378                                                            46.2       2e-04 
PHYSO_315255                                                          46.2       2e-04 
HYAP_08026                                                            46.2       2e-04 
CCA25510                                                              46.2       3e-04 
PYIW_21944                                                            46.2       3e-04 
SDRG_01407                                                            45.8       3e-04 
PYVX_16714                                                            45.8       3e-04 
CCI43456                                                              43.1       3e-04 
PYVX_18338                                                            45.8       3e-04 
PHYSO_484541                                                          45.8       3e-04 
PYVX_19030                                                            45.4       3e-04 
SPRG_17022                                                            42.4       3e-04 
H310_00209                                                            45.8       3e-04 
H310_12448                                                            45.4       3e-04 
PYVX_22589                                                            45.4       4e-04 
PHALS_03645                                                           45.4       4e-04 
PYIR_13168                                                            45.1       5e-04 
PYVX_14527                                                            45.1       5e-04 
PHALS_09729                                                           45.1       5e-04 
PYU1_G012274                                                          45.1       5e-04 
H257_09028                                                            44.7       5e-04 
PPTG_16659                                                            45.1       5e-04 
H257_08182                                                            45.1       5e-04 
PITG_10462                                                            45.1       6e-04 
SDRG_02438                                                            43.5       6e-04 
PYIR_13120                                                            44.7       6e-04 
PYIW_21108                                                            45.1       6e-04 
HYAP_09511                                                            45.1       6e-04 
PHYRA_78815                                                           44.7       6e-04 
PHYCA_564296                                                          44.7       6e-04 
CCI41909                                                              43.9       6e-04 
PHYRA_82040                                                           44.7       6e-04 
SPRG_04912                                                            43.9       6e-04 
PHALS_03540                                                           44.7       6e-04 
CCA19118                                                              42.0       6e-04 
PYAP_22646                                                            44.7       6e-04 
PPTG_08785                                                            44.7       7e-04 
SPRG_00889                                                            44.7       7e-04 
PHYKE_1044                                                            44.3       7e-04 
H257_06698                                                            44.7       7e-04 
PHYSO_558498                                                          44.7       7e-04 
PYIR_17453                                                            44.7       7e-04 
PITG_00020                                                            44.7       7e-04 
PYAR_24323                                                            44.3       9e-04 
PHYSO_350197                                                          43.9       0.001 
CCA19033                                                              44.3       0.001 
CCI43793                                                              43.9       0.001 
PPTG_14630                                                            43.5       0.001 
H310_01921                                                            43.1       0.001 
PYAP_19753                                                            43.9       0.001 
CCI45127                                                              42.4       0.001 
PYU1_G004386                                                          43.9       0.001 
PYAP_16161                                                            43.9       0.001 
PITG_02109                                                            43.5       0.001 
H257_13567                                                            43.5       0.001 
PYVX_13084                                                            43.9       0.001 
PYIW_21526                                                            43.5       0.001 
H310_08803                                                            43.5       0.001 
CCA22329                                                              43.5       0.002 
PYIR_22246                                                            43.1       0.002 
PYIW_17818                                                            43.5       0.002 
PYAP_13695                                                            42.7       0.002 
SDRG_05150                                                            42.7       0.002 
SPRG_08346                                                            42.7       0.002 
H257_03363                                                            42.4       0.003 
SPRG_11900                                                            42.7       0.003 
H310_07701                                                            42.7       0.003 
PYIR_13555                                                            42.0       0.003 
PHALS_11367                                                           42.7       0.003 
H257_10913                                                            42.7       0.003 
H257_07514                                                            42.4       0.003 
PHALS_06568                                                           42.0       0.003 
PHYRA_73432                                                           42.4       0.003 
PYU1_G012870                                                          42.0       0.004 
SDRG_06288                                                            42.0       0.004 
HYAP_07348                                                            42.4       0.004 
HYAP_11712                                                            42.0       0.004 
PHYKE_5588                                                            42.0       0.004 
PYAP_22685                                                            42.0       0.005 
PYU1_G009178                                                          41.6       0.005 
PHALS_05587                                                           42.0       0.005 
SDRG_02135                                                            41.2       0.005 
PITG_03652                                                            41.6       0.006 
PHYCA_504801                                                          41.2       0.006 
SPRG_08532                                                            41.6       0.006 
SDRG_06342                                                            41.6       0.006 
SPRG_02753                                                            41.2       0.006 
SDRG_01408                                                            41.6       0.006 
H257_06469                                                            38.1       0.006 
SDRG_14486                                                            40.8       0.006 
SPRG_13975                                                            41.2       0.006 
PHYKE_9146                                                            41.2       0.007 
SDRG_07012                                                            40.8       0.007 
PHYSO_533422                                                          41.2       0.007 
HYAP_14013                                                            41.2       0.007 
HYAP_09304                                                            41.6       0.007 
PHYCA_539981                                                          41.2       0.007 
H257_05679                                                            40.8       0.007 
H310_13911                                                            40.8       0.008 
PYU1_G003229                                                          41.2       0.008 
PYU1_G000724                                                          40.0       0.008 
PITG_08008                                                            41.2       0.008 
HYAP_11713                                                            40.8       0.008 
PPTG_19153                                                            41.2       0.009 
PHYRA_84786                                                           40.8       0.010 
PHYSO_343629                                                          40.8       0.010 
PPTG_18989                                                            40.8       0.011 
CCI46733                                                              40.8       0.011 
PYU1_G001268                                                          40.0       0.012 
H257_03931                                                            40.8       0.012 
SPRG_14312                                                            40.4       0.012 
PHALS_07930                                                           40.8       0.012 
CCI45895                                                              40.8       0.013 
PYVX_21894                                                            40.8       0.013 
HYAP_13757                                                            39.7       0.013 
PPTG_09008                                                            40.8       0.013 
PHYSO_478611                                                          40.4       0.013 
PYIW_20891                                                            40.0       0.013 
PHYRA_81944                                                           40.4       0.014 
SPRG_08326                                                            40.4       0.014 
PHYRA_73430                                                           40.0       0.014 
PYAR_18690                                                            40.4       0.015 
PYU1_G011261                                                          40.4       0.015 
PYIW_24869                                                            39.7       0.015 
SDRG_05128                                                            40.0       0.015 
H310_09363                                                            40.4       0.016 
PHYRA_94409                                                           40.4       0.016 
CCI45290                                                              40.4       0.017 
CCA27157                                                              40.0       0.018 
PITG_03318                                                            40.0       0.018 
PHYSO_248481                                                          40.0       0.018 
PYIR_21831                                                            38.5       0.018 
PPTG_16044                                                            40.0       0.019 
PYAR_18008                                                            37.7       0.020 
PITG_07572                                                            38.9       0.020 
PYAR_19122                                                            39.7       0.020 
PITG_19979                                                            38.9       0.022 
CCA25744                                                              39.3       0.022 
CCA15513                                                              40.0       0.022 
PHYSO_320361                                                          39.3       0.023 
SDRG_14771                                                            39.7       0.024 
H310_02933                                                            39.7       0.024 
H310_06666                                                            39.7       0.024 
PYIR_22667                                                            39.7       0.025 
PHALS_10968                                                           39.3       0.026 
PYAR_21583                                                            38.9       0.027 
PHYKE_10704                                                           39.3       0.028 
HYAP_06101                                                            39.7       0.028 
SPRG_09211                                                            39.3       0.028 
PYAP_23744                                                            37.0       0.032 
PHYRA_73297                                                           37.0       0.033 
SPRG_02502                                                            37.0       0.033 
PHYCA_71329                                                           36.2       0.033 
SDRG_02154                                                            39.3       0.033 
SDRG_05608                                                            37.0       0.033 
PYVX_14287                                                            39.3       0.034 
PYIR_25066                                                            38.5       0.034 
PHYRA_77134                                                           39.3       0.036 
PPTG_14626                                                            39.3       0.037 
SPRG_06273                                                            39.3       0.038 
SDRG_01838                                                            39.3       0.039 
PHYCA_509385                                                          38.9       0.040 
PHYSO_349983                                                          38.9       0.041 
H310_01510                                                            38.9       0.044 
H257_08793                                                            38.9       0.044 
PHYSO_552247                                                          38.9       0.044 
PHYRA_79406                                                           38.1       0.045 
H257_00263                                                            38.9       0.046 
CCA20666                                                              38.9       0.046 
H310_14019                                                            38.5       0.051 
H310_02031                                                            38.5       0.052 
SPRG_06061                                                            38.5       0.053 
SDRG_07310                                                            38.5       0.053 
PYAP_19085                                                            38.5       0.056 
H257_03521                                                            38.5       0.058 
H310_07070                                                            38.5       0.059 
PYAR_14218                                                            38.5       0.062 
PITG_02106                                                            38.5       0.062 
PYU1_G009249                                                          38.5       0.063 
CCI40991                                                              38.5       0.063 
SPRG_01860                                                            38.1       0.064 
H257_01308                                                            38.5       0.064 
SPRG_08834                                                            38.1       0.066 
CCI45857                                                              38.1       0.068 
SDRG_08236                                                            38.1       0.068 
PHALS_06699                                                           38.1       0.068 
PYIW_16158                                                            38.1       0.068 
SPRG_21393                                                            38.1       0.072 
PYVX_14593                                                            38.1       0.075 
H310_13627                                                            38.1       0.077 
PPTG_13492                                                            38.1       0.077 
CCA26890                                                              38.1       0.080 
PITG_14197                                                            37.7       0.080 
HYAP_13690                                                            37.7       0.083 
HYAP_11295                                                            37.7       0.086 
CCA23572                                                              38.1       0.087 
PHYKE_4241                                                            37.7       0.089 
PHYKE_7856                                                            37.4       0.092 
SDRG_12776                                                            37.7       0.100 
PYIR_14542                                                            37.4       0.10  
PYIR_22259                                                            35.8       0.10  
PPTG_08670                                                            37.0       0.10  
PYU1_G010818                                                          36.2       0.11  
PYIR_14494                                                            37.7       0.11  
SPRG_06021                                                            37.7       0.11  
SDRG_05567                                                            37.7       0.11  
PHALS_12503                                                           37.4       0.11  
H257_10063                                                            37.4       0.12  
SPRG_02939                                                            37.7       0.12  
PYU1_G007013                                                          37.4       0.13  
PYAP_15732                                                            37.0       0.13  
PYAP_18827                                                            37.4       0.14  
HYAP_13688                                                            37.4       0.14  
PHYRA_85319                                                           37.0       0.15  
SDRG_03414                                                            37.0       0.15  
PYAP_19560                                                            36.6       0.15  
PHALS_00378                                                           37.4       0.15  
PYVX_15906                                                            35.0       0.15  
PHYKE_5585                                                            36.6       0.16  
SPRG_18807                                                            37.0       0.16  
PYIW_25250                                                            36.6       0.16  
PYAP_17960                                                            37.0       0.16  
PITG_13665                                                            35.0       0.16  
HYAP_10421                                                            36.6       0.17  
PYAR_13491                                                            37.0       0.18  
PYAR_16504                                                            37.0       0.18  
PYAP_17800                                                            37.0       0.18  
HYAP_02360                                                            35.0       0.18  
PHYKE_38                                                              36.2       0.18  
H310_06449                                                            37.0       0.18  
PYIW_20221                                                            36.6       0.19  
H310_12180                                                            37.0       0.19  
PYU1_G004115                                                          35.0       0.19  
PHALS_07062                                                           34.7       0.20  
PHYRA_85100                                                           34.7       0.20  
PHYRA_85097                                                           34.7       0.20  
PYIW_16910                                                            37.0       0.20  
PHALS_06334                                                           37.0       0.20  
PYIW_19873                                                            35.8       0.20  
H310_12480                                                            35.4       0.21  
SDRG_15601                                                            36.6       0.21  
CCI10928                                                              36.6       0.22  
PHALS_09667                                                           36.6       0.22  
H257_11443                                                            36.6       0.23  
PYVX_14851                                                            35.8       0.24  
CCA17621                                                              36.6       0.24  
H310_04667                                                            36.6       0.24  
H310_13412                                                            36.6       0.25  
PYAR_16120                                                            36.6       0.25  
PHYCA_529660                                                          36.2       0.25  
CCI39367                                                              36.6       0.26  
SPRG_09332                                                            36.2       0.27  
PYU1_G013961                                                          34.3       0.27  
CCI11474                                                              36.2       0.27  
H257_05175                                                            36.2       0.27  
H257_00729                                                            34.3       0.27  
SDRG_00756                                                            36.6       0.27  
PHYKE_7347                                                            34.3       0.28  
PITG_17893                                                            36.2       0.28  
PYAR_22485                                                            35.8       0.28  
SDRG_08197                                                            36.2       0.28  
PPTG_04553                                                            36.2       0.29  
PPTG_09889                                                            35.0       0.29  
H310_01094                                                            34.3       0.29  
CCI44571                                                              34.7       0.29  
PHYKE_8531                                                            35.8       0.30  
PHYCA_510506                                                          34.3       0.30  
H257_07492                                                            36.2       0.30  
PHYSO_289146                                                          34.3       0.30  
PHALS_08097                                                           36.2       0.31  
PYU1_G007458                                                          36.2       0.32  
PYIW_14611                                                            36.2       0.32  
H257_09262                                                            36.2       0.33  
SDRG_04871                                                            36.2       0.33  
H310_07683                                                            35.8       0.34  
PYAR_17064                                                            36.2       0.34  
PYAR_16228                                                            36.2       0.34  
PHYRA_73535                                                           36.2       0.34  
HYAP_10830                                                            36.2       0.35  
SPRG_08217                                                            35.8       0.35  
SDRG_00814                                                            35.8       0.35  
HYAP_02230                                                            36.2       0.36  
PYAP_13297                                                            34.7       0.36  
CCA22367                                                              35.8       0.38  
PITG_19877                                                            35.8       0.39  
H257_01309                                                            35.8       0.39  
PHYRA_76931                                                           35.8       0.39  
H310_14188                                                            34.3       0.39  
CCI39556                                                              35.8       0.40  
PYVX_17890                                                            35.4       0.40  
PHYSO_556164                                                          35.8       0.41  
PPTG_19631                                                            33.9       0.41  
PHYRA_82811                                                           35.8       0.41  
PHALS_02608                                                           35.8       0.42  
SDRG_14286                                                            35.8       0.42  
PHYSO_541890                                                          35.8       0.43  
PHYRA_75484                                                           35.4       0.43  
SPRG_06629                                                            35.4       0.43  
H310_06667                                                            35.8       0.43  
HYAP_01795                                                            35.8       0.43  
H310_05686                                                            35.8       0.45  
PYVX_19982                                                            35.4       0.47  
PHYSO_258828                                                          35.4       0.47  
SPRG_02999                                                            35.4       0.48  
PPTG_03759                                                            35.4       0.48  
PYU1_G008119                                                          33.5       0.49  
CCA24267                                                              34.3       0.51  
CCA21572                                                              34.3       0.51  
PYAP_15706                                                            35.0       0.51  
PYAR_15792                                                            33.5       0.51  
H310_14230                                                            33.9       0.51  
SDRG_13739                                                            35.4       0.52  
SPRG_15871                                                            33.1       0.52  
PYIR_15407                                                            33.5       0.54  
PYIW_26522                                                            33.5       0.54  
PYIR_16780                                                            35.4       0.55  
PHYRA_83071                                                           35.4       0.56  
PHYKE_9717                                                            35.4       0.57  
PPTG_11714                                                            35.4       0.59  
PYAR_16674                                                            35.0       0.60  
PPTG_06991                                                            35.0       0.60  
PITG_07286                                                            35.4       0.60  
H257_11802                                                            35.0       0.61  
PHYSO_500554                                                          33.5       0.62  
PHALS_06636                                                           35.4       0.62  
PHYRA_82888                                                           35.0       0.62  
PHYRA_84721                                                           35.0       0.62  
SDRG_15262                                                            35.0       0.63  
PPTG_19471                                                            34.7       0.64  
PYVX_17508                                                            33.9       0.67  
PPTG_04169                                                            35.0       0.71  
PHYSO_529931                                                          35.0       0.72  
PHYSO_543442                                                          35.0       0.73  
HYAP_04252                                                            34.7       0.73  
H257_09823                                                            35.0       0.76  
H310_03025                                                            34.7       0.77  
PITG_11578                                                            35.0       0.79  
PHYRA_82056                                                           34.7       0.80  
SPRG_01283                                                            34.3       0.81  
PPTG_08766                                                            34.7       0.81  
PHYSO_538430                                                          34.7       0.83  
PYVX_22150                                                            34.3       0.84  
PITG_10447                                                            34.7       0.84  
PYIW_15014                                                            34.7       0.85  
PYU1_G006758                                                          34.3       0.86  
SPRG_11532                                                            34.7       0.88  
PHYRA_83696                                                           34.3       0.88  
SDRG_11258                                                            34.3       0.89  
PYAP_18890                                                            33.1       0.89  
PHYCA_6753                                                            34.7       0.93  
PYIR_21473                                                            34.7       0.93  
PHYCA_511620                                                          33.9       0.95  
SDRG_07081                                                            34.7       0.95  
PHALS_06336                                                           34.3       0.97  
SPRG_19470                                                            34.7       0.97  
PITG_00263                                                            34.7       0.97  
PHYCA_98948                                                           32.7       0.99  
PHYCA_9844                                                            33.9       0.99  
PITG_16461                                                            34.7       1.0   
PYIW_21901                                                            34.7       1.0   
PHYCA_504258                                                          33.9       1.1   
PHALS_11651                                                           34.3       1.1   
PITG_17594                                                            34.3       1.1   
PPTG_07800                                                            33.1       1.1   
PYVX_18449                                                            34.3       1.1   
PYIW_24816                                                            34.3       1.1   
PYIR_20476                                                            34.3       1.2   
SDRG_02060                                                            34.3       1.2   
PHYSO_355952                                                          33.9       1.2   
PHYSO_485120                                                          32.7       1.2   
CCI44114                                                              33.9       1.2   
H257_11158                                                            34.3       1.2   
PHYRA_80100                                                           33.9       1.2   
PHYKE_4910                                                            33.9       1.2   
PHYRA_73534                                                           34.3       1.3   
PPTG_03644                                                            33.9       1.3   
PHYSO_335887                                                          34.3       1.3   
PPTG_05753                                                            34.3       1.3   
CCI40262                                                              34.3       1.3   
PYAP_16005                                                            34.3       1.3   
SPRG_10233                                                            33.9       1.3   

>H310_09223
Length=333

 Score = 582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/333 (100%), Positives = 333/333 (100%), Gaps = 0/333 (0%)

Query  1    MHVNLSKIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSF  60
            MHVNLSKIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSF
Sbjct  1    MHVNLSKIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSF  60

Query  61   VLSECEKQDLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKT  120
            VLSECEKQDLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKT
Sbjct  61   VLSECEKQDLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKT  120

Query  121  TYIPSPSMESHGGAGHKESAGLMISLEAQIKNVKKTSHELLQQAINDAKEADRIGDATVD  180
            TYIPSPSMESHGGAGHKESAGLMISLEAQIKNVKKTSHELLQQAINDAKEADRIGDATVD
Sbjct  121  TYIPSPSMESHGGAGHKESAGLMISLEAQIKNVKKTSHELLQQAINDAKEADRIGDATVD  180

Query  181  EMAYQEEVLNDAENTVDAMGKQMDRAEDLGKSIKHPILYKFTHIFsrkkskrgkrgassk  240
            EMAYQEEVLNDAENTVDAMGKQMDRAEDLGKSIKHPILYKFTHIFSRKKSKRGKRGASSK
Sbjct  181  EMAYQEEVLNDAENTVDAMGKQMDRAEDLGKSIKHPILYKFTHIFSRKKSKRGKRGASSK  240

Query  241  krgggkstrssrVPRGvqvklhppqpqpkqeedqldELSKILAKLGQTADTISDITTRTT  300
            KRGGGKSTRSSRVPRGVQVKLHPPQPQPKQEEDQLDELSKILAKLGQTADTISDITTRTT
Sbjct  241  KRGGGKSTRSSRVPRGVQVKLHPPQPQPKQEEDQLDELSKILAKLGQTADTISDITTRTT  300

Query  301  EQVDRIDQKVTSVDERVTKEAKLVESVLKAEMT  333
            EQVDRIDQKVTSVDERVTKEAKLVESVLKAEMT
Sbjct  301  EQVDRIDQKVTSVDERVTKEAKLVESVLKAEMT  333

>H257_06294
Length=358

 Score = 472 bits (1215),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 257/358 (72%), Positives = 287/358 (80%), Gaps = 25/358 (7%)

Query  1    MHVNLSKIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSF  60
            MHVNLSKIHQTSCEGYVTKRGH+MK+WKRRYMVL+GDTLLV+YYDSKEIY S G PKGSF
Sbjct  1    MHVNLSKIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSF  60

Query  61   VLSECEKQDLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKT  120
            VLSECEKQDLSDEG SVKPFGFKFIGHCPGQGYKEY V+VE+QIDQTKWLNVAHNALGK 
Sbjct  61   VLSECEKQDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKN  120

Query  121  T----------------YIPSPSMESHGGA---------GHKESAGLMISLEAQIKNVKK  155
            +                 +P  S++ +            GHKESAGLM SLEAQ+KNVKK
Sbjct  121  SSPQKSMSQRIEEITGPLLPCASVQLNCPRRDMIHITTLGHKESAGLMQSLEAQMKNVKK  180

Query  156  TSHELLQQAINDAKEADRIGDATVDEMAYQEEVLNDAENTVDAMGKQMDRAEDLGKSIKH  215
            TS ELLQQAINDAKEADRIGDATV+EM YQE+VLNDAE TVD MG+QMD AEDLG+S+KH
Sbjct  181  TSQELLQQAINDAKEADRIGDATVNEMVYQEDVLNDAEGTVDTMGRQMDHAEDLGRSLKH  240

Query  216  PILYKFTHIFsrkkskrgkrgasskkrgggkstrssrVPRGvqvklhppqpqpkqeedql  275
            PILYK TH+F+RKKS +     S  ++GG K++RSSRV R             + E+DQL
Sbjct  241  PILYKLTHLFTRKKSYKKGGRGSKTRKGGAKASRSSRVSRVKLQPPQQQHAAAQPEDDQL  300

Query  276  dELSKILAKLGQTADTISDITTRTTEQVDRIDQKVTSVDERVTKEAKLVESVLKAEMT  333
            D+LSKILAKLGQTADTISDIT RTTEQVDRIDQKVTSVD+RV KEAKLV++VLKAEMT
Sbjct  301  DQLSKILAKLGQTADTISDITARTTEQVDRIDQKVTSVDDRVKKEAKLVQAVLKAEMT  358

>SDRG_01781
Length=335

 Score = 273 bits (697),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 153/330 (46%), Positives = 210/330 (64%), Gaps = 4/330 (1%)

Query  1    MHVNLSKIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPP-KGS  59
            M+++L+   QTSCEGYVTKRGH+MK+W+RRYMVL GDTL V+Y+DSK IYKS+ P  KGS
Sbjct  1    MNLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGS  60

Query  60   FVLSECEKQDLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGK  119
            F+L+E EK D SDEGG VKP+GFK +GH PG GYKE+ V+VET  DQT+WL VAHNALGK
Sbjct  61   FILAEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120

Query  120  TTYIPSPSMESHGGA--GHKESAGLMISLEAQIKNVKKTSHELLQQAINDAKEADRIGDA  177
                P  S +    A  GH+ ++G + S   Q++NV KT  ELL++AI   + A  +GD 
Sbjct  121  NV-APQASADQRATALLGHRAASGFLTSAPVQLRNVNKTKEELLRKAIVTLEHARTVGDN  179

Query  178  TVDEMAYQEEVLNDAENTVDAMGKQMDRAEDLGKSIKHPILYKFTHIFsrkkskrgkrga  237
            TV EM +  E+L+ AE  +D +G ++DR +++ K +  P  Y F+   S+KK     +  
Sbjct  180  TVSEMGHNAEMLDIAEANMDYVGTELDRGDNIIKKMTSPFFYYFSSSKSKKKGAGSPKSK  239

Query  238  sskkrgggkstrssrVPRGvqvklhppqpqpkqeedqldELSKILAKLGQTADTISDITT  297
            S++         S    +          P     +D+LD+LSKILA L   A+TIS    
Sbjct  240  SARSHLPQTPMNSPTNKKPSGPTSKTGGPTTDAGDDELDQLSKILASLEVHANTISTEVE  299

Query  298  RTTEQVDRIDQKVTSVDERVTKEAKLVESV  327
            RTTEQ+DRI +K+   DERV +++  V ++
Sbjct  300  RTTEQIDRIQKKMVEADERVVEQSAKVHAI  329

>SPRG_06336
Length=335

 Score = 271 bits (694),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 151/330 (46%), Positives = 208/330 (63%), Gaps = 4/330 (1%)

Query  1    MHVNLSKIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPP-KGS  59
            M+++L+   QTSCEGYVTKRGH+MK+W+RRYMVL GDTL V+YYDSK IYKS+ P  KGS
Sbjct  1    MNLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGS  60

Query  60   FVLSECEKQDLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGK  119
            F+L+E EK D SDEGG VKP+GFK +GH PG GYKE+ V+VET  DQT+WL VAHNALGK
Sbjct  61   FILAEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120

Query  120  TTYIPSPSMESHGGA--GHKESAGLMISLEAQIKNVKKTSHELLQQAINDAKEADRIGDA  177
                P  S++    A  GH+  +G + S   Q++NV KT  ELL++AI   + A  +GD 
Sbjct  121  NV-TPQASVDQRASALLGHRAPSGFLTSAPVQLRNVNKTKEELLRKAIVTLEHARTVGDN  179

Query  178  TVDEMAYQEEVLNDAENTVDAMGKQMDRAEDLGKSIKHPILYKFTHIFsrkkskrgkrga  237
            TV EM +  E+L+ AE  +D +  ++DR +++ K +  P  Y F+   S+KK     +  
Sbjct  180  TVSEMGHNAEMLDIAEANMDYVETELDRGDNIIKKMTSPFFYYFSSSKSKKKGTGSPKSK  239

Query  238  sskkrgggkstrssrVPRGvqvklhppqpqpkqeedqldELSKILAKLGQTADTISDITT  297
            S++         S    +                +D+LD+LSKILA L   A+TIS    
Sbjct  240  SARSHQPQTPMNSPTHKKSSGPASKAGGATTDAGDDELDQLSKILASLEVHANTISTEVE  299

Query  298  RTTEQVDRIDQKVTSVDERVTKEAKLVESV  327
            RTTEQ+DRI +K+   DER+ +++  V ++
Sbjct  300  RTTEQIDRIQKKMVEADERIVEQSAKVHAI  329

>PYU1_G001735
Length=342

 Score = 166 bits (419),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 109/323 (34%), Positives = 177/323 (55%), Gaps = 9/323 (3%)

Query  11   TSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGP-PKGSFVLSECEKQD  69
            TSCEGYVTKRGH  K+W+ RY+V +G  L V+Y++S++   + G  PKGSF +S  EK +
Sbjct  22   TSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHE  81

Query  70   --LSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSPS  127
              +   GG  KPFGFK +GH P +GY E  +FVE+  D  KWL V  NAL     +    
Sbjct  82   YWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKLTRKG  141

Query  128  MESHGGAGHKESAGLMISLEAQIKNVKKTSHELLQQAINDAKEADRIGDATVDEMAYQEE  187
            M     +      G  IS + Q+K +  T  ELL++A+ + + A  IG   V+E+  Q E
Sbjct  142  MTDSTKSMF--GFGASISPQLQVKKLAATKEELLREALREIEGAKLIGREAVNEIVSQGE  199

Query  188  VLNDAENTVDAMGKQMDRAEDLGKSIKHPILYKFTHIFsrkkskrgkrgasskkrgggks  247
             L+  EN +  +   +D A+ L + +K P+L    H+FS    ++     ++     G +
Sbjct  200  KLDQVENDLGHVEGDLDHADKLLRHLKSPVL----HVFSNDNRQKKGAPTAATASASGGA  255

Query  248  trssrVPRGvqvklhppqpqpkqeedqldELSKILAKLGQTADTISDITTRTTEQVDRID  307
            + ++    G + +LH          + L+ L+  L++L + A+ ++    R+TEQ+ RI+
Sbjct  256  SATTSPVSGTEGQLHAKITGGGGTLNDLEMLALALSELEEQANLMNAEAARSTEQIARIE  315

Query  308  QKVTSVDERVTKEAKLVESVLKA  330
            +++TSV++RV  + K   + +KA
Sbjct  316  ERLTSVNDRVQHQTKKATATMKA  338

>PHYSO_471523
Length=348

 Score = 158 bits (400),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 109/336 (32%), Positives = 169/336 (50%), Gaps = 25/336 (7%)

Query  7    KIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKE-IYKSNG---PPKGSFVL  62
            K   TSCEGYVTKRGH  K+W+ R++VL G  L V+YY+S+   +   G    PKGSF L
Sbjct  17   KARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYL  76

Query  63   SECEKQD--LSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKT  120
            S  E  +  +   G + KPFGFK +GH P +GY E  VFVET  D+ KWL VA NAL   
Sbjct  77   SSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNALSAK  136

Query  121  TYIPSPSMESHGGAGHKESAGLMISL--------EAQIKNVKKTSHELLQQAINDAKEAD  172
              +   +++       K   G  ISL        + Q++ + K+  ELL  A+ D + A 
Sbjct  137  RQLTRQAIDQSVSPNRKNLFGFNISLSPQPNMSPQKQMQTLTKSRDELLSDALRDIEAAK  196

Query  173  RIGDATVDEMAYQEEVLNDAENTVDAMGKQMDRAEDLGKSIKHPILYKFTHIFsrkkskr  232
            ++G    +E+  Q E L+  E  + A+ + +D  + L + +K P L    H+FS     +
Sbjct  197  QVGREACNEIVTQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSPTL----HLFSDDSRPK  252

Query  233  gkrgasskkrgggkstrssrVPRGvqvklhppqpqpkqeedqldELSKILAKLGQTADTI  292
                 +S  +   +S R  R+P                    L+ L++ L +L   A+ +
Sbjct  253  ASASKASSPQRSQQSGRPPRLP-------PAMDSINDAGVSDLERLAQALGELEVQAELL  305

Query  293  SDITTRTTEQVDRIDQKVTSVDERVTKEAKLVESVL  328
            +    R T+Q++RI+ ++++V  RV K+ K   + L
Sbjct  306  NGEAGRGTQQIERIEHQLSNVTARVEKQTKQASAAL  341

>PHYCA_556162
Length=351

 Score = 157 bits (397),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 105/341 (31%), Positives = 168/341 (49%), Gaps = 28/341 (8%)

Query  7    KIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKE-IYKSNG---PPKGSFVL  62
            K   TSCEGYVTKRGH  K+W+ R++VL G  L V YY+S+   + + G   PPKGSF L
Sbjct  17   KARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYL  76

Query  63   SECEKQD--LSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKT  120
            S  E  +  +   G + KPFGFK +GH P +GY E  VFVET  D+ KWL VA NAL   
Sbjct  77   SSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALSAK  136

Query  121  TYIPSPSMESHGGAGHKESAGLMISL--------EAQIKNVKKTSHELLQQAINDAKEAD  172
              +   +++       K   G  +SL        + Q++ + K   +LL  A+ D + A 
Sbjct  137  RQLTRQAIDQSVSPNKKNLFGFSVSLSPQPALSPQKQMQTLTKNKDDLLSDALRDIEAAK  196

Query  173  RIGDATVDEMAYQEEVLNDAENTVDAMGKQMDRAEDLGKSIKHPILYKFTHIFsrkkskr  232
            +IG    +E+  Q E L+  E  + A+ + +D  + L + +K P L+ F++    K +  
Sbjct  197  QIGREACNEIVIQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSPTLHMFSNDSRPKSTSS  256

Query  233  gkrgasskkrgggkstrssrVPRGvqvklhppqpqpkqeedqldELSKILAKLGQ---TA  289
             K  +  + +             G        Q    + +    +L ++   LG+    A
Sbjct  257  SKANSPQRSQQS-----------GGSSPTRLAQAAESRIDPGASDLERLAQALGELELQA  305

Query  290  DTISDITTRTTEQVDRIDQKVTSVDERVTKEAKLVESVLKA  330
            + ++D    +T+Q+  I+  +++V  RV K+ K   + L+A
Sbjct  306  ELLNDEAGHSTQQIQTIEHHLSTVTGRVEKQTKQASATLRA  346

>PITG_18456
Length=351

 Score = 156 bits (395),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 106/338 (31%), Positives = 169/338 (50%), Gaps = 22/338 (7%)

Query  7    KIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEI----YKSNGPPKGSFVL  62
            K   TSCEGYVTKRGH  K+W+ R++V+ G  L V+YY+S+            PKG F L
Sbjct  17   KARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYL  76

Query  63   SECEKQD--LSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKT  120
            S  E  +  +   G + KPFGFK +GH P +GY E  VFV+T  D+ KWL VA NALG  
Sbjct  77   SSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALGAK  136

Query  121  TYIPSPSMESHGGAGHKESAGLMISL--------EAQIKNVKKTSHELLQQAINDAKEAD  172
              +   +++     G K   G  +SL        + QI+ + K+  ELL QA+ + + A 
Sbjct  137  RQLTRQAIDQSVSPGKKNLFGFSVSLSPQPAMSPQKQIQTLSKSKDELLSQALRELEAAK  196

Query  173  RIGDATVDEMAYQEEVLNDAENTVDAMGKQMDRAEDLGKSIKHPILYKFTHIFsrkkskr  232
             +G    +E+  Q E L+  E  + A+ + +D  + L + +K P L+ F+     K +  
Sbjct  197  LVGREACNEIVVQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSPTLHLFSDDSRPKSTGS  256

Query  233  gkrgasskkrgggkstrssrVPRGvqvklhppqpqpkqeedqldELSKILAKLGQTADTI  292
             K  +  +    G S+ +   P          +         L+ L++ L +L   A+ +
Sbjct  257  SKGSSPQRSHQSGGSSPTRLPP--------ALEISSDAGVSDLERLAQALGELEVQAELL  308

Query  293  SDITTRTTEQVDRIDQKVTSVDERVTKEAKLVESVLKA  330
            +    R+++Q++RI+  +T+V  RV K+ K   + L A
Sbjct  309  NGEAGRSSQQIERIEHHLTNVTTRVEKQTKQASATLSA  346

>PHYRA_81100
Length=349

 Score = 156 bits (394),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 106/338 (31%), Positives = 169/338 (50%), Gaps = 24/338 (7%)

Query  7    KIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGP----PKGSFVL  62
            K   TSCEGYVTKRGH  K+W+ R++VL G  L ++YY+S+            PKGSF L
Sbjct  17   KARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYL  76

Query  63   SECEKQD--LSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKT  120
            S  E  +  +   G + KPFGFK IGH P +GY E  VFVETQ D+ KWL VA NAL   
Sbjct  77   SSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAK  136

Query  121  TYIPSPSMESHGGAGHKESAGLMISL--------EAQIKNVKKTSHELLQQAINDAKEAD  172
              +   +++    +  K   G  +SL        + Q++ + +   ELL  A+ D + A 
Sbjct  137  RQLTRQAIDQSVSSNKKNLFGFGVSLSPQPLMTPQKQMQTLTQNKDELLSGALRDIEAAK  196

Query  173  RIGDATVDEMAYQEEVLNDAENTVDAMGKQMDRAEDLGKSIKHPILYKFTHIFsrkkskr  232
             +G    +E+  Q E L+  E  + A+ + +D  + L + +K P L+ F+      + K 
Sbjct  197  LVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFGDKLLRRLKSPTLHLFSD---DSRPKS  253

Query  233  gkrgasskkrgggkstrssrVPRGvqvklhppqpqpkqeedqldELSKILAKLGQTADTI  292
                  S +R        SR+P          +         L+ L++ L +L   A+ +
Sbjct  254  TASKGHSPQRSQQSGGSPSRLP-------PAMETINDAGVSDLERLAQALGELEVQAEIL  306

Query  293  SDITTRTTEQVDRIDQKVTSVDERVTKEAKLVESVLKA  330
            +    R+T+Q++R++ ++++V  RV K+ K   + L+A
Sbjct  307  NGEAGRSTQQIERVEHQLSNVTARVEKQTKQASATLRA  344

>PYVX_18171
Length=294

 Score = 152 bits (385),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 83/220 (38%), Positives = 118/220 (54%), Gaps = 8/220 (4%)

Query  8    IHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEK  67
            +  TSCEGYVTKRGH  K+W+ RY+VL G  L VAY++SK  +++    KG F LS  +K
Sbjct  9    VRPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDK  68

Query  68   Q-----DLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTY  122
                   +   G   KPFGFK +GH P +GY E  +FVET  D TKWL VAHNAL     
Sbjct  69   HAYVAGGMGAVGAQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNALESAAA  128

Query  123  IPSPSMESHGGAGHKESA---GLMISLEAQIKNVKKTSHELLQQAINDAKEADRIGDATV  179
            +   +    GG+   +S        S + Q+K +  +  ELL+ A+ + + A  IG    
Sbjct  129  MSRKAAGDGGGSATTKSLFGFSTTTSPQQQLKAMSVSKDELLKDALRELEGAKLIGREAC  188

Query  180  DEMAYQEEVLNDAENTVDAMGKQMDRAEDLGKSIKHPILY  219
             EM  Q E L+  E  +  +   +D  + L + +K P+L+
Sbjct  189  TEMVVQGEKLDGIEANLGGIESDLDYGDKLLRRLKSPVLH  228

>PYAP_17762
Length=348

 Score = 150 bits (379),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 109/320 (34%), Positives = 162/320 (51%), Gaps = 18/320 (6%)

Query  11   TSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGP-PKGSFVLSECEKQD  69
            TSCEGYVTKRGH  K+W+ R++VL+G  LLV+YYDSKE+ ++ G  PKGSF LS  EK +
Sbjct  30   TSCEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHE  89

Query  70   --LSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALG---KTTYIP  124
              +   G   KPFGFK +GH P +GY E  +FVET  D  KWL V  NAL    K T   
Sbjct  90   YYVGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTG  149

Query  125  SPSMESHGGAGHKESAGL--MISLEAQIKNVKKTSHELLQQAINDAKEADRIGDATVDEM  182
             P          K   G     S + Q+K +  T  ++L+QAI + + A  IG +   E+
Sbjct  150  QPE-----ALAPKSLFGFSPATSPQQQMKKMTATKEQMLKQAIEEIESAKLIGRSACQEI  204

Query  183  AYQEEVLNDAENTVDAMGKQMDRAEDLGKSIKHPILYKFTHIFsrkkskrgkrgasskkr  242
              Q E L+     +  +   +D A+ L + +K+P L    H+FS     R K    +K  
Sbjct  205  FIQGERLDHIGQELAHVEGDLDYADKLLRHMKNPGL----HMFSSDARDRAKNTGRTKPS  260

Query  243  gggkstrssrVPRGvqvklhppqpqpkqeedqldELSKILAKLGQTADTISDITTRTTEQ  302
                 +  S   R   +               ++ L+ +L +L Q A  +++   + T Q
Sbjct  261  SRDTPSAVSEETRA-AILSDSHDAVGGAPLSDIERLASLLGELEQQATLLNEEAIKGTAQ  319

Query  303  VDRIDQKVTSVDERVTKEAK  322
            V+R+ +++  V+ERV  + +
Sbjct  320  VERVGEQLAHVNERVKAQTR  339

>PPTG_17127
Length=351

 Score = 148 bits (374),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 103/338 (30%), Positives = 169/338 (50%), Gaps = 22/338 (7%)

Query  7    KIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKE-IYKSNG---PPKGSFVL  62
            K   TSCEGYVTKRGH  K+W+ R++V+ G  L V+YY+S+   +   G    PKGSF L
Sbjct  17   KARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYL  76

Query  63   SECEKQD--LSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKT  120
            S  E  +  +   G + KPFGFK +GH P +GY E  VFV+T  D+ KWL VA NAL   
Sbjct  77   SSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVK  136

Query  121  TYIPSPSMESHGGAGHKESAGLMISL--------EAQIKNVKKTSHELLQQAINDAKEAD  172
              +   +++       K   G  ++L        + Q++ + K+  ELL +A+ + + A 
Sbjct  137  RQLTRQAIDQSVSPNKKTLFGFSVALSPQPAMSPQKQMQTLAKSKDELLSEALRELEAAK  196

Query  173  RIGDATVDEMAYQEEVLNDAENTVDAMGKQMDRAEDLGKSIKHPILYKFTHIFsrkkskr  232
             +G    +E+  Q E L+  E  + A+ + +D  + L + +K P L+ F+     K +  
Sbjct  197  LVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFGDKLLRRLKSPTLHLFSDDSRPKSTGG  256

Query  233  gkrgasskkrgggkstrssrVPRGvqvklhppqpqpkqeedqldELSKILAKLGQTADTI  292
             K  +  +    G S+ S   P                    L+ L++ L +L   A+ +
Sbjct  257  SKGSSPQRFHQSGGSSPSRLPP--------AFDTSSDAGGSDLERLAQALGELEVQAEML  308

Query  293  SDITTRTTEQVDRIDQKVTSVDERVTKEAKLVESVLKA  330
            +   + +++Q++RI+  +T+V  RV K+ K   + L A
Sbjct  309  NGEASHSSQQIERIEHHLTNVTTRVEKQTKQASATLSA  346

>CCA18899
Length=343

 Score = 145 bits (366),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 91/230 (40%), Positives = 126/230 (55%), Gaps = 16/230 (7%)

Query  5    LSKIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKS-NGPPKGSFVLS  63
            L++   TSCEGYVTKRGH  K+W+ RY+V+ G  + V+YY+SK+  KS N  PKGSF+L 
Sbjct  10   LARYTPTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYESKDSSKSKNATPKGSFILQ  69

Query  64   ECEKQDLSDE---GGSV--KPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALG  118
              EK +        GSV  KPFGFK +GH P QGY E  VFV++  D  +WL+V +N L 
Sbjct  70   SAEKHEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLK  129

Query  119  KTTYIPSPS----MESHGGAGHKESAGLMISLEAQIKNVKKTS--HELLQQAINDAKEAD  172
             +  +   +    M++          G     + Q+   KK    HE LQQ I  AK A 
Sbjct  130  ASKCMAREAFMAEMDTTKSVLGFSYIGTTSKQQIQVLKSKKCDYIHEALQQ-IEMAKSA-  187

Query  173  RIGDATVDEMAYQEEVLNDAENTVDAMGKQMDRAEDLGKSIKHPILYKFT  222
              G+A  DE+  Q E L   E  +  +   ++ +E L KSI+HP+ Y F+
Sbjct  188  --GNAACDEIVSQGEQLGKVEQNLSTIQNDLNHSEKLIKSIRHPLRYFFS  235

>PHALS_06478
Length=345

 Score = 144 bits (363),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 84/230 (37%), Positives = 125/230 (54%), Gaps = 14/230 (6%)

Query  7    KIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKE-IYKSNGP---PKGSFVL  62
            K   TSCEGYVTKRGH  K+W+ R++VL G  L VAYY+S+   +  NG    PKGSF L
Sbjct  17   KAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYL  76

Query  63   SECEKQD--LSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKT  120
            S  E  +  +   G + +PFGFK +GH P +G+ E  VFVETQ D+ KWL VA NAL   
Sbjct  77   SNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAK  136

Query  121  TYIP--------SPSMESHGGAGHKESAGLMISLEAQIKNVKKTSHELLQQAINDAKEAD  172
              +         SP+ +   G     S   ++S + Q++ +  +   LL +A+ + + A 
Sbjct  137  RQLTRQAIDQSVSPNKKKLFGFSVPSSTQPVMSPQKQMQTLATSKEGLLLEALREIEAAK  196

Query  173  RIGDATVDEMAYQEEVLNDAENTVDAMGKQMDRAEDLGKSIKHPILYKFT  222
             +G    +E+  Q E L+  E  + A+ + +D  + L   +K P L+ F+
Sbjct  197  LVGREACNEIVNQGEKLDVIEQDLSAIDRDLDFGDKLLHRLKSPTLHFFS  246

>PYIR_13451
Length=359

 Score = 140 bits (353),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 84/232 (36%), Positives = 122/232 (53%), Gaps = 21/232 (9%)

Query  7    KIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGP--------PKG  58
            K   TSCEGYVTKRGH  K+W+ RY+V +G  L VAYY+S++  K +          PKG
Sbjct  23   KFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDASKGSSSSGGTGVPVPKG  82

Query  59   SFVLSECEKQD--LSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNA  116
            SF +S  EK +  +   GG  KPFGFK +GH P +GY E  +FVE+  D  KW+ V  NA
Sbjct  83   SFYVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQNA  142

Query  117  LGKTTYIPSPSMESHGGAGHKESAGLMISLEA------QIKNVKKTSHELLQQAINDAKE  170
            L       +      GG     +   M    A      Q+K +  T  +LL+ A+ + + 
Sbjct  143  LD-----AAKKRSRTGGFQDNSTTKTMFGFSASASPQLQVKKLAATKEDLLRDALREIEG  197

Query  171  ADRIGDATVDEMAYQEEVLNDAENTVDAMGKQMDRAEDLGKSIKHPILYKFT  222
            A  IG   V+E+  Q E L+  E+ +  +   +D A+ L + +K P+L+ F+
Sbjct  198  AKLIGREAVNEIVVQGEKLDMVESDLGKVEGDLDHADKLLRHMKRPMLHLFS  249

 Score = 37.0 bits (84),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 16/54 (30%), Positives = 36/54 (67%), Gaps = 0/54 (0%)

Query  277  ELSKILAKLGQTADTISDITTRTTEQVDRIDQKVTSVDERVTKEAKLVESVLKA  330
            +L+  L +L + A+ ++    ++TEQ+ R++Q++T+V++RV  + K   + +KA
Sbjct  302  KLALALGELEEQANLMNAEAVKSTEQIARVEQRLTAVNDRVQTQTKKANATMKA  355

>PYIW_19971
Length=348

 Score = 128 bits (322),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 102/334 (31%), Positives = 157/334 (47%), Gaps = 20/334 (6%)

Query  7    KIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECE  66
            K   TSCEGYVTKRGH  K+W+ RY+V +          +     S   PKGSF +S  E
Sbjct  21   KFKATSCEGYVTKRGHFRKSWRVRYLVFN----GADLQAAGGGGASPATPKGSFFVSSVE  76

Query  67   KQD--LSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALG---KTT  121
            K +  +   GG  KPFGFK +GH P +GY E  +FVET  D  KW+ V  NAL    K T
Sbjct  77   KHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKHT  136

Query  122  YIPSPSMESHGGAGHKESAGLMISLEAQIKNVKKTSHELLQQAINDAKEADRIGDATVDE  181
              P  +  S        SA   +S + Q+K +  T  ELL+ A+ + + A  IG   V +
Sbjct  137  RTPGAADSSTTKNMFGFSA--TVSPQLQVKKLAATKEELLRDALREIEGAKLIGREAVSD  194

Query  182  MAYQEEVLNDAENTVDAMGKQMDRAEDLGKSIKHPILYKFTHIFsrkkskrgkrgasskk  241
            +  Q   LN  E+ +  +   +D    L   +K P+L    H+FS     +     S   
Sbjct  195  IKGQGGKLNMIEDDLGKVESDLDHGGKLLNHMKRPML----HLFSNDNRSKPNAHHSGSH  250

Query  242  rgggkstrssrVPRGvqvklhppqpq--pkqeedqldELSKILAKLG---QTADTISDIT  296
                     +    G          Q   +Q+   + +L +++  LG   + A  ++   
Sbjct  251  SDHKDGHSGAHPSSGGSSAETATGAQHHQQQDTSVMSDLERLVLALGELEEQATAMNAEA  310

Query  297  TRTTEQVDRIDQKVTSVDERVTKEAKLVESVLKA  330
             ++TEQ+ R++Q++T+V++RV  + K   + +KA
Sbjct  311  VKSTEQIARVEQRLTAVNDRVQAQTKKATATMKA  344

>PHYKE_8393
Length=326

 Score = 118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 95/334 (28%), Positives = 149/334 (45%), Gaps = 39/334 (12%)

Query  7    KIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECE  66
            K   TSCEGYVTKRGH            HG+T   A+             KGSF LS   
Sbjct  17   KARPTSCEGYVTKRGHFP------CHPPHGET--PAH-------------KGSFYLSNIA  55

Query  67   KQD--LSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYI-  123
              +  +   G + KPFGFK +GH P +GY E  VFVET  D+ KWL VA NALG    I 
Sbjct  56   PHEYVVGVMGAADKPFGFKMVGHAPRKGYVELDVFVETLSDRNKWLEVARNALGAKRQIM  115

Query  124  -------PSPSMESHGGAGHKESAGLMISLEAQIKNVKKTSHELLQQAINDAKEADRIGD  176
                    SP+ +   G G   S   ++  + QI+ +     ELL +A+ + + A  +G 
Sbjct  116  RQAIDQSVSPTKKGMFGFGLSLSPQPLVPPQKQIQALTHNKEELLAEALRELEAAKMVGR  175

Query  177  ATVDEMAYQEEVLNDAENTVDAMGKQMDRAEDLGKSIKHPILYKFTHIFsrkkskrgkrg  236
               +E+  Q E L+  E+ + A+ + +D  + L + +K+P L+ F+           +  
Sbjct  176  EACNEIVVQGEKLDSVEHDLHAIDRDLDFGDKLLRRLKNPTLHLFS--------DDTRPK  227

Query  237  asskkrgggkstrssrVPRGvqvklhppqpqpkqeedqldELSKILAKLGQTADTISDIT  296
            + +                               +   L+ L+  L +L   A+ ++   
Sbjct  228  SHANSNESSPQRTHQSAGSNPIHLPFSMGSANDADASDLERLAHALGELELQAELLNGEA  287

Query  297  TRTTEQVDRIDQKVTSVDERVTKEAKLVESVLKA  330
             R+T+Q+ RI+Q++++V  RV K+ K   + L A
Sbjct  288  GRSTQQIARIEQQLSNVTARVEKQTKQASATLSA  321

>PYAR_13570
Length=322

 Score = 115 bits (288),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/217 (31%), Positives = 108/217 (50%), Gaps = 18/217 (8%)

Query  24   MKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGP-PKGSFVLSECEKQD--LSDEGGSVKPF  80
            + +W+ RY+VL+G  L V+Y+DSK++ ++ G  PKGSF LS  EK +  +   G   KPF
Sbjct  6    LPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPF  65

Query  81   GFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSPSMESHGGAGHKESA  140
            GFK +GH P +GY E  +FVE++ D  KWL V  +AL     +    +            
Sbjct  66   GFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAASTKSLFGF  125

Query  141  GLMISLEAQIKNVKKTSHELLQQAINDAKEADRIGDATVDEMAYQ---------------  185
                S + QI+ +  +  ELL+QAI++ + A  +G     E+  Q               
Sbjct  126  SPATSPQKQIQKLSASKEELLKQAIDEIESAKLMGREACQEIVVQGVRKRGRLTSGFSLH  185

Query  186  EEVLNDAENTVDAMGKQMDRAEDLGKSIKHPILYKFT  222
             E L+  E+ +  +   +D  + L   +K P+LY F+
Sbjct  186  AEKLDHIESELQRVDADLDYGDKLLSHLKSPLLYLFS  222

>CCI45123
Length=301

 Score = 103 bits (258),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/194 (34%), Positives = 102/194 (53%), Gaps = 12/194 (6%)

Query  39   LLVAYYDSKEIYKS-NGPPKGSFVLSECEKQDLSDE---GGSVK--PFGFKFIGHCPGQG  92
            + V+YY+SK+ YK+ N  PKGSF+L   EK +        GSVK  PFGFK +GH P QG
Sbjct  1    MQVSYYESKDSYKNRNATPKGSFILQNVEKHEYWISRMVTGSVKERPFGFKMVGHAPKQG  60

Query  93   YKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSPS----MESHGGAGHKESAGLMISLEA  148
            Y E  VFV++  +  +WL+V +N L     +   +    M++  G      AG   + + 
Sbjct  61   YVELDVFVDSLSNMDQWLDVINNGLKANKRMAREAFMAEMDTTKGVLGFSFAG--TTSKQ  118

Query  149  QIKNVKKTSHELLQQAINDAKEADRIGDATVDEMAYQEEVLNDAENTVDAMGKQMDRAED  208
            Q+K +K    + + +A+   + A   G A  DE+  Q E L   E  +  +   ++ +E 
Sbjct  119  QVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQLGKVEQNLSNIESDLNHSEK  178

Query  209  LGKSIKHPILYKFT  222
            L KSI+HP+ Y F+
Sbjct  179  LIKSIRHPLRYFFS  192

>PPTG_18898
Length=1559

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 58/106 (55%), Gaps = 18/106 (17%)

Query  12   SCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIY-KSNGPPKGSFVLSECEKQDL  70
            SC GY+TK+GH  K+WK+RY +L G+T  ++YY   ++   + G P    ++ + +K D 
Sbjct  407  SCAGYLTKQGHKRKSWKKRYFILRGNT--ISYYSDYDMANNAKGKPLAEVLVEDVQKWD-  463

Query  71   SDEGGSVKPFGFKFIGH--CPGQGYKEYMVFVETQIDQTKWLNVAH  114
                   +PFGF F+ +   P      Y V+ +   ++TKW+N  H
Sbjct  464  ------GEPFGFMFMTNEQVP------YYVYADNDRERTKWMNALH  497

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/98 (31%), Positives = 44/98 (45%), Gaps = 17/98 (17%)

Query  13   CEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSD  72
            CEGY+TKRGH+   WK RY  L G+ L   YY S+E  K  G             + ++ 
Sbjct  213  CEGYLTKRGHVFTNWKTRYFTLRGNVL--EYYSSEEKSKKYG---------AVTVEKVAP  261

Query  73   EGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWL  110
              G    F F      P      Y V+  ++ ++++WL
Sbjct  262  WSGEAHGFMFYTTKQIP------YYVYASSEAERSRWL  293

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/116 (28%), Positives = 55/116 (47%), Gaps = 18/116 (16%)

Query  12   SCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLS  71
            SCEGY+TKRGH++ + +  Y VL+G +L   +Y  ++ Y+ N        ++E E + ++
Sbjct  307  SCEGYLTKRGHLVPSQRMAYYVLNGTSL--RHYADQQAYRDN-----QSAMAEVEIRSVA  359

Query  72   DEGGSVKPFGFKFI-GHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSP  126
               G      F  + G+        + V  +T  +Q KWL     +   T  +P P
Sbjct  360  PWDGEANGLMFMTVTGNV-------FYVIADTAGEQQKWLATVKKS---TASVPEP  405

>PITG_20562
Length=1559

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 58/106 (55%), Gaps = 18/106 (17%)

Query  12   SCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIY-KSNGPPKGSFVLSECEKQDL  70
            SC GY+TK+GH  K+WK+RY +L G+T  ++YY   ++   + G P    ++ + +K D 
Sbjct  408  SCAGYLTKQGHKRKSWKKRYFILRGNT--ISYYSDYDMANNAKGKPLAEVLVEDVQKWD-  464

Query  71   SDEGGSVKPFGFKFIGH--CPGQGYKEYMVFVETQIDQTKWLNVAH  114
                   +PFGF F+ +   P      Y V+ +   ++TKW+N  H
Sbjct  465  ------GEPFGFMFMTNEQVP------YYVYADNDRERTKWMNALH  498

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/108 (29%), Positives = 48/108 (44%), Gaps = 17/108 (16%)

Query  13   CEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSD  72
            CEGY+TKRGH+   WK RY  L G+ L   YY S+E  K  G             + ++ 
Sbjct  214  CEGYLTKRGHVFTNWKTRYFTLRGNVL--EYYSSEEKSKKYG---------AVTVEKVAP  262

Query  73   EGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKT  120
              G    F F      P      Y V+  ++ ++++WL    + + +T
Sbjct  263  WSGEAHGFMFYTTKQIP------YYVYASSEAERSRWLRALKDFMVET  304

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 56/118 (47%), Gaps = 18/118 (15%)

Query  10   QTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQD  69
            + SCEGY+TKRGH++ + +  Y VL+G +L   +Y  ++ Y+ N        ++E E + 
Sbjct  306  EVSCEGYLTKRGHLVPSQRMAYYVLNGTSL--RHYADQQAYRDN-----QSAMAEVEIRS  358

Query  70   LSDEGGSVKPFGFKFI-GHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSP  126
            ++   G      F  + G+        + V  +T  +Q KWL     +   T  +P P
Sbjct  359  VAPWDGEANGLMFMTVTGNV-------FYVIADTTGEQQKWLATVKKS---TASVPEP  406

>PYU1_G006347
Length=1095

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 61/123 (50%), Gaps = 22/123 (18%)

Query  4    NLSKIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKS-NGPPKGSFVL  62
            N +     SC GY+TK+GH  K+WK+RY +L G+  L++YY   ++  S  G P     +
Sbjct  386  NATAPEPVSCAGYLTKQGHKRKSWKKRYFILRGN--LISYYSDYDLANSAKGKPLAEVAV  443

Query  63   SECEKQDLSDEGGSVKPFGFKFIG--HCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKT  120
             + +K D        +PFGF F+     P      Y V+ +   ++ KW+    NAL K 
Sbjct  444  EDVQKWD-------GEPFGFMFMTSEQVP------YYVYADNDRERNKWM----NALSKL  486

Query  121  TYI  123
            T +
Sbjct  487  TAV  489

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/98 (32%), Positives = 47/98 (48%), Gaps = 17/98 (17%)

Query  13   CEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSD  72
            CEG++TKRGH+   WK RY VL GD L   Y+  +E  K      GS  +++     ++ 
Sbjct  200  CEGFLTKRGHVFTNWKTRYFVLRGDVL--EYFSGEEKNKK----YGSVTVAK-----VAP  248

Query  73   EGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWL  110
              G    F F      P      Y V+  ++ +++KWL
Sbjct  249  WSGEAHGFMFYTTKQIP------YYVYAASEAERSKWL  280

 Score = 41.6 bits (96),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 29/104 (28%), Positives = 51/104 (49%), Gaps = 19/104 (18%)

Query  10   QTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQD  69
            + SCEGY+T+RGH++ + +  Y VL+G +L   +Y  +  Y+ N        ++E E + 
Sbjct  292  EVSCEGYLTRRGHLVPSQRMAYYVLNGASLR--HYADQSAYRDN-----QSAIAEVEVRS  344

Query  70   LSDEGGSVKPFGFKF---IGHCPGQGYKEYMVFVETQIDQTKWL  110
            ++   G  +P G  F    G+        +    +T  +Q KWL
Sbjct  345  VAPWDG--EPNGLMFQTSTGNV-------FYASTDTVGEQQKWL  379

>PYAR_23286
Length=607

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 57/103 (55%), Gaps = 16/103 (16%)

Query  12   SCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLS  71
            +C GY+TK+GH  K+WK+RY VL G +  V+YY     Y +   PKG   L+E   +D+ 
Sbjct  388  ACSGYLTKQGHKRKSWKKRYFVLRGSS--VSYYTD---YDTANSPKGK-PLAEVVIEDVQ  441

Query  72   DEGGSVKPFGFKFIG--HCPGQGYKEYMVFVETQIDQTKWLNV  112
               G  +PFGF F+     P      Y V+ + + ++TKW+N 
Sbjct  442  RWDG--EPFGFMFMTSEQIP------YYVYADNERERTKWMNA  476

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 45/99 (45%), Gaps = 19/99 (19%)

Query  13   CEGYVTKRGHMMKTWKRRYMVLHGDTL-LVAYYDSKEIYKSNGPPKGSFVLSECEKQDLS  71
            CEG++TKRGH+   WK RY VL G+ L   A  D  + Y       GS V+     + ++
Sbjct  194  CEGFLTKRGHVFTNWKMRYFVLRGNVLEYFAGEDKSKRY-------GSVVV-----EKVA  241

Query  72   DEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWL  110
               G    F F      P      Y V+  ++ ++ KWL
Sbjct  242  AWSGEAHGFMFYTAKQVP------YYVYASSESERAKWL  274

 Score = 40.0 bits (92),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 29/42 (69%), Gaps = 2/42 (5%)

Query  12   SCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSN  53
            +CEGY+T+RGH++ + +  Y VL+G +L   +Y  ++ Y+ N
Sbjct  288  TCEGYLTRRGHLVPSQRHAYYVLNGTSLR--HYADQQAYRDN  327

>PYIW_17381
Length=952

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 56/112 (50%), Gaps = 18/112 (16%)

Query  4    NLSKIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKS-NGPPKGSFVL  62
            N +     SC GY+TK+GH  K+WK+RY +L G+  L+AY+   +I  S  G P     +
Sbjct  397  NATAPEPVSCAGYLTKQGHKRKSWKKRYFILRGN--LIAYFTDYDIANSAKGKPLAEVTV  454

Query  63   SECEKQDLSDEGGSVKPFGFKFIG--HCPGQGYKEYMVFVETQIDQTKWLNV  112
             + +K D        +PFGF F+     P      Y V+ +   ++ KW+N 
Sbjct  455  EDVQKWD-------GEPFGFMFMTSEQVP------YYVYADNDRERNKWMNA  493

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/98 (31%), Positives = 48/98 (49%), Gaps = 17/98 (17%)

Query  13   CEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSD  72
            CEG++TKRGH+  TWK RY VL G+ L   Y+  ++     G   GS  +++     ++ 
Sbjct  211  CEGFLTKRGHVFTTWKTRYFVLRGNVL--EYFSGED----KGKRYGSVTVAK-----VAP  259

Query  73   EGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWL  110
              G    F F      P      Y V+  ++ +++KWL
Sbjct  260  WSGEAHGFMFYTTKQVP------YYVYASSEAERSKWL  291

 Score = 39.7 bits (91),  Expect = 0.023, Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 28/44 (64%), Gaps = 2/44 (5%)

Query  10   QTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSN  53
            +  CEGY+T+RGH++ + +  Y VL+G +L   +Y  +  Y+ N
Sbjct  303  EVGCEGYLTRRGHLVPSQRMAYYVLNGTSLR--HYADQSAYREN  344

>PYIR_21589
Length=1568

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 63/122 (52%), Gaps = 20/122 (16%)

Query  4    NLSKIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLS  63
            N +     SC GY+TK+GH  K+WK+RY +L G+  L+AYY   ++  S    KG   L+
Sbjct  397  NATAPEPVSCAGYLTKQGHKRKSWKKRYFILRGN--LIAYYPDYDLANSA---KGR-ALA  450

Query  64   ECEKQDLSDEGGSVKPFGFKFIG--HCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTT  121
            E   +D+    G  +PFGF F+     P      Y V+ +   ++ KW+    NAL K T
Sbjct  451  EVTVEDVQKWDG--EPFGFMFMTSEQVP------YYVYADNDRERNKWM----NALRKLT  498

Query  122  YI  123
             +
Sbjct  499  TV  500

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/98 (31%), Positives = 48/98 (49%), Gaps = 17/98 (17%)

Query  13   CEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSD  72
            CEG++TKRGH+  TWK RY VL G+ L   Y+  ++     G   GS  +++     ++ 
Sbjct  211  CEGFLTKRGHVFTTWKTRYFVLRGNVL--EYFAGED----KGKRYGSVTVAK-----VAP  259

Query  73   EGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWL  110
              G    F F      P      Y V+  ++ +++KWL
Sbjct  260  WSGEAHGFMFYTTKQIP------YYVYAASEAERSKWL  291

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 29/44 (66%), Gaps = 2/44 (5%)

Query  10   QTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSN  53
            + SCEGY+T+RGH++ + +  Y VL+G +L   +Y  +  Y+ N
Sbjct  303  EVSCEGYLTRRGHLVPSQRMAYYVLNGTSL--RHYADQSAYRDN  344

>SPRG_06059
Length=1312

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 63/122 (52%), Gaps = 22/122 (18%)

Query  6    SKIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYY-DSKEIYKSNGPPKGSFVLSE  64
            S I   SC GY+TK+GH  K+WKRRY VL G TL  AYY D   + K +        L+E
Sbjct  219  SAIKPISCAGYLTKQGHRRKSWKRRYFVLRGGTL--AYYADYDSMNKQS--------LAE  268

Query  65   CEKQDLSDEGGSVKPFGFKFIG--HCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTY  122
               +D++   G  + FGF+FI     P      Y VF E+  ++ KW+ VA   L +T  
Sbjct  269  VGVEDVALWDG--EQFGFQFITTEQVP------YYVFAESDRERQKWM-VALQTLVRTHS  319

Query  123  IP  124
             P
Sbjct  320  AP  321

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/104 (27%), Positives = 40/104 (38%), Gaps = 10/104 (10%)

Query  13   CEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSK------EIYKSNGPPKGSFVLSECE  66
            C GY+TKRGH++  WK R+ VL    +L  Y D        +++     P      +   
Sbjct  12   CAGYLTKRGHVVTNWKTRFFVLRPHAILCYYADESMAKKLGQVHLVKVAPWEYVSATTAN  71

Query  67   KQDLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWL  110
                S  G     FGF F           Y V+     ++ KWL
Sbjct  72   SILKSTRGSDEMKFGFMFF----TTKRVAYYVYANVNAERQKWL  111

 Score = 32.3 bits (72),  Expect = 4.8, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 4/50 (8%)

Query  11   TSCEGYVTKR--GHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKG  58
            T CEGY+TKR  G    + + +Y VL G TLL  Y+D +E Y+ +  P  
Sbjct  125  TDCEGYLTKRTPGFSFLSSRPKYYVLTG-TLLKCYHD-EEGYRGHDVPSA  172

>H257_06722
Length=1482

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 51/104 (49%), Gaps = 14/104 (13%)

Query  8    IHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYY-DSKEIYKSNGPPKGSFVLSECE  66
            +   +C G++TK+GH  K+WK+RY VL G+TL  AYY D       +G P G   + E  
Sbjct  347  MQPIACAGWLTKQGHKRKSWKKRYFVLRGNTL--AYYTDFDASNLRHGKPLGEVTVREVS  404

Query  67   KQDLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWL  110
              D        +P GF FI +        Y VF +   DQ KWL
Sbjct  405  AWD-------GEPSGFMFITN----DSVPYYVFADNDRDQAKWL  437

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 34/54 (63%), Gaps = 7/54 (13%)

Query  13   CEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECE  66
            CEGY+TKRGH++ +++ RY VL G T  + YY  +  Y+S     G+  L+E E
Sbjct  251  CEGYLTKRGHLVPSYRMRYFVLCGST--IKYYADETAYRS-----GASALAEME  297

 Score = 40.4 bits (93),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 43/100 (43%), Gaps = 16/100 (16%)

Query  13   CEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSD  72
              GY+TKRGH++  WK R+ VL     L +YY  + + K          L E   + +S 
Sbjct  155  ASGYLTKRGHVVTNWKTRFFVLRAGGRL-SYYADEGMKKK---------LGEVHLEKVSP  204

Query  73   EGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNV  112
              G     GF F  +        Y V+  T  ++ +WL+ 
Sbjct  205  WSGEAN--GFMFYTN----KQIAYYVYASTNSERRRWLDA  238

>PHYRA_84916
Length=1541

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 56/104 (54%), Gaps = 18/104 (17%)

Query  12   SCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIY-KSNGPPKGSFVLSECEKQDL  70
            SC GY+TK+GH  K+WK+RY +L G+T  ++YY   ++   + G P    ++ + +K D 
Sbjct  404  SCAGYLTKQGHKRKSWKKRYFILRGNT--ISYYSDYDMANNTKGKPLAEVLVEDVQKWD-  460

Query  71   SDEGGSVKPFGFKFIGH--CPGQGYKEYMVFVETQIDQTKWLNV  112
                   +PFGF F+ +   P      Y V+ +   ++ KW+N 
Sbjct  461  ------GEPFGFMFMTNEQVP------YYVYADNDRERNKWMNA  492

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/98 (31%), Positives = 44/98 (45%), Gaps = 17/98 (17%)

Query  13   CEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSD  72
            CEGY+TKRGH+   WK RY  L G+ L   YY S+E  K  G             + ++ 
Sbjct  210  CEGYLTKRGHLFTNWKTRYFTLRGNVL--EYYSSEEKSKKYG---------AVTVEKVAP  258

Query  73   EGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWL  110
              G    F F      P      Y V+  ++ ++++WL
Sbjct  259  WSGEAHGFMFYTTKQIP------YYVYASSEGERSRWL  290

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/116 (28%), Positives = 55/116 (47%), Gaps = 18/116 (16%)

Query  12   SCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLS  71
            SCEGY+TKRGH++ + +  Y VL+G +L   +Y  ++ Y+ N        ++E E + ++
Sbjct  304  SCEGYLTKRGHLVPSQRMAYYVLNGTSL--RHYADQQAYRDN-----QSAMAEVEIRSVA  356

Query  72   DEGGSVKPFGFKFI-GHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSP  126
               G      F  + G+        + V  +T  +Q KWL     +   T  +P P
Sbjct  357  PWDGEANGLMFMTVTGNV-------FYVIADTGGEQQKWLATVKKS---TANVPEP  402

>H310_00231
Length=1495

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 56/122 (46%), Gaps = 18/122 (15%)

Query  8    IHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYY---DSKEIYKSNGPPKGSFVLSE  64
            +   +C G++TK+GH  K+WK+RY VL G TL  AYY   D+  +  S   P G   + E
Sbjct  347  VQPIACAGWLTKQGHKRKSWKKRYFVLRGTTL--AYYTDFDASNMRHSR--PLGEVTVRE  402

Query  65   CEKQDLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIP  124
                D        +P GF F+ +        Y VF + + DQ KWL         +T + 
Sbjct  403  VSTWD-------GEPGGFMFVTN----DNVPYYVFADNERDQAKWLTALRKLFESSTSVE  451

Query  125  SP  126
             P
Sbjct  452  EP  453

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/54 (39%), Positives = 34/54 (63%), Gaps = 7/54 (13%)

Query  13   CEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECE  66
            CEGY+TKRGH++ +++ RY VL G ++   Y+  +  Y+S     G+  L+E E
Sbjct  251  CEGYLTKRGHLVPSYRMRYFVLSGASM--KYFADETAYRS-----GASALAEME  297

 Score = 39.3 bits (90),  Expect = 0.032, Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 40/96 (42%), Gaps = 16/96 (17%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDEG  74
            GY+TKRGH++  WK R+ VL     L +YY  + + K          L E   + +S   
Sbjct  157  GYLTKRGHVVTNWKTRFFVLRAGGRL-SYYADEGMKKK---------LGEVHLEKVSPWS  206

Query  75   GSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWL  110
            G    F F             Y V+  T  ++ +WL
Sbjct  207  GEANGFMFYTSKQI------AYYVYASTNSERRRWL  236

>SPRG_06058
Length=1258

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 55/115 (48%), Gaps = 12/115 (10%)

Query  7    KIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECE  66
            K    +C G++TK+GH  K+WK+RY VL G  L  +YY   E   +    +    LS+  
Sbjct  143  KPAPVACAGWLTKQGHKRKSWKKRYFVLRGTVL--SYYADFEAANT----RAGKALSDVS  196

Query  67   KQDLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTT  121
             +D+    G    F F  + + P      Y VF + + DQ KW++    A+G  T
Sbjct  197  LKDVGPWDGEACGFMFTTLENVP------YYVFADNERDQAKWMSALKKAVGADT  245

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 52/112 (46%), Gaps = 27/112 (24%)

Query  13   CEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSD  72
            CEGY+TKRGH++ +++ RY V+ G   +V YY  +  Y++     G+  L+E E +    
Sbjct  47   CEGYLTKRGHLVPSYRLRYFVMCGS--VVKYYSDETAYRT-----GASALAEIEVKS---  96

Query  73   EGGSVKPFGFKFIGHCPGQGYK-----EYMVFVETQIDQTKWLNVAHNALGK  119
                    G ++ G   G  +K        V  E   D  KW+     ALG+
Sbjct  97   --------GGRWDGESTGLFFKTATNSTMFVCAENVADLQKWI----EALGR  136

>SDRG_12762
Length=1392

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/124 (31%), Positives = 62/124 (50%), Gaps = 16/124 (13%)

Query  7    KIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECE  66
            K    +C G++TK+GH  K+WK+RY VL G  L  +Y+   E   +    +    LSE  
Sbjct  354  KPAPVACAGWLTKQGHKRKSWKKRYFVLRGTVL--SYFADFEAANT----RLGKALSEVS  407

Query  67   KQDLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSP  126
             +D++   G V  F F  + + P      Y VF + + DQ KW+     A+G    + +P
Sbjct  408  VKDVAPWDGEVCGFMFVTLENVP------YYVFADNERDQAKWMTALKKAVG----LDAP  457

Query  127  SMES  130
            ++E+
Sbjct  458  TLET  461

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/135 (29%), Positives = 60/135 (44%), Gaps = 32/135 (24%)

Query  13   CEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSD  72
            CEGY+TKRGH++ +++ RY V+ G   +V YY  +  Y++     G+  L+E E +    
Sbjct  258  CEGYLTKRGHLVPSYRLRYFVMCGS--VVKYYSDETAYRT-----GASALAEIEVKS---  307

Query  73   EGGSVKPFGFKFIGHCPGQGYK-----EYMVFVETQIDQTKWLNVAHNALGKT-TYIPSP  126
                    G ++ G   G  +K        V  E   D  KW+     ALG+     P P
Sbjct  308  --------GGRWDGESTGLFFKTATNSTMFVCAENVADLQKWI----EALGRIFNEAPKP  355

Query  127  SMESHGG----AGHK  137
            +  +  G     GHK
Sbjct  356  APVACAGWLTKQGHK  370

 Score = 40.4 bits (93),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 29/112 (26%), Positives = 45/112 (40%), Gaps = 20/112 (18%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDEG  74
            GY+TKRGH++  WK R+  L     L +YY+ + + K          L E     +S   
Sbjct  164  GYLTKRGHVITNWKTRFFALRSQGRL-SYYNDEGMGKK---------LGEVHVSKVSPWS  213

Query  75   GSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSP  126
            G    F F+            Y V+  +  ++ +WL     AL     +P P
Sbjct  214  GETNGFMFQTTKQI------SYYVYASSNTERARWL----KALDDFYIVPDP  255

>PHYSO_361747
Length=1523

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 54/104 (52%), Gaps = 18/104 (17%)

Query  12   SCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIY-KSNGPPKGSFVLSECEKQDL  70
            SC GY+TK+GH  K+WK+RY +L G+   ++YY   ++   S G P    ++ + +K D 
Sbjct  413  SCAGYLTKQGHKRKSWKKRYFILRGNA--ISYYSDYDMANNSKGKPLAEVLVEDVQKWD-  469

Query  71   SDEGGSVKPFGFKFIG--HCPGQGYKEYMVFVETQIDQTKWLNV  112
                   +PFGF F+     P      Y V+ +   ++ KW+N 
Sbjct  470  ------GEPFGFMFMTTEQVP------YYVYADNDRERNKWMNA  501

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 45/100 (45%), Gaps = 17/100 (17%)

Query  13   CEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSD  72
            CEGY+TKRGH+   WK RY  L G+ L   YY S+E  K  G             + ++ 
Sbjct  219  CEGYLTKRGHLFTNWKTRYFTLRGNVL--EYYSSEEKSKKYG---------AVTVEKVAT  267

Query  73   EGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNV  112
              G    F F      P      Y V+  ++ ++++WL V
Sbjct  268  WSGEAHGFMFYTTKQIP------YYVYASSESERSRWLRV  301

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 56/118 (47%), Gaps = 18/118 (15%)

Query  10   QTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQD  69
            + SCEGY+TKRGH++ + +  Y VL+G +L   +Y  ++ Y+ N        ++E E + 
Sbjct  311  EVSCEGYLTKRGHLVPSQRMAYYVLNGTSL--RHYADQQAYRDN-----QLAMAEVEIRS  363

Query  70   LSDEGGSVKPFGFKFI-GHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSP  126
            ++   G      F  + G+        + V  +T  +Q KWL     +   T  +P P
Sbjct  364  VAAWDGEANGLMFMTVTGNV-------FYVIADTAGEQQKWLATVKKS---TASVPEP  411

>HYAP_08645
Length=1514

 Score = 60.5 bits (145),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 57/104 (55%), Gaps = 18/104 (17%)

Query  12   SCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIY-KSNGPPKGSFVLSECEKQDL  70
            SC GY+TK+GH  K+WK+RY +L G+  L++YY   ++   + G P     L+E   +D+
Sbjct  307  SCAGYLTKQGHKRKSWKKRYFILRGN--LISYYSDYDMANNTKGRP-----LAEVLVEDV  359

Query  71   SDEGGSVKPFGFKFIGH--CPGQGYKEYMVFVETQIDQTKWLNV  112
                G  +PFGF F+ +   P      Y V+ +   ++ KW+N 
Sbjct  360  QSWDG--EPFGFMFMTNEQVP------YYVYADNDRERNKWMNA  395

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/98 (30%), Positives = 43/98 (44%), Gaps = 17/98 (17%)

Query  13   CEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSD  72
            CEGY+TKRGH+   WK RY  L G+ L   YY  +E  K  G             + ++ 
Sbjct  113  CEGYLTKRGHLFTNWKTRYFTLRGNVL--EYYSGEEKSKKYG---------AVTVEKVAT  161

Query  73   EGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWL  110
              G    F F      P      Y V+  ++ ++++WL
Sbjct  162  WSGEAHGFMFYTTKQIP------YYVYASSESERSRWL  193

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 56/118 (47%), Gaps = 18/118 (15%)

Query  10   QTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQD  69
            + SCEGY+TKRGH++ + +  Y VL+G +L   +Y  ++ Y+ N        ++E E + 
Sbjct  205  EVSCEGYLTKRGHLVPSQRMAYYVLNGTSL--RHYADQQAYREN-----QSAMAEVEIRS  257

Query  70   LSDEGGSVKPFGFKFI-GHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSP  126
            ++   G      F  + G+        + V  +T  +Q KWL     +   T  +P P
Sbjct  258  VAPWEGETNGLMFMTVTGNV-------FYVIADTVGEQQKWLATVKKS---TASVPEP  305

>SDRG_12763
Length=1317

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 57/108 (53%), Gaps = 21/108 (19%)

Query  6    SKIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYY-DSKEIYKSNGPPKGSFVLSE  64
            S I   SC GY+TK+GH  K+WKRRY VL G TL  +YY D   + K +        L+E
Sbjct  217  SAIKPISCAGYLTKQGHRRKSWKRRYFVLRGATL--SYYSDYDSMNKQS--------LAE  266

Query  65   CEKQDLSDEGGSVKPFGFKFIG--HCPGQGYKEYMVFVETQIDQTKWL  110
               +D++   G  + FGF+FI     P      Y VF E+  ++ KW+
Sbjct  267  VGVEDVALWDG--EQFGFQFITTEQVP------YYVFAESDRERQKWM  306

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/104 (27%), Positives = 41/104 (39%), Gaps = 10/104 (10%)

Query  13   CEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSK------EIYKSNGPPKGSFVLSECE  66
            C GY+TKRGH++  WK R+ VL    +L  Y D        +++     P   F  +   
Sbjct  10   CAGYLTKRGHVVTNWKTRFFVLRPHAILCYYADDSMVKKLGQVHLVKVAPWEYFSATTGN  69

Query  67   KQDLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWL  110
                S  G     FGF F           Y V+     ++ +WL
Sbjct  70   SVLKSARGSDEMKFGFMFF----TTKRVAYYVYANVNAERQRWL  109

>PHYKE_1990
Length=1499

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 56/103 (54%), Gaps = 16/103 (16%)

Query  12   SCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLS  71
            +C GY+TK+GH  K+WK+RY +L G T  ++YY   ++  ++   KG   L+E   +D+ 
Sbjct  405  ACAGYLTKQGHKRKSWKKRYFILRGST--ISYYSDYDMANNS---KGK-ALAEVLVEDVQ  458

Query  72   DEGGSVKPFGFKFIG--HCPGQGYKEYMVFVETQIDQTKWLNV  112
               G  +PFGF F+     P      Y V+ +   ++ KW+N 
Sbjct  459  RWDG--EPFGFMFMTSEQVP------YYVYADNDRERNKWMNA  493

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 46/98 (47%), Gaps = 17/98 (17%)

Query  13   CEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSD  72
            CEGY+TKRGH+   WK RY  L G+ L   YY S+E  K  G      V+ E     ++ 
Sbjct  211  CEGYLTKRGHLFTNWKTRYFTLRGNVL--EYYSSEEKSKKYG-----AVMVE----KVAT  259

Query  73   EGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWL  110
              G    F F      P      Y V+  ++ +++KWL
Sbjct  260  WSGEAHGFMFYTTKQIP------YYVYASSEAERSKWL  291

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/118 (29%), Positives = 59/118 (50%), Gaps = 18/118 (15%)

Query  10   QTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQD  69
            + SCEGY+TKRGH++ + +  Y VL+G +L   +Y  ++ Y+ N        ++E E + 
Sbjct  303  EVSCEGYLTKRGHLVPSQRMAYYVLNGASL--RHYADQQAYRDN-----QSAMAEVEIRS  355

Query  70   LSDEGGSVKPFGFKFI-GHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSP  126
            ++   G      F+ + G+        + V  +T  +Q KWL+    +   TT IP P
Sbjct  356  VAPWDGEANGLMFQTVTGNV-------FYVIADTSGEQQKWLSTVKKS---TTNIPEP  403

>PYVX_20438
Length=1346

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 55/103 (53%), Gaps = 16/103 (16%)

Query  12   SCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLS  71
            +C GY+TK+GH  K+WK+RY +L G +  ++Y+   E+  S    KG   L+E   +D+ 
Sbjct  318  ACAGYLTKQGHKRKSWKKRYFILRGTS--ISYFADFEMANSA---KGK-ALAEVTVEDVQ  371

Query  72   DEGGSVKPFGFKFIG--HCPGQGYKEYMVFVETQIDQTKWLNV  112
               G  +PFGF F+     P      Y V+ +   ++ KW+N 
Sbjct  372  RWDG--EPFGFMFMTSEQVP------YYVYADNDRERNKWMNA  406

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 42/100 (42%), Gaps = 17/100 (17%)

Query  13   CEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSD  72
            CEGY+TKRGH+   WK RY  L G+ L   Y+ S +  K  G               ++ 
Sbjct  123  CEGYLTKRGHVFTNWKTRYFTLRGNVL--EYFASDDKSKKYG---------AVTVAKVAP  171

Query  73   EGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNV  112
              G    F F      P      Y V+  +++++ KWL  
Sbjct  172  WSGEAHGFMFYTTKQIP------YYVYASSEVERAKWLRA  205

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 36/118 (31%), Positives = 57/118 (48%), Gaps = 22/118 (19%)

Query  12   SCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLS  71
            SCEGY+TKRGH++ + +  Y VL G T+L  Y D ++ Y+ N        ++E E + ++
Sbjct  218  SCEGYLTKRGHLVPSQRMAYYVLTG-TMLRHYAD-QQAYREN-----QSAMAEVEVRSVA  270

Query  72   DEGGSVKPFGFKF---IGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSP  126
               G  +P G  F    G+        +    +TQ +Q KWL     +   T  +P P
Sbjct  271  TWDG--EPHGLMFQTVTGNV-------FYASADTQGEQQKWLATVKKS---TANLPEP  316

>PHYKE_2479
Length=171

 Score = 53.9 bits (128),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 52/107 (49%), Gaps = 21/107 (20%)

Query  10   QTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQD  69
            ++  EGYVTKRGH+++ WK R+  L G+  LV+YY++K   ++    KG   ++  +   
Sbjct  72   RSKWEGYVTKRGHLVRNWKMRFFTLEGN--LVSYYENKVDARNRSHLKGRVNVASVKMDK  129

Query  70   LSDEGGSVKPFGFKF------IGHCPGQGYKEYMVFVETQIDQTKWL  110
            ++  G     F F F      + HC           V TQ DQ  W+
Sbjct  130  VAKNGHG---FDFSFETTEGKVFHCS----------VPTQFDQLAWV  163

>PYAP_16997
Length=1018

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 34/100 (34%), Positives = 55/100 (55%), Gaps = 12/100 (12%)

Query  12   SCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLS  71
            +C GY+TK+GH  K+WK+RY VL G++  + Y+   +   SN   KG   L+E   +D+ 
Sbjct  401  ACSGYLTKQGHKRKSWKKRYFVLRGNS--ITYFTDFDTANSN---KGK-ALAEVIVEDVQ  454

Query  72   DEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLN  111
               G  +PFGF F+          Y V+ + + ++ KW+N
Sbjct  455  RWDG--EPFGFMFM----TSEQVPYYVYADNERERGKWMN  488

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 29/101 (29%), Positives = 47/101 (47%), Gaps = 17/101 (17%)

Query  10   QTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQD  69
            + +CEG++TKRGH+   WK RY VL G+ L   Y+   +  K      GS ++     + 
Sbjct  204  EIACEGFLTKRGHVFTNWKMRYFVLRGNVL--EYFSGDDKSKR----YGSVIV-----EK  252

Query  70   LSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWL  110
            ++   G    F F      P      Y V+  ++ ++ KWL
Sbjct  253  VAPWSGEAHGFMFYTTKQVP------YYVYASSEAERAKWL  287

 Score = 38.9 bits (89),  Expect = 0.050, Method: Composition-based stats.
 Identities = 27/117 (23%), Positives = 54/117 (46%), Gaps = 16/117 (14%)

Query  10   QTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQD  69
            + +CEG++T+RGH++ + +  Y VL+G +L   +Y  ++ Y+ N        +++ E + 
Sbjct  299  EVTCEGFLTRRGHLVPSQRFAYYVLNGTSL--RHYADQQAYRDN-----QSAIADVEVRS  351

Query  70   LSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSP  126
            +S          F+ +          +    ++  +Q KWL+    A   T  IP P
Sbjct  352  VSSWDNEQNGLMFQTVTG------NVFYAIADSAGEQQKWLSSVRKA---TANIPEP  399

>CCI44752
Length=1526

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/107 (29%), Positives = 57/107 (53%), Gaps = 16/107 (15%)

Query  8    IHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEK  67
            +   +C GY+TK+GH  K+WK+RY +L G+  +++YY   ++  +    KG   L+E + 
Sbjct  413  VEPVACAGYLTKQGHKRKSWKKRYFILRGN--IISYYQDYDLANN---AKGK-ALAEVQV  466

Query  68   QDLSDEGGSVKPFGFKFIG--HCPGQGYKEYMVFVETQIDQTKWLNV  112
            +D+    G    FGF F+     P      Y V+ + + ++ KW++ 
Sbjct  467  EDVQKWDGEA--FGFMFMTTEQVP------YYVYADNERERKKWMSA  505

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 48/97 (49%), Gaps = 17/97 (18%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            EGY+TKRGH+   WK R+ VL G+ L   YY S+E  K      GS V+++     ++  
Sbjct  223  EGYLTKRGHVFTNWKTRFFVLSGNVL--EYYSSEEKTKR----YGSVVVAK-----VAPW  271

Query  74   GGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWL  110
             G    F F      P      Y V+  ++ ++TKWL
Sbjct  272  SGEAHGFMFYTTKQIP------YYVYAASEAEKTKWL  302

 Score = 40.0 bits (92),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 56/129 (43%), Gaps = 15/129 (12%)

Query  10   QTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQD  69
            + +CEGY+T+RGH++ + +  Y VL G  L   +Y  ++ Y+ N        ++E E + 
Sbjct  314  EVTCEGYLTRRGHLVPSQRVCYYVLSGTYL--RHYADQQAYRDNDS-----AMAEVEIRS  366

Query  70   LSDEGGSVKPFGFK-FIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSPSM  128
            ++     V    FK   G+        +    ET+ ++ +W++   N     T  P    
Sbjct  367  IAAWDAEVNGLMFKTMTGNV-------FYASTETESERQRWVSNHSNTTTSNTVEPVACA  419

Query  129  ESHGGAGHK  137
                  GHK
Sbjct  420  GYLTKQGHK  428

>PYVX_13574
Length=950

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 51/103 (50%), Gaps = 21/103 (20%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            EGYVTKRGH+++ WK R+  L G+  LV+YY+SK   ++    KG   ++  +   ++  
Sbjct  159  EGYVTKRGHLVRNWKMRFFTLEGN--LVSYYESKVDARNRSHLKGRVNVASVKIDKVAKS  216

Query  74   GGSVKPFGFKF------IGHCPGQGYKEYMVFVETQIDQTKWL  110
            G   + F F F      + HC           V TQ DQ  W+
Sbjct  217  G---QGFDFSFETTEGKVFHCS----------VPTQFDQLAWV  246

>PYIW_13172
Length=939

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 51/103 (50%), Gaps = 21/103 (20%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            EGYVTKRGH+++ WK R+  L G+ L  +YY+SK   ++    KG   ++  + + +S  
Sbjct  150  EGYVTKRGHLVRNWKNRFFTLEGNNL--SYYESKVDARNRNHLKGRVNVASVKIEKVSKS  207

Query  74   GGSVKPFGFKF------IGHCPGQGYKEYMVFVETQIDQTKWL  110
            G     F F F      + HC           V TQ++Q  W+
Sbjct  208  GHG---FDFAFETSEGKVFHCS----------VPTQMEQLSWI  237

>CCA18875
Length=1514

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 32/107 (30%), Positives = 55/107 (51%), Gaps = 16/107 (15%)

Query  8    IHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEK  67
            +   +C GY+TK+GH  K+WK+RY +L G+  +++YY     Y      KG   L+E + 
Sbjct  413  VEPVTCAGYLTKQGHKRKSWKKRYFILRGN--IISYYQD---YDLANHVKGK-ALAEVQV  466

Query  68   QDLSDEGGSVKPFGFKFIG--HCPGQGYKEYMVFVETQIDQTKWLNV  112
            +D+    G    FGF F+     P      Y V+ + + ++ KW++ 
Sbjct  467  EDVQKWDGEA--FGFMFMTTEQVP------YYVYADNERERKKWMSA  505

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 47/97 (48%), Gaps = 17/97 (18%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            EGY+TKRGH+   WK R+ VL G+ L   YY S+E  K      GS V+++     ++  
Sbjct  223  EGYLTKRGHVFTNWKTRFFVLSGNVL--EYYSSEEKTKR----YGSVVVAK-----VAPW  271

Query  74   GGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWL  110
             G    F F      P      Y V+  ++ ++ KWL
Sbjct  272  SGEAHGFMFYTTKQIP------YYVYAASETEKAKWL  302

 Score = 40.0 bits (92),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 55/118 (47%), Gaps = 17/118 (14%)

Query  10   QTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQD  69
            + +CEGY+T+RGH++ + +  Y VL G  L   +Y  ++ Y+ N        ++E E + 
Sbjct  314  EVTCEGYLTRRGHLVPSQRVCYYVLSGTCL--RHYADQQAYRDNDS-----AMAEVEVRS  366

Query  70   LSDEGGSVKPFGFK-FIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSP  126
            ++     V    FK   G+        +    ET+ ++ +W+    N L  TT +  P
Sbjct  367  IAAWDAEVNGLMFKTMTGNV-------FYASTETETERQRWVFNHTNTL--TTNVVEP  415

>PYIR_15309
Length=937

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 51/103 (50%), Gaps = 21/103 (20%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            EGYVTKRGH+++ WK R+  L G+ L  +YY+SK   ++    KG   ++  + + +S  
Sbjct  148  EGYVTKRGHLVRNWKNRFFTLEGNNL--SYYESKVDARNRSHLKGRVNVASVKVEKVSKS  205

Query  74   GGSVKPFGFKF------IGHCPGQGYKEYMVFVETQIDQTKWL  110
            G     F F F      + HC           V TQ++Q  W+
Sbjct  206  GHG---FDFSFETSEGKVFHCS----------VPTQMEQLSWV  235

>PHYSO_544598
Length=1163

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 55/109 (50%), Gaps = 12/109 (11%)

Query  9    HQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQ  68
            H+   EGYV K+G  +  W+ RY++L G TL   YY+SKE  +S    +G  ++S+   +
Sbjct  14   HEVHWEGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARNLRGRMIISKVRPE  71

Query  69   DLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNAL  117
            +        K  GF        QG+K + +   T++++  W+ +   A+
Sbjct  72   NYG------KAHGFLL----ETQGHKHFHLCCSTELEKDMWVEMMQAAI  110

>H310_00230
Length=1248

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 58/123 (47%), Gaps = 18/123 (15%)

Query  6    SKIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSEC  65
            S +   +C GY+TK+GH  K+WKRRY VL G   L++YY   E             L+E 
Sbjct  219  SSLQPIACAGYLTKQGHKRKSWKRRYFVLRG--ALLSYYTDYESANKQ-------CLAEV  269

Query  66   EKQDLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNAL--GKTTYI  123
              +D+    G +  F F             Y V+ +T+ ++ KWL VA  AL   ++   
Sbjct  270  GIEDVQVWDGEMHGFMFTTTEQV------MYYVYADTERERQKWL-VALKALLDAQSNRA  322

Query  124  PSP  126
            P+P
Sbjct  323  PTP  325

 Score = 42.0 bits (97),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 47/109 (43%), Gaps = 18/109 (17%)

Query  13   CEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNG-------PP---KGSFVL  62
            C GY+TKRGH++  WK R+ VL     L +YY+ + + K  G        P    GS   
Sbjct  12   CSGYLTKRGHVVTNWKMRFFVLRPHANL-SYYEDESMSKKLGQVHLAKVAPWEYNGSLTR  70

Query  63   SECEKQDLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLN  111
            S   K+DL     S   +GF F           Y ++  +  +  KW N
Sbjct  71   S-LSKRDLRTSDDSR--YGFMFF----TTKRVVYYIYTSSANEHQKWFN  112

>PHYRA_82543
Length=1199

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 55/109 (50%), Gaps = 12/109 (11%)

Query  9    HQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQ  68
            H+   EGYV K+G  +  W+ RY++L G TL   YY+SKE  +S    +G  ++S+   +
Sbjct  56   HEVHWEGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARNLRGRMIISKVRPE  113

Query  69   DLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNAL  117
            +        K  GF        QG+K + +   T++++  W+ +   A+
Sbjct  114  NYG------KAHGFLL----ETQGHKHFHLCCATELEKDMWVEMMQAAI  152

>PPTG_19371
Length=1195

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 55/109 (50%), Gaps = 12/109 (11%)

Query  9    HQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQ  68
            H+   EGYV K+G  +  W+ RY++L G TL   YY+SKE  +S    +G  ++S+   +
Sbjct  66   HEVHWEGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARNLRGRMIISKVRPE  123

Query  69   DLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNAL  117
            +        K  GF        QG+K + +   T++++  W+ +   A+
Sbjct  124  NYG------KAHGFLI----ETQGHKHFHLCCTTELEKDMWVEMMQAAI  162

>PHYCA_503112
Length=214

 Score = 51.6 bits (122),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 50/97 (52%), Gaps = 9/97 (9%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            EGYVTKRGH+++ WK R+  L G+  LV+YY++K   ++    KG   ++  +   ++  
Sbjct  117  EGYVTKRGHLVRNWKSRFFTLEGN--LVSYYENKVDARNRSHLKGRVNVASVKMDKVAKN  174

Query  74   GGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWL  110
            G      GF F      +G K +   V T  DQ  W+
Sbjct  175  G-----HGFDFSFETT-EG-KVFYCSVPTHFDQLAWV  204

>PYAP_18636
Length=1009

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/109 (28%), Positives = 55/109 (50%), Gaps = 12/109 (11%)

Query  9    HQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQ  68
            H+   EGYV K+G  +  W+ RY+VL G TL   YY++KE  +S    +G  ++S+   +
Sbjct  98   HEVHWEGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEEARSGRNLRGRMIISKVRPE  155

Query  69   DLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNAL  117
            +     G    F  + +GH      K + +   T++++  W+ +   A+
Sbjct  156  NYGKAHG----FLLETMGH------KHFHLCCSTELEKDMWVEMMQAAI  194

>SDRG_14487
Length=964

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 36/56 (64%), Gaps = 3/56 (5%)

Query  12  SCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEK  67
           + EG++ K+G +M TWK+RYMVL G    +AYYD KE+       KG+F L+  E+
Sbjct  5   AWEGWIYKQGSLMPTWKKRYMVLKG--RHIAYYD-KEVSNPRAKEKGTFTLAAVER  57

 Score = 34.7 bits (78),  Expect = 0.96, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (65%), Gaps = 2/31 (6%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYD  45
            G++ K G  +K+WK+R+ VL G  L   YYD
Sbjct  133  GWLEKEGQNVKSWKKRFFVLSGTDL--TYYD  161

>SPRG_02752
Length=831

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 35/54 (65%), Gaps = 3/54 (6%)

Query  14  EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEK  67
           EG++ K+G +M TWK+RYMVL G    +AYYD KE+       KG+F L+  E+
Sbjct  7   EGWIYKQGSLMPTWKKRYMVLKG--RHIAYYD-KEVTNPRAKEKGTFTLAAVER  57

 Score = 34.7 bits (78),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (65%), Gaps = 2/31 (6%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYD  45
            G++ K G  +K+WK+R+ VL G  L   YYD
Sbjct  134  GWLEKEGQNVKSWKKRFFVLSGTDL--TYYD  162

>SPRG_00364
Length=255

 Score = 50.8 bits (120),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 52/106 (49%), Gaps = 21/106 (20%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPK--GSFVLSECEKQDLS  71
             G+V KRG +M+TWKRRY VL  + L  AYYD        G PK  G FV         S
Sbjct  165  RGWVEKRGAVMRTWKRRYFVLRENVL--AYYD----INLEGQPKKGGDFV--------QS  210

Query  72   DEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNAL  117
             E  ++KP G +F     G   +  + F ET  D  +WL +A N L
Sbjct  211  IETSTIKPNGLEF-KMVSG---RSLLGFTETTDDHVQWL-LAANTL  251

>PITG_19213
Length=1201

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/109 (28%), Positives = 55/109 (50%), Gaps = 12/109 (11%)

Query  9    HQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQ  68
            H+   EGYV K+G  +  W+ RY++L G TL   YY+SKE  +S    +G  ++++   +
Sbjct  66   HEVHWEGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARNLRGRMIINKVRPE  123

Query  69   DLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNAL  117
            +        K  GF        QG+K + +   T++++  W+ +   A+
Sbjct  124  NYG------KAHGFLI----ETQGHKHFHLCCTTELEKDMWVEMMQAAI  162

>H257_16349
Length=262

 Score = 50.8 bits (120),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 50/105 (48%), Gaps = 16/105 (15%)

Query  7    KIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECE  66
            + HQ   +G+V KRG   ++WKRR+ VL  + L  AYYD   I     P KG  V+    
Sbjct  168  RAHQDVMKGWVEKRGSRFRSWKRRFFVLRDNIL--AYYD---INLEGQPQKGGDVV----  218

Query  67   KQDLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLN  111
               LS E  +VKP G +F         +  + F E   D  +WL+
Sbjct  219  ---LSIENSTVKPNGLEF----KMSSGRTLVGFTEEANDHARWLS  256

>PHALS_06533
Length=930

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/104 (31%), Positives = 50/104 (48%), Gaps = 21/104 (20%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            EGYVTKRGH+++ WK R+  L G+  LV+YY++K   ++    KG   ++  +   ++  
Sbjct  111  EGYVTKRGHLVRNWKMRFFTLEGN--LVSYYENKVEARNRSHLKGRVNVASVKVDKVAKN  168

Query  74   GGSVKPFGFKF------IGHCPGQGYKEYMVFVETQIDQTKWLN  111
            G     F F F      + HC           V T  DQ  W++
Sbjct  169  GHG---FDFSFETTEGKVFHCS----------VPTHFDQLAWVH  199

>PYIR_23372
Length=1415

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/98 (31%), Positives = 51/98 (52%), Gaps = 12/98 (12%)

Query  12   SCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLS  71
            S EGY+ K+  ++++WK  Y VL GDT+  AYY+S+E + SN    G   +   E  ++ 
Sbjct  322  SFEGYLNKKSDLLQSWKATYCVLEGDTM--AYYESREDFISNSKLMGRIQIQGVEDDNMG  379

Query  72   DEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKW  109
                  KP GF+ I     +G++   +   T  ++ +W
Sbjct  380  ------KPNGFRVI----TEGHRTNHLSSRTGFEKDQW  407

>PYIW_18491
Length=1684

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/98 (32%), Positives = 51/98 (52%), Gaps = 12/98 (12%)

Query  12   SCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLS  71
            S EGY+ K+  +++TWK  Y VL GDT+  AYY+S+E + SN    G   +   E  ++ 
Sbjct  307  SFEGYLNKKSDLLQTWKATYSVLEGDTM--AYYESREDFISNSKLIGRIQIQGVEDDNMG  364

Query  72   DEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKW  109
                  KP GF+ I     +G++   +   T  ++ +W
Sbjct  365  ------KPNGFRII----TEGHRTNHLSSRTGFEKDQW  392

>PYU1_G001063
Length=783

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 48/103 (47%), Gaps = 21/103 (20%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            EGYVTKRGH+++ WK R+  L G  L  +YY+SK   ++    KG   ++  + +  S  
Sbjct  147  EGYVTKRGHLVRNWKNRFFTLEGTNL--SYYESKVDARNRSHLKGRVQVASVKLEKTSKS  204

Query  74   GGSVKPFGFKF------IGHCPGQGYKEYMVFVETQIDQTKWL  110
            G     F F F      + HC           V T+ DQ  W+
Sbjct  205  GHG---FDFSFETSEGKVFHCS----------VPTKFDQLTWV  234

>PYAR_15463
Length=1091

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 55/109 (50%), Gaps = 12/109 (11%)

Query  9    HQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQ  68
            H+   EGYV K+G  +  W+ RY+VL G TL   YY+SKE  +S    +G  ++S+   +
Sbjct  73   HEVHWEGYVRKKGDWLPRWEERYLVLDGATL--TYYNSKEEARSGRNLRGRMIISKVRPE  130

Query  69   DLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNAL  117
            +        K  GF        +G+K + +   T++++  W+ +   A+
Sbjct  131  NYG------KAHGFLI----ETKGHKLFHLCCSTELEKDMWVEMMQAAI  169

>SPRG_05449
Length=723

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 51/100 (51%), Gaps = 10/100 (10%)

Query  13   CEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSD  72
             EG+V+K+GH+++ WK RY  L  +  L++YY+SKE  +     KG   L+  +      
Sbjct  65   WEGFVSKKGHLVRNWKLRYFTLESN--LLSYYESKEDARKRRHLKGRVHLTRVQII----  118

Query  73   EGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNV  112
            EG S   + F F      Q  K + V   T++DQ  W+ V
Sbjct  119  EGKSAHGYDFTF----DTQEGKPFHVSTTTELDQIAWVKV  154

>H257_06721
Length=1238

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 58/123 (47%), Gaps = 18/123 (15%)

Query  6    SKIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSEC  65
            S +   +C GY+TK+GH  K+WK+RY VL G +LL  Y D     K          L+E 
Sbjct  225  SSLQPIACAGYLTKQGHKRKSWKKRYFVLRG-SLLSYYTDYDSTNKQ--------CLAEV  275

Query  66   EKQDLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNAL--GKTTYI  123
              +D+    G +  F F             Y V+ E++ ++ KWL V+  AL   ++T  
Sbjct  276  GIEDVQVWDGEMHGFMFTTSEQV------VYYVYAESERERQKWL-VSLKALLDAQSTRA  328

Query  124  PSP  126
            P P
Sbjct  329  PKP  331

 Score = 44.7 bits (104),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 48/110 (44%), Gaps = 16/110 (15%)

Query  13   CEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNG-------PP---KGSFVL  62
            C GY+TKRGH++  WK RY VL     L +YY+ + + K  G        P    GS   
Sbjct  14   CRGYLTKRGHVVTNWKMRYFVLRPHASL-SYYEDESMAKKLGQVHLAKVAPWEYNGSLAK  72

Query  63   SECEKQDL-SDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLN  111
            S  +++   S  G     +GF F           Y ++  + I+  KW +
Sbjct  73   SVSKRESRGSSSGAEESRYGFMFF----TTKRVVYYIYTTSAIEHQKWFH  118

>PHYRA_77834
Length=936

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 50/105 (48%), Gaps = 25/105 (24%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            EGYVTKRGH+++ WK R+  L G+  LV+YY++K   ++    KG   ++  +   ++  
Sbjct  119  EGYVTKRGHLVRNWKMRFFTLEGN--LVSYYENKVDARNRSHLKGRVNVASVKVDKVAKN  176

Query  74   GGSVKPFGFKF--------IGHCPGQGYKEYMVFVETQIDQTKWL  110
            G      GF+F        + HC           V T  DQ  W+
Sbjct  177  G-----HGFEFSFETTEGKVFHCS----------VPTHFDQLAWV  206

>PHALS_04098
Length=1183

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/109 (28%), Positives = 54/109 (50%), Gaps = 12/109 (11%)

Query  9    HQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQ  68
            H+   EGYV K+G  +  W+ RY++L G TL   YY+SKE  +S    +G   + +   +
Sbjct  70   HEVHWEGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARNMRGRMTVYKVRPE  127

Query  69   DLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNAL  117
            +        K  GF        Q +K++ +   T++++  W+ + H A+
Sbjct  128  NYG------KAHGFLL----ETQSHKQFHLCCATELEKDMWVEMMHAAV  166

>PYAR_25500
Length=473

 Score = 50.4 bits (119),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/101 (30%), Positives = 55/101 (54%), Gaps = 14/101 (14%)

Query  12   SCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLS  71
            + EGY+ K+  ++  W+  Y VL GDTL  AYY+S+E + SN     + ++   + QD+ 
Sbjct  60   AFEGYLHKKSEVLSHWRATYCVLEGDTL--AYYESREDFISN-----TKLIGRIQVQDVG  112

Query  72   DEGGSV---KPFGFKFIGHCPGQGYKEYMVFVETQIDQTKW  109
            D+  S    KP GF+ +     +G++ + +   T  ++ +W
Sbjct  113  DDDQSAPNGKPHGFRIM----TEGHRAHHLSSRTAFEKDQW  149

>PPTG_13401
Length=927

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 50/97 (52%), Gaps = 9/97 (9%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            EGYVTKRGH+++ WK R+  L G+  LV+YY++K   ++    KG   ++  +   ++  
Sbjct  109  EGYVTKRGHLVRNWKMRFFTLEGN--LVSYYENKVDARNRSHLKGRVNVASVKMDKVAKN  166

Query  74   GGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWL  110
            G      GF F      +G K +   V T  DQ  W+
Sbjct  167  G-----HGFDFSFET-TEG-KVFYCSVPTHFDQIAWV  196

>PITG_18067
Length=924

 Score = 50.4 bits (119),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 50/97 (52%), Gaps = 9/97 (9%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            EGYVTKRGH+++ WK R+  L G+  LV+YY++K   ++    KG   ++  +   ++  
Sbjct  109  EGYVTKRGHLVRNWKMRFFTLEGN--LVSYYENKVDARNRSHLKGRVNVASVKMDKVAKN  166

Query  74   GGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWL  110
            G      GF F      +G K +   V T  DQ  W+
Sbjct  167  G-----HGFDFSFET-TEG-KVFYCSVPTHFDQLAWV  196

>SDRG_03531
Length=255

 Score = 49.3 bits (116),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 52/103 (50%), Gaps = 17/103 (17%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDEG  74
            G+V KRG +M++WKRRY VL  + L  AYYD   I     P KG  ++        S E 
Sbjct  166  GWVEKRGAVMRSWKRRYFVLRENVL--AYYD---INLEGQPKKGGDLVQ-------SIET  213

Query  75   GSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNAL  117
             +VKP G +F     G   +  + F ET  D  +WL +A N L
Sbjct  214  STVKPNGLEF-KMVSG---RSLVGFTETTDDHVQWL-LAANTL  251

>SDRG_08800
Length=881

 Score = 50.4 bits (119),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 50/99 (51%), Gaps = 10/99 (10%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            EG+V+K+GH+++ WK RY  L  +  L++YY+SKE  +     KG   L+         E
Sbjct  66   EGFVSKKGHLVRNWKLRYFTLESN--LLSYYESKEDARKRRHLKGRVHLTRVHII----E  119

Query  74   GGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNV  112
            G S   + F F      Q  K + V   T++DQ  W+ V
Sbjct  120  GKSAHGYDFTF----DTQEGKPFHVSTTTELDQIAWVKV  154

>H310_04843
Length=968

 Score = 50.4 bits (119),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 30/117 (26%), Positives = 58/117 (50%), Gaps = 12/117 (10%)

Query  9    HQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQ  68
            H+   EGYV K+G  +  W+ RY+VL G +L   YY+SKE  ++    +G  +++     
Sbjct  98   HEVHWEGYVRKKGDWLPRWEERYLVLDGASL--TYYNSKEEARTGKNLRGRMIITRV---  152

Query  69   DLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPS  125
             L +  G    F  + +GH      K + +   T++++  W+ +   A+ +  + P+
Sbjct  153  -LPENYGKAHGFLIETMGH------KHFHLCCTTELEKDMWVEMMQAAIDEGVHHPN  202

>PYU1_G012859
Length=1183

 Score = 50.4 bits (119),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 63/147 (43%), Gaps = 26/147 (18%)

Query  10   QTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQD  69
            Q++C G++ K+G  +KTWKRRY  LHG TL       +   +  G    SF +S  EKQ 
Sbjct  808  QSNCHGWLNKQGGTIKTWKRRYFSLHGTTL-------RYFKRETGSMLRSFTISHVEKQP  860

Query  70   LSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIP----S  125
                G  V                ++ M+  E++ D  +WL     ++   + +P    +
Sbjct  861  QVALGLEVMT-----------TSGRKLMLTAESKEDYGRWLRALQASISAESSVPKSPTA  909

Query  126  PSMESHGGAGHKESAGLMISLEAQIKN  152
            P  + H      ++ G   ++ A + N
Sbjct  910  PVQQQHDA----DAGGRASNVSATVNN  932

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/48 (38%), Positives = 34/48 (71%), Gaps = 7/48 (15%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVL  62
            G++ K+GH++++WK+RY VLHGD+L   Y+++      + PP+G  ++
Sbjct  497  GWLLKQGHLIRSWKQRYFVLHGDSL--QYFEN-----IDKPPRGGGIV  537

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 24/71 (34%), Positives = 38/71 (54%), Gaps = 12/71 (17%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQ-----  68
            +G++ K G  MK WK+R++VL G+ L  +YY  +     + PP GS V+ + E       
Sbjct  197  KGWLLKEGKRMKNWKKRFVVLRGNVL--SYYADE---TPSSPPLGSLVIRQVETNFTTPF  251

Query  69   --DLSDEGGSV  77
              D+  EGG +
Sbjct  252  TLDVHTEGGRI  262

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 22/38 (58%), Gaps = 0/38 (0%)

Query  2    HVNLSKIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTL  39
            H   S     +CEG++ K+GH  K WKRRY  L+ D L
Sbjct  348  HTLPSSASSQTCEGWLLKQGHKSKRWKRRYFTLNNDML  385

 Score = 37.4 bits (85),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 25/40 (63%), Gaps = 2/40 (5%)

Query  6    SKIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYD  45
            +++ +   EG++ K+G   KTWK+RY VL    L+  YYD
Sbjct  605  NRLGRLGQEGWLLKKGQNFKTWKQRYFVLERSRLM--YYD  642

 Score = 32.0 bits (71),  Expect = 7.4, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 20/30 (67%), Gaps = 2/30 (7%)

Query  15  GYVTKRGHMMKTWKRRYMVLHGDTLLVAYY  44
           G+ +K+G  +KTWK R+ VL G  L  AY+
Sbjct  11  GWGSKQGSKVKTWKTRFFVLRGTDL--AYF  38

>PYAP_24144
Length=1022

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/108 (29%), Positives = 54/108 (50%), Gaps = 8/108 (7%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            EGY+ K+  ++  W+  Y VL GDTL  AYY+S+E +  N    G   +   +  +L   
Sbjct  314  EGYLHKKSDLLAQWRAIYCVLEGDTL--AYYESREDFILNARLIGRIQVQGVDDDNLPAA  371

Query  74   GGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTT  121
             G  KP GF+ +     +G++ + +   T  ++ +W     +A+ K T
Sbjct  372  TG--KPHGFRVL----TEGHRIHHLGSRTAFEKDQWKRAIKSAIAKAT  413

>CCA18023
Length=1138

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 59/124 (48%), Gaps = 14/124 (11%)

Query  9    HQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQ  68
            HQ   EGYV K+G  +  W+ RY+VL G TL   YY++KE  +S    +G  ++ +   +
Sbjct  120  HQVHWEGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEEARSARNLRGKMMIVKVRPE  177

Query  69   DLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSPSM  128
            +        K  GF        +G+K + +   T++++  W+ +   A+ +    P  S 
Sbjct  178  NYG------KAHGFLI----ETKGHKHFHLCCATELEKDMWIEMMQAAIEQAA--PFSSN  225

Query  129  ESHG  132
             SH 
Sbjct  226  ASHS  229

>PHYKE_6662
Length=765

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/109 (27%), Positives = 54/109 (50%), Gaps = 12/109 (11%)

Query  9    HQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQ  68
            H+   EG+V K+G  +  W+ RY++L G TL   YY+SKE  +S    +G  ++ +   +
Sbjct  67   HEVHWEGFVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARNLRGRMIIVKVRPE  124

Query  69   DLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNAL  117
            +        K  GF        QG+K + +   T++++  W+ +   A+
Sbjct  125  NYG------KAHGFLI----ETQGHKHFHLCCSTELEKDMWVEMMQAAI  163

>PITG_11303
Length=293

 Score = 48.9 bits (115),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 26/42 (62%), Gaps = 2/42 (5%)

Query  13   CEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNG  54
            CEGY+TKRGH+   WK RY  L G+ L   YY S+E  K  G
Sbjct  214  CEGYLTKRGHVFTNWKTRYFTLRGNVL--EYYSSEEKSKKYG  253

>CCA24531
Length=374

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 75/180 (42%), Gaps = 23/180 (13%)

Query  6    SKIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSEC  65
            + I +    G++ K+G ++++WK+RYMVL G  L  +YYD+  I       KGSF +   
Sbjct  18   TSIRRGQYSGWIFKQGSLVRSWKKRYMVLKGRQL--SYYDTDNILSLKVKEKGSFQVITV  75

Query  66   EKQDLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNA----LGKTT  121
            E   LS+E           + H  G+G +   ++ ET  + + W N    A    +    
Sbjct  76   E---LSNE------IKNGLLVH--GRGGRILKLYTETTEEASGWYNAIMEATVISVETAA  124

Query  122  YIPSPSMESHGGAGHKESAGLMISLEAQIKNVKKTS------HELLQQAINDAKEADRIG  175
             I +      G  G  E+A  +        N  K         ELL Q+ ND  E D  G
Sbjct  125  AIVAGRTSRAGSVGSNETASSIDGNTGDSLNAHKICPDLDEETELLHQSNNDEIEIDHTG  184

 Score = 35.8 bits (81),  Expect = 0.30, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 24/34 (71%), Gaps = 2/34 (6%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKE  48
            G++ K G   K+WK+RY VL G++L  AY+ S++
Sbjct  184  GWLWKEGCRFKSWKKRYFVLRGNSL--AYFASED  215

>CCA17102
Length=884

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 49/104 (47%), Gaps = 21/104 (20%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            EGYV KRGH+++ WK R+  L G+ L  +YY+SK   +     KG   L+    + +S  
Sbjct  110  EGYVIKRGHLVRNWKMRFFTLEGNRL--SYYESKGDAQQRVHLKGRVKLASVRIEAVSRL  167

Query  74   GGSVKPFGFKF------IGHCPGQGYKEYMVFVETQIDQTKWLN  111
            G     F F F      + HC           V T++DQ  W++
Sbjct  168  GNG---FDFTFETAESKVFHCS----------VPTKLDQLLWIH  198

>CCI46235
Length=1155

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/109 (28%), Positives = 54/109 (50%), Gaps = 12/109 (11%)

Query  9    HQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQ  68
            HQ   EGYV K+G  +  W+ RY+VL G TL   YY++KE  +S    +G  ++ +   +
Sbjct  115  HQVHWEGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEEARSARNLRGKMMIVKVRPE  172

Query  69   DLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNAL  117
            +        K  GF        +G+K + +   T++++  W+ +   A+
Sbjct  173  NYG------KAHGFLI----ETKGHKHFHLCCATELEKDMWIEMMQAAI  211

>PITG_20103
Length=1301

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/115 (29%), Positives = 54/115 (47%), Gaps = 12/115 (10%)

Query  12   SCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLS  71
            S EGY++K+  ++ +WK  Y VL  DTL  A+Y+++E + SN    G   L   E +D+ 
Sbjct  224  SFEGYLSKKSDVLMSWKATYCVLEEDTL--AFYETREDFISNSKLIGRIQLQSIEDEDMG  281

Query  72   DEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSP  126
                  KP GF+ I     +G     +   T  ++ +W      A+ K   +  P
Sbjct  282  ------KPNGFRVI----AEGNHVNHLSSRTTFEKEQWKRAISIAISKAPEVTRP  326

>PYIR_18382
Length=1154

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/109 (27%), Positives = 54/109 (50%), Gaps = 12/109 (11%)

Query  9    HQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQ  68
            H+   EGYV K+G  +  W+ RY+VL G  L   YY++KE  +S    +G  ++S+   +
Sbjct  124  HEVHWEGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEEARSARNLRGRMIISKVRPE  181

Query  69   DLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNAL  117
            +        K  GF        +G+K + +   T++++  W+ +   A+
Sbjct  182  NYG------KAHGFLI----ETKGHKHFHLCCSTELEKDMWVEMMQAAI  220

>HYAP_04457
Length=1203

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 60/125 (48%), Gaps = 20/125 (16%)

Query  9    HQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQ  68
            H+   EGYV K+G  +  W+ RY++L G TL   YY+SKE  +S    +G  +L +   +
Sbjct  57   HEVHWEGYVRKKGDWLPRWEERYLILDGPTL--TYYNSKEDARSARNLRGRMLLLKVRPE  114

Query  69   DLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSPSM  128
            +        K  GF F+     Q +K + +   +++++  W+ +   A+ + T       
Sbjct  115  NYG------KAHGF-FLE---TQSHKHFHLCCSSELEKDMWVEMMQAAIEEGT-------  157

Query  129  ESHGG  133
              HGG
Sbjct  158  -KHGG  161

>PYU1_G008848
Length=765

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/109 (27%), Positives = 54/109 (50%), Gaps = 12/109 (11%)

Query  9    HQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQ  68
            H+   EGYV K+G  +  W+ RY+VL G  L   YY++KE  +S    +G  ++S+   +
Sbjct  129  HEVHWEGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEEARSARNLRGRMIISKVRPE  186

Query  69   DLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNAL  117
            +        K  GF        +G+K + +   T++++  W+ +   A+
Sbjct  187  NYG------KAHGFLI----ETKGHKHFHLCCSTELEKDMWVEMMQAAI  225

>SDRG_00080
Length=298

 Score = 48.1 bits (113),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 30/46 (65%), Gaps = 5/46 (11%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSF  60
            GYV K+G  +K WKRRYMVLH DTL   YY S+   ++   P+G F
Sbjct  75   GYVRKQGSFVKNWKRRYMVLHDDTLF--YYVSE---RATTKPRGFF  115

>PHYRA_79348
Length=1240

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 53/113 (47%), Gaps = 12/113 (11%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            EGY++K+  ++ +WK  Y VL  DTL  A+YD++E + SN    G   L   E +D+   
Sbjct  268  EGYLSKKSDVLMSWKATYCVLEEDTL--AFYDTREDFISNTKLIGRIQLQGIEDEDMG--  323

Query  74   GGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSP  126
                KP GF+ I     +G     +   T  ++ +W      A+ K   +  P
Sbjct  324  ----KPNGFRLI----AEGNHINHLSSRTAFEKEQWKRAISIAISKAPEVTRP  368

>H310_05457
Length=269

 Score = 47.8 bits (112),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 51/105 (49%), Gaps = 16/105 (15%)

Query  7    KIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECE  66
            +  Q   +G+V KRG  +++WKRR+ +L  +  L++YYD   I     P KG  V+    
Sbjct  175  RTRQDVMKGWVEKRGSRIRSWKRRFFILREN--LLSYYD---INLEGQPQKGGDVV----  225

Query  67   KQDLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLN  111
               LS E  +VKP G +F         +  + F E   D  +WL+
Sbjct  226  ---LSIENSTVKPNGLEF----KMTNGRSLVGFTEEADDHARWLS  263

 Score = 34.7 bits (78),  Expect = 0.56, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 27/45 (60%), Gaps = 6/45 (13%)

Query  15  GYVTKRGHMMKTWKRRYMVLHGDTLLVAYY-DSKEIYKSNGPPKG  58
           GYV +   + K WKRR+MVL G  L  +YY +  E  + + PPKG
Sbjct  39  GYVYR---LSKKWKRRFMVLEGRDL--SYYGNETEAMEPSTPPKG  78

>PYU1_G009508
Length=328

 Score = 48.1 bits (113),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKE  48
            GY+ K+G   KTW+RRY +L  DT +++YYDS E
Sbjct  166  GYLVKQGSYWKTWRRRYFILRRDTPVLSYYDSAE  199

>H257_03093
Length=975

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 59/118 (50%), Gaps = 14/118 (12%)

Query  9    HQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQ  68
            H+   EGYV K+G  +  W+ RY+VL G +L   YY+SK+  ++    +G  ++++    
Sbjct  99   HEVHWEGYVRKKGDWLPRWEERYLVLDGASL--TYYNSKDEARTGTNLRGRMIITKV---  153

Query  69   DLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSP  126
             L +  G    F  + +GH      K + +   T++++  W+ +   A+ +   +P P
Sbjct  154  -LPENYGKAHGFLIETMGH------KHFHLCCTTELEKDMWVEMMQAAIDEG--VPHP  202

>PHYKE_5678
Length=809

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 33/46 (72%), Gaps = 2/46 (4%)

Query  8    IHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSN  53
            I +T  EGY+ K+GH++++W+ RY VL G T   +YY SKE+ K++
Sbjct  97   IFETDWEGYIWKQGHVVRSWRYRYAVLSGVTF--SYYVSKEVAKTD  140

>PYIW_16987
Length=821

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/109 (27%), Positives = 54/109 (50%), Gaps = 12/109 (11%)

Query  9    HQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQ  68
            H+   EGYV K+G  +  W+ RY+VL G  L   YY++KE  +S    +G  ++S+   +
Sbjct  115  HEVHWEGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEEARSARNLRGRMIISKVRPE  172

Query  69   DLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNAL  117
            +        K  GF        +G+K + +   T++++  W+ +   A+
Sbjct  173  NYG------KAHGFLIE----TKGHKHFHLCCSTELEKDMWVEMMQAAI  211

>CCI41225
Length=981

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/111 (30%), Positives = 49/111 (44%), Gaps = 21/111 (19%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            EGYVTKRGH+++ WK R+  L G+ L  +YY+SK   +     KG   ++      +S  
Sbjct  140  EGYVTKRGHLVRNWKMRFFTLEGNRL--SYYESKVDAQQRAHLKGRVKVASVRIDQVSKW  197

Query  74   GGSVKPFGFKF------IGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALG  118
            G     + F F      I HC           V T ++Q  W+      +G
Sbjct  198  GSG---YEFTFSTTEGKIFHCS----------VSTPLEQVLWVYFLEAGIG  235

>PPTG_06823
Length=1321

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/115 (29%), Positives = 54/115 (47%), Gaps = 12/115 (10%)

Query  12   SCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLS  71
            S EGY++K+  ++ +WK  Y VL  DTL  A+Y+++E + SN    G   L   E +D+ 
Sbjct  247  SFEGYLSKKSDVLMSWKATYCVLEEDTL--AFYETREDFISNSKLIGRIQLQGIEDEDMG  304

Query  72   DEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSP  126
                  KP GF+ I     +G     +   T  ++ +W      A+ K   +  P
Sbjct  305  ------KPNGFRVI----AEGNHVNHLSSRTAFEKEQWKRAISIAISKAPEVTRP  349

>SPRG_16312
Length=261

 Score = 47.0 bits (110),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 30/46 (65%), Gaps = 5/46 (11%)

Query  15  GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSF  60
           GYV K+G  +K WKRR+MVLH DTL   YY S+   ++   P+G F
Sbjct  43  GYVRKQGSFVKNWKRRFMVLHDDTLF--YYVSE---RAMAKPRGFF  83

>PHYCA_506137
Length=810

 Score = 47.8 bits (112),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 33/46 (72%), Gaps = 2/46 (4%)

Query  8    IHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSN  53
            I +T  EGY+ K+GH++++W+ RY VL G T   +YY SK++ K++
Sbjct  98   IFETDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDVAKTD  141

>PHYCA_504712
Length=208

 Score = 46.2 bits (108),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 45/106 (42%), Gaps = 18/106 (17%)

Query  13   CEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSD  72
            C G++ K G  +K WKRRY  LHG TL   Y+ S      NG    SF +  C    L  
Sbjct  85   CSGWLRKEGGTVKNWKRRYFTLHGPTL--CYFKS-----DNGALLRSFTV--CHVVTLRT  135

Query  73   EGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALG  118
                      +       +  ++ +V  ETQ D  +WL+  H A+ 
Sbjct  136  R---------RLCLEITTEVGRKLLVASETQADLDRWLDHLHRAIA  172

>H257_03361
Length=699

 Score = 47.8 bits (112),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 37/61 (61%), Gaps = 3/61 (5%)

Query  14  EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
           +G++ K+G ++ +WK+RY+VL G    ++Y+D KE+       KGSFVL+  +     D 
Sbjct  11  QGWIQKQGSVVPSWKKRYLVLSGQN--ISYFD-KEVSNPRAKEKGSFVLAGVQPNKSYDN  67

Query  74  G  74
           G
Sbjct  68  G  68

 Score = 38.1 bits (87),  Expect = 0.069, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 51/120 (43%), Gaps = 21/120 (18%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDEG  74
            G++ K+G ++++WK+RY VL G    +AY+D+ +     G  KG   L++    D     
Sbjct  212  GWLDKQGEIVQSWKQRYFVLRGRN--IAYFDTVD-----GNQKGGGRLADVTMSDT----  260

Query  75   GSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSPSMESHGGA  134
                  G  F  H      +   V   +  D   W NV    LGK T I   S   + GA
Sbjct  261  ------GLHF--HL--DNGRVVNVTASSSTDLQGWHNVVSQVLGKRTDITDGSPHEYAGA  310

>PHYRA_79281
Length=809

 Score = 47.8 bits (112),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 33/46 (72%), Gaps = 2/46 (4%)

Query  8    IHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSN  53
            I +T  EGY+ K+GH++++W+ RY VL G T   +YY SK++ K++
Sbjct  97   IFETDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDVAKTD  140

>PYAR_14615
Length=517

 Score = 47.4 bits (111),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 47/106 (44%), Gaps = 10/106 (9%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            EG++ K+G   K+WKRR+ V  G TL  +YY S++  K    P     L  C  +D    
Sbjct  38   EGFLQKKGQRFKSWKRRWFVCDGRTL--SYYISRKDRK----PNAIIPLESCTVED----  87

Query  74   GGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGK  119
            GG  + +    I    G     Y +  E     T WLNV   A+ K
Sbjct  88   GGISETWNSPRIYLTDGTTGTMYCLSAEDGEVVTAWLNVLRTAIAK  133

>PYAR_19914
Length=788

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 50/103 (49%), Gaps = 14/103 (14%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            EGYVTKRGH+++ WK R+  L G+ L  +YY++K   ++    KG   +   + + +S  
Sbjct  146  EGYVTKRGHLVRNWKNRFFTLEGNNL--SYYENKVDARNRDHLKGRVNVVSVKAEKVSKS  203

Query  74   GGSVKPFGFKF------IGHCPGQGYKE---YMVFVETQIDQT  107
            G     F F F        HC      E   ++ F+E  +D +
Sbjct  204  GHG---FDFSFDTVEGKTFHCSVPTETERLMWVYFLEAGVDHS  243

>CCA19097
Length=688

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 28/39 (72%), Gaps = 2/39 (5%)

Query  8   IHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDS  46
           +H     G+V K+G ++KTWKRRYMVL+G+ L   YYDS
Sbjct  2   VHINQFSGWVHKQGAVIKTWKRRYMVLNGNVL--KYYDS  38

 Score = 37.4 bits (85),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 24/33 (73%), Gaps = 2/33 (6%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSK  47
            G++ K+G  +K WKRR+ +L GD L  +Y+D++
Sbjct  144  GWLVKQGGRVKNWKRRFFLLRGDNL--SYFDTE  174

>PPTG_05519
Length=810

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 31/44 (70%), Gaps = 2/44 (5%)

Query  8    IHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYK  51
            I +T  EGY+ K+GH++++W+ RY VL G T   +YY SK++ K
Sbjct  98   IFETDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDVAK  139

>PHYSO_344112
Length=813

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 31/44 (70%), Gaps = 2/44 (5%)

Query  8    IHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYK  51
            I +T  EGY+ K+GH++++W+ RY VL G T   +YY SK++ K
Sbjct  98   IFETDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDVAK  139

>PYVX_13312
Length=1016

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 29/109 (27%), Positives = 52/109 (48%), Gaps = 12/109 (11%)

Query  9    HQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQ  68
            H+   EGYV K+G  +  W+ RY++L G  L   YY+SK+  +S    +G   LS    +
Sbjct  71   HEVHWEGYVRKKGDWLPRWEERYLILDGAAL--TYYNSKDEARSGRNLRGRMQLSRVRPE  128

Query  69   DLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNAL  117
            +        K  GF        +G+K + +   T++++  W+ +   A+
Sbjct  129  NYG------KAHGFLI----ETRGHKSFHLCCTTELEKDMWVEMMQAAI  167

>PITG_02762
Length=810

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 31/44 (70%), Gaps = 2/44 (5%)

Query  8    IHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYK  51
            I +T  EGY+ K+GH++++W+ RY VL G T   +YY SK++ K
Sbjct  98   IFETDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDVAK  139

>CCI10489
Length=777

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 58/124 (47%), Gaps = 13/124 (10%)

Query  8    IHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEK  67
            + +T  EGY+ KRGH++++W+ R+ VL G  L  +YY SKE+   N       V     +
Sbjct  101  MFKTDWEGYIWKRGHVVRSWRHRFAVLSGTCL--SYYTSKEVAMLNTEKYRGRVTVTAAR  158

Query  68   QDLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTT-YIPSP  126
             D +   G +                K ++++  T +++  W+ +   A+   + +I SP
Sbjct  159  NDETRSCGVLITTTIN----------KTFIIYTRTPVERDIWVCMITQAVANLSGHIHSP  208

Query  127  SMES  130
              +S
Sbjct  209  ITKS  212

>PYAP_17290
Length=835

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/101 (31%), Positives = 50/101 (50%), Gaps = 17/101 (17%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            EGYVTKRGH+++ WK R+  L G+ L  +YY++K   ++    KG   ++   K D   +
Sbjct  153  EGYVTKRGHLVRNWKMRFFTLEGNNL--SYYENKVDARNRDHLKGRVNVASV-KLDKVSK  209

Query  74   GGSVKPFGFKF----IGHCPGQGYKEYMVFVETQIDQTKWL  110
             G    F F+     + HC           V T+++Q  W+
Sbjct  210  SGHGHDFSFETTEGKVFHCS----------VPTEMEQLAWV  240

>PYAP_22195
Length=901

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 47/106 (44%), Gaps = 10/106 (9%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            EGY+ K+G  +K WKRR+ V +G TL  +YY S++  K    P     L  C  +D    
Sbjct  38   EGYLQKKGQRLKGWKRRWFVCNGRTL--SYYISRKDRK----PNAVIPLETCTVED----  87

Query  74   GGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGK  119
            GG  + +    I    G     Y +  E       WL V  NA+ K
Sbjct  88   GGLSETWNSPRIYLTDGTSGVMYCLSAEDAEVVNAWLTVLRNAVAK  133

>PYIR_15118
Length=1222

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 71/152 (47%), Gaps = 30/152 (20%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDEG  74
            GY+ K+G   KTW+RRY +L  D  +++YYDS E     G              +++ +G
Sbjct  193  GYLVKQGSFWKTWRRRYFILRRDIPVLSYYDSAEELTKLG--------------EITVDG  238

Query  75   GS-VKP-----FGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSPSM  128
             + V+P     F F+F+     +G K  +V  E +     W++   N + +     +  M
Sbjct  239  TTGVRPTPREGFPFQFV--VEHEGRKLTLVAEEGKPSTDAWISNIQNCIQRR----AAEM  292

Query  129  ESHGGAGHKESAGLMI----SLEAQIKNVKKT  156
            E+   +  ++S  L I    S+E  +++ +K+
Sbjct  293  ENARQSVERKSLALRISENGSMEEDLQSFRKS  324

>PYAP_16658
Length=294

 Score = 46.2 bits (108),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 24/34 (71%), Gaps = 0/34 (0%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKE  48
            GY+ K+G   KTWKRRY +L  D  ++AYY S+E
Sbjct  152  GYLVKQGSFWKTWKRRYFILRRDINVLAYYTSQE  185

>CCA16487
Length=975

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/105 (30%), Positives = 51/105 (49%), Gaps = 9/105 (9%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            EGYVTKRGH+++ WK R+  L G+ L  +YY++K   +     KG   ++      +S  
Sbjct  138  EGYVTKRGHLVRNWKMRFFTLEGNRL--SYYENKVDAQQRAHLKGRVKVASVRIDQVSKW  195

Query  74   GGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALG  118
            G      G++F      +G K +   V T ++Q  W+      +G
Sbjct  196  GS-----GYEFT-FSTTEG-KTFHCSVSTSLEQLLWVYFLEAGIG  233

>PYU1_G006732
Length=954

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 47/106 (44%), Gaps = 10/106 (9%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            EGY+ K+G  +K WKRR+ V    TL  +YY S++  K    P     L  C  QD    
Sbjct  21   EGYLQKKGQRLKGWKRRWFVCDARTL--SYYISRKDRK----PNAVIPLEGCSVQD----  70

Query  74   GGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGK  119
            GG  + +    I    G     Y +  E     T+WL V  NA+ K
Sbjct  71   GGLSETWNSPRIYLTDGTNGVMYCLSSEDGEAVTQWLAVLRNAVAK  116

>PYIW_18911
Length=1196

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 24/34 (71%), Gaps = 0/34 (0%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKE  48
            GY+ K+G   KTW+RRY +L  D  +++YYDS E
Sbjct  174  GYLVKQGSFWKTWRRRYFILRRDIPVLSYYDSAE  207

>SPRG_00890
Length=883

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 67/145 (46%), Gaps = 16/145 (11%)

Query  9    HQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQ  68
            H+   EGYV K+G  +  W+ RY+VL G +L   YY++K+  +S    +G  +++     
Sbjct  26   HEVHWEGYVRKKGDWLPRWEERYLVLDGASL--TYYNTKDEARSGRNLRGRMIITRV---  80

Query  69   DLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSPSM  128
             L +  G    F  +  GH      K + +   T++++  W+ +   A+ +    P P +
Sbjct  81   -LPENYGKAHGFLIETKGH------KHFHLCCTTELEKDMWVEMMQAAIDEGISHP-PHL  132

Query  129  ESHGGAGHKESAGLMISLEAQIKNV  153
             +   +G  E+    +S +A    V
Sbjct  133  TTQQSSGTFEAT---VSFQASPTQV  154

>PYIR_23012
Length=965

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 51/119 (43%), Gaps = 10/119 (8%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            EGY+ K+G  +K WKRR+ V    TL  +YY    I + +  P     L  C  QD    
Sbjct  38   EGYLQKKGQRLKGWKRRWFVCDARTL--SYY----INRKDRKPNAVIPLEGCTVQD----  87

Query  74   GGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSPSMESHG  132
            GG  + +    I    G     Y +  E     T+WL V  NA+ K        ++S+G
Sbjct  88   GGLSETWNSPRIYLTDGTSGVMYCLSAEDGEAVTQWLLVLRNAVTKVNGTDGAELQSNG  146

>PYAR_19883
Length=833

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/123 (23%), Positives = 58/123 (47%), Gaps = 15/123 (12%)

Query  7    KIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPP-KGSFVLSEC  65
            ++ +T  EGY+ K+GH+++ W+ RY +L G T   +YY SK++   +    +G   ++  
Sbjct  96   EMFETDWEGYIWKQGHVVRNWRYRYAILSGTTF--SYYISKDVAMQDTEKYRGRVSVTGA  153

Query  66   EKQDLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPS  125
             + D    G  +               +K + ++  T ++   W+ +   A+   T +P 
Sbjct  154  SRDDSRANGVLIT-----------TTIHKAFALYTRTPVEAEIWVRMIQQAVANAT-LPK  201

Query  126  PSM  128
            PS+
Sbjct  202  PSV  204

>CCI42457
Length=906

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/105 (30%), Positives = 48/105 (46%), Gaps = 21/105 (20%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            EGYV KRGH+++ WK R+  L G+   V+YY+SK   +     KG   +     + +S  
Sbjct  130  EGYVIKRGHLVRNWKMRFFTLEGNR--VSYYESKGDAQQRVHLKGRVKVVSVRMETISKL  187

Query  74   GGSVKPFGFKF------IGHCPGQGYKEYMVFVETQIDQTKWLNV  112
            G     F F F      + HC           V T++ Q  W+++
Sbjct  188  GNG---FDFSFETAESKVFHCS----------VPTKLSQLLWVHL  219

>PHYKE_4911
Length=46

 Score = 41.6 bits (96),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/39 (46%), Positives = 27/39 (69%), Gaps = 2/39 (5%)

Query  15  GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSN  53
           G+V K+G ++K WK+R+MVL G  L   YYD+ ++ K N
Sbjct  9   GWVYKQGSLVKNWKKRFMVLRGRQL--TYYDTAKMMKWN  45

>CCI47145
Length=390

 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 85/195 (44%), Gaps = 29/195 (15%)

Query  8    IHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEK  67
            I +    G++ K+G ++++WK+RYMVL G  L  +YYD+  I       KGSF +   E 
Sbjct  32   IRRGQYSGWIFKQGSLVRSWKKRYMVLKGRQL--SYYDTDNILSLKVKEKGSFQVITVEL  89

Query  68   QDLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSPS  127
             +    G          + H  G+G +   ++ ET  + + W    +NA+ + T I   +
Sbjct  90   SNEIKNG---------LLVH--GRGGRILKLYTETTEEASGW----YNAIIEATVISVET  134

Query  128  MESHGGAGHKESAGLMISLEAQIKNVKKTSHELLQQAINDAKEADRIG--DATVDEMAYQ  185
              +   AG    AG + S E  +          +     D++ A +I      V E+  Q
Sbjct  135  AVAI-AAGRTSRAGSLGSNETALS---------VDGCTRDSQMAHKICLDSNDVTELLDQ  184

Query  186  EEVLNDAENTVDAMG  200
             ++ N+ E  +D  G
Sbjct  185  SDLQNNDEIEIDHTG  199

 Score = 35.8 bits (81),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 24/34 (71%), Gaps = 2/34 (6%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKE  48
            G++ K G   K+WK+RY VL G++L  AY+ S++
Sbjct  199  GWLWKEGCRFKSWKKRYFVLRGNSL--AYFASED  230

>PYIW_18480
Length=755

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 30/42 (71%), Gaps = 2/42 (5%)

Query  8   IHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEI  49
           + +T  EGYV K+GH++++W+ RY +L G T   +YY SKE+
Sbjct  47  MFETDWEGYVWKQGHVVRSWRYRYAILSGTTF--SYYVSKEV  86

>CCA21715
Length=782

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 30/43 (70%), Gaps = 2/43 (5%)

Query  7    KIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEI  49
            ++ +T  EGY+ K+GH++++W+ RY VL G     +YY SKEI
Sbjct  102  ELFETDWEGYIWKQGHVVRSWRYRYAVLSGTCF--SYYSSKEI  142

>CCA21860
Length=782

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 30/43 (70%), Gaps = 2/43 (5%)

Query  7    KIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEI  49
            ++ +T  EGY+ K+GH++++W+ RY VL G     +YY SKEI
Sbjct  102  ELFETDWEGYIWKQGHVVRSWRYRYAVLSGTCF--SYYSSKEI  142

>H310_06378
Length=837

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/97 (31%), Positives = 49/97 (51%), Gaps = 10/97 (10%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            EG+V K+GH+++ WK RY  L G+  L++YY++KE  +     KG   L+      +  E
Sbjct  59   EGFVQKKGHLVRNWKVRYFTLEGN--LLSYYETKEDARKRRFLKGRVHLTTV----MLVE  112

Query  74   GGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWL  110
            G S   +   F      Q  K + V   T+++Q  W+
Sbjct  113  GRSAHGYDLTFT----TQESKPFHVSTTTELEQIAWV  145

>PHYSO_315255
Length=1301

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 53/113 (47%), Gaps = 12/113 (11%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            EGY++K+  ++ +WK  Y VL  DTL  A+Y+++E + SN    G   L   E +D+   
Sbjct  226  EGYLSKKSDVLMSWKATYCVLEEDTL--AFYETREDFISNTKLIGRIQLQGIEHEDMG--  281

Query  74   GGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSP  126
                KP GF+ I     +G     +   T  ++ +W      A+ K   +  P
Sbjct  282  ----KPNGFRVI----AEGNHINHLSSRTAFEKEQWKRAISIAISKAPEVTRP  326

>HYAP_08026
Length=798

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 31/44 (70%), Gaps = 2/44 (5%)

Query  8    IHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYK  51
            + +T  EGY+ K+GH++++W+ RY VL G T   +YY SK++ K
Sbjct  85   LFETDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDVAK  126

>CCA25510
Length=1139

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 24/34 (71%), Gaps = 0/34 (0%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKE  48
            GY+ K+G   K+W+RRY +L  D  ++AYY SKE
Sbjct  197  GYLVKQGSFWKSWRRRYFILRRDVPILAYYTSKE  230

>PYIW_21944
Length=1317

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 48/185 (26%), Positives = 86/185 (46%), Gaps = 23/185 (12%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPK--GSFVLSECEKQDLSD  72
            G++TK+GHM KTWK R+ VL+ D    AY      YK+ G  +  GS  L++     +S 
Sbjct  105  GWLTKQGHMWKTWKTRFFVLYSDGTF-AY------YKNEGKKRMQGSLTLND---GIVSI  154

Query  73   EGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSPSMESHG  132
            +   ++  G  ++     +G+ + + +  +Q +   W+    +AL      P P  E   
Sbjct  155  KHVDIRKVGKSYVIQVE-KGFYKLLCYCCSQNEAELWV----SALRSARKTPPPCFEIDL  209

Query  133  GAGHKESAGLMISLEAQIKNVKKTSHELLQQAINDAKEADRIGDATVDEMAYQEEVLNDA  192
             A  +E AG+  ++  Q+  +  T H+ + Q++ D K    I     +  A+ E   N  
Sbjct  210  TAA-EEKAGVN-AVTRQLNRIFITDHQ-IAQSVEDFKATTLISHRAEEVQAFVE---NID  263

Query  193  ENTVD  197
            +N +D
Sbjct  264  DNIID  268

>SDRG_01407
Length=815

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 67/145 (46%), Gaps = 16/145 (11%)

Query  9    HQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQ  68
            H+   EGYV K+G  +  W+ RY+VL G +L   YY++K+  +S    +G  +++     
Sbjct  80   HEVHWEGYVRKKGDWLPRWEERYLVLDGASL--TYYNTKDEARSGRNLRGRMIITRV---  134

Query  69   DLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSPSM  128
             L +  G    F  +  GH      K + +   T++++  W+ +   A+ +    P P +
Sbjct  135  -LPENYGKAHGFLIETKGH------KHFHLCCTTELEKDMWVEMMQAAIDEGISHP-PHL  186

Query  129  ESHGGAGHKESAGLMISLEAQIKNV  153
             +   +G  E+    +S +A    V
Sbjct  187  TTQQSSGTFEAT---VSFQASPTQV  208

>PYVX_16714
Length=1030

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 47/106 (44%), Gaps = 10/106 (9%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            EG++ K+G  +K WKRR+ V  G  L  +YY S++  K    P     L  C  QD    
Sbjct  160  EGFLQKKGQRLKGWKRRWFVCDGRAL--SYYISRKDRK----PNAVIPLEGCTVQD----  209

Query  74   GGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGK  119
            GG  + +    I    G     Y +  E     T+WL V  NA+ +
Sbjct  210  GGISETWNSPRIYLTDGATGVMYCLSAEDGTAVTQWLAVLRNAVAR  255

>CCI43456
Length=126

 Score = 43.1 bits (100),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 35/64 (55%), Gaps = 7/64 (11%)

Query  2   HVNLSKIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFV  61
           ++++ +I   + EG +TKR   MK W++RY +L G+ L    Y SK     N  P G   
Sbjct  9   NLSIDRIQNPAFEGELTKRSMWMKEWRKRYFILKGNKL----YFSK---SKNDAPHGFID  61

Query  62  LSEC  65
           L++C
Sbjct  62  LADC  65

>PYVX_18338
Length=746

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 33/49 (67%), Gaps = 2/49 (4%)

Query  1    MHVNLSKIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEI  49
            +H ++    +T  EGY+ K+GH++++W+ RY VL G T   +YY SK++
Sbjct  69   VHGSIEDAFETDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDV  115

>PHYSO_484541
Length=911

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 51/121 (42%), Gaps = 24/121 (20%)

Query  13   CEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSD  72
            C G++ K G  +K WKRRY  LHG TL   Y+ S      NG    SF +  C    L  
Sbjct  781  CSGWLRKEGGTVKNWKRRYFTLHGPTL--CYFKS-----DNGALLRSFTV--CHVVTLRT  831

Query  73   EGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSPSMESHG  132
            +         K       +  ++ +V  ETQ D  +WL+  H A      I +   + HG
Sbjct  832  K---------KLCLEITTEVGRKLLVASETQADLDRWLDHLHRA------IAAEKRKKHG  876

Query  133  G  133
            G
Sbjct  877  G  877

 Score = 36.6 bits (83),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (65%), Gaps = 0/31 (0%)

Query  9    HQTSCEGYVTKRGHMMKTWKRRYMVLHGDTL  39
            +  + +G++ K G   KTWKRRYM L G T+
Sbjct  155  NSVAMKGWLMKEGQNFKTWKRRYMTLTGRTI  185

 Score = 35.0 bits (79),  Expect = 0.64, Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 23/35 (66%), Gaps = 2/35 (6%)

Query  8   IHQTSCE--GYVTKRGHMMKTWKRRYMVLHGDTLL  40
           +  + C+  G+  K+G ++K+WKRRY VL G  L+
Sbjct  37  VRSSYCDHSGWGLKQGSIIKSWKRRYFVLKGRELI  71

 Score = 33.9 bits (76),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)

Query  13   CEGYVTKRGHMMKTWKRRYMVLHG  36
            CEG++ KRG     W+RRY  L G
Sbjct  273  CEGWLYKRGQRSTEWQRRYFRLKG  296

>PYVX_19030
Length=556

 Score = 45.4 bits (106),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/91 (32%), Positives = 46/91 (51%), Gaps = 12/91 (13%)

Query  27   WKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDEGGSVKPFGFKFIG  86
            WK+RY V+H D L + YY + E ++  G  +G    S   K D        KP GF+F  
Sbjct  40   WKKRYCVIHKDVLQIVYYLTLEDFE-KGAIRGKIPFSSVHKWD-------GKPNGFQF--  89

Query  87   HCPGQGYKEYMVFVETQIDQTKWLNVAHNAL  117
            + P    K + V+ ET  +QT+W++   + +
Sbjct  90   YTPYN--KCFRVYTETPEEQTRWVDAMQSLI  118

>SPRG_17022
Length=107

 Score = 42.4 bits (98),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 25/41 (61%), Gaps = 2/41 (5%)

Query  8   IHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKE  48
           I  T  EGY+ K+GH+++ W+ RY VL G      YY SKE
Sbjct  29  IMDTDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKE  67

>H310_00209
Length=1198

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 52/106 (49%), Gaps = 13/106 (12%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            EGY++K+G ++  WK  Y VL G TL  A YDS+E + ++   K   +L      D++D+
Sbjct  261  EGYLSKKGDLLAAWKSCYCVLEGLTL--AIYDSREDFMADAGLKVRVILV-----DVNDD  313

Query  74   GGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGK  119
                +P GF        +G+K   +   T  +Q +W+      L K
Sbjct  314  --VARPHGFAI----KTEGHKTLHLASRTAFEQEQWVRAIRLQLTK  353

>H310_12448
Length=555

 Score = 45.4 bits (106),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 51/113 (45%), Gaps = 13/113 (12%)

Query  13   CEGYVTKRGHMMKT-WKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLS  71
            C GYV  +       WK+RY VL  ++L + +YDS E   + G  KG    S        
Sbjct  22   CTGYVYNQPEKNSIIWKKRYCVLQENSLYIFHYDSAEA-AAKGELKGKIPYSSVHDW---  77

Query  72   DEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIP  124
             EG   KP GF+F  + P    K Y V+ +T+ ++ KW+      L     IP
Sbjct  78   -EG---KPHGFQF--YTPTN--KCYKVYTDTEDEKVKWIATMQKQLDDAPEIP  122

>PYVX_22589
Length=1375

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/115 (28%), Positives = 52/115 (45%), Gaps = 12/115 (10%)

Query  12   SCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLS  71
            S EGY+ K+  ++  WK  Y VL  DTL  AY++S+E + SN    G   +   E  D+ 
Sbjct  279  SFEGYLNKKSDLLPNWKVTYCVLEEDTL--AYFESREDFISNSKLIGRVQIQAVEDDDMG  336

Query  72   DEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSP  126
                  K  GF+ +     +G+    +   T  ++ +W      A+ KT  +  P
Sbjct  337  ------KSNGFRIV----TEGHHVNHLSSRTAFEKDQWKRAIAIAISKTPELSRP  381

>PHALS_03645
Length=830

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 31/44 (70%), Gaps = 2/44 (5%)

Query  8    IHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYK  51
            I +T  EGY+ K+GH++++W+ RY VL G   + +YY SK++ K
Sbjct  98   IFETDWEGYIWKQGHVVRSWRYRYAVLSGT--IFSYYVSKDVAK  139

>PYIR_13168
Length=1353

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 52/102 (51%), Gaps = 9/102 (9%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDEG  74
            G++TK+GHM KTWK R+ VL+ D    AYY +K   K  G    +  +   +  D+   G
Sbjct  116  GWLTKQGHMWKTWKTRFFVLYADGTF-AYYKNKGKKKMQGCLMLNDGIVTVKHVDVRKIG  174

Query  75   GSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNA  116
               KP+ F+       +G+ + + +  +Q++   W++   +A
Sbjct  175  ---KPYVFQV-----EKGFYKLICYCCSQLEAELWVSALRSA  208

>PYVX_14527
Length=1269

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 32/52 (62%), Gaps = 3/52 (6%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECE  66
            G+V K+G +++ WK+R+MVLHG  L   YYD+  +  S    KGSF L   E
Sbjct  903  GWVYKQGSLVRNWKKRFMVLHGRQL--TYYDTARLTPSVK-AKGSFTLITVE  951

 Score = 38.5 bits (88),  Expect = 0.061, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 24/34 (71%), Gaps = 2/34 (6%)

Query  15    GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKE  48
             G++ K G  +K+WKRR+  L GD L  +Y+DS++
Sbjct  1049  GWLKKEGSRVKSWKRRFFALRGDAL--SYFDSED  1080

 Score = 34.7 bits (78),  Expect = 0.96, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 17/25 (68%), Gaps = 0/25 (0%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTL  39
            G++ K G   KTWK+RY VL G+ L
Sbjct  714  GWLEKEGQHFKTWKKRYFVLRGNRL  738

 Score = 34.3 bits (77),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 23/35 (66%), Gaps = 2/35 (6%)

Query  10   QTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYY  44
            Q +  G+V K G ++++WK+R++V  G  L  AYY
Sbjct  584  QVTYAGWVFKEGSLVRSWKKRFLVAKGADL--AYY  616

>PHALS_09729
Length=949

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 60/134 (45%), Gaps = 18/134 (13%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQD--LS  71
            EG++ K+G  +K WKRR+ V  G TL  +YY S++  +    P     L  C  QD  LS
Sbjct  38   EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISRKDRR----PNAVIPLEGCTVQDGGLS  91

Query  72   DEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGK----TTYIPSPS  127
            +   S + +        P  G   Y +  E  I  T+WL+V   A+ +    TT + +  
Sbjct  92   ETWNSPRIYLTD-----PATGIM-YCLSAEEGIVVTQWLDVLQVAVARVNNATTELSATE  145

Query  128  MESHGGAGHKESAG  141
               + G  H+  A 
Sbjct  146  ASQNKGRQHRSQAA  159

>PYU1_G012274
Length=873

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 53/115 (46%), Gaps = 12/115 (10%)

Query  12   SCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLS  71
            S EGY+ K+  ++++WK  Y VL G+T+  AYY+S+E +  N    G   +   E   + 
Sbjct  310  SFEGYLNKKSDLLQSWKALYCVLEGETM--AYYESREDFIMNTKLIGRIHIQSVEDDHMG  367

Query  72   DEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSP  126
                  KP GF+ +     +G++   +   T  ++ +W      A+ K      P
Sbjct  368  ------KPNGFRIL----TEGHRTNHLSSRTAFEKDQWKRAITAAITKAPEAARP  412

>H257_09028
Length=556

 Score = 44.7 bits (104),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 41/143 (29%), Positives = 59/143 (41%), Gaps = 26/143 (18%)

Query  11   TSCEGYVTKRGHMMKT-WKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQD  69
            T C GYV  +       WK+RY VL  ++L + +YD+ E   + G  KG    S      
Sbjct  20   TLCTGYVYNQHEKNSIIWKKRYCVLQENSLYIFHYDNAEA-ATQGELKGKIPYSSVHDW-  77

Query  70   LSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIP-----  124
               EG   KP GF+F  + P    K Y V+ +T+ ++ KW++     L     +P     
Sbjct  78   ---EG---KPHGFQF--YTPTN--KCYKVYTDTEEEKLKWVSTMQKQLDDAPDVPDGEQV  127

Query  125  --------SPSMESHGGAGHKES  139
                    SP      G GH  S
Sbjct  128  PYARFGASSPVGSPRQGGGHPSS  150

>PPTG_16659
Length=916

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 46/105 (44%), Gaps = 18/105 (17%)

Query  13   CEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSD  72
            C G++ K G  +K WKRRY  LHG TL   Y+ S      NG    SF +  C    L  
Sbjct  787  CSGWLRKEGGTVKNWKRRYFTLHGPTL--CYFKS-----DNGALLRSFTI--CHVVTLRT  837

Query  73   EGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNAL  117
            +         +       +  ++ +V  ETQ D  +WL+  H A+
Sbjct  838  K---------RLCLEITTEVGRKLLVASETQADLDRWLDHLHRAI  873

 Score = 36.6 bits (83),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 18/26 (69%), Gaps = 0/26 (0%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTL  39
            +G++ K G   KTWKRRYM L G T+
Sbjct  161  KGWLLKEGQNFKTWKRRYMTLTGRTI  186

 Score = 35.8 bits (81),  Expect = 0.38, Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 36/79 (46%), Gaps = 21/79 (27%)

Query  8   IHQTSCE--GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSEC  65
           +  + C+  G+  K+G ++K+WKRRY VL G  L         IY S   P G  +    
Sbjct  37  VRSSYCDHSGWGYKQGSIIKSWKRRYFVLKGREL---------IYFSERSPSGKGI----  83

Query  66  EKQDLSDEGGSVKPFGFKF  84
                 DE G ++  G +F
Sbjct  84  ------DEKGRLRISGVEF  96

 Score = 33.9 bits (76),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 0/27 (0%)

Query  13   CEGYVTKRGHMMKTWKRRYMVLHGDTL  39
            CEG++ KRG     W+RRY  L G  L
Sbjct  274  CEGWLYKRGQRSTEWQRRYFKLKGFKL  300

>H257_08182
Length=859

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 32/54 (59%), Gaps = 3/54 (6%)

Query  9   HQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVL  62
           H     G++ K+G  +KTWK+RYMVL G    V YYD K + + N   KG+ VL
Sbjct  4   HVGQWSGWIYKQGSRVKTWKKRYMVLQGRH--VTYYD-KSVLEPNPTEKGALVL  54

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 61/129 (47%), Gaps = 29/129 (22%)

Query  10   QTSC----EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSEC  65
            +TSC    EG++ K+G  +K+WKRRY V+HG  L  AYY  K+  +     +G+FV  + 
Sbjct  656  RTSCMMTQEGWMLKQGKQVKSWKRRYFVVHGTDL--AYY--KDELRGTVLGQGTFVHVKP  711

Query  66   EKQDLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPS  125
                        KP+    I +      +  +V + ++ D+  WL+   +AL      P 
Sbjct  712  NPD---------KPWSLVIILNTG----RLLVVALSSEHDEATWLHALQSALQ-----PP  753

Query  126  P---SMESH  131
            P   S+E H
Sbjct  754  PDSQSLEPH  762

 Score = 38.5 bits (88),  Expect = 0.061, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 24/38 (63%), Gaps = 4/38 (11%)

Query  11   TSC---EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYD  45
            TSC    G++ K G  +K+WKRRY  LHG  +LV Y D
Sbjct  437  TSCAHHRGWLQKEGLAIKSWKRRYFTLHG-RMLVYYKD  473

 Score = 36.2 bits (82),  Expect = 0.33, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 25/42 (60%), Gaps = 3/42 (7%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSK-EIYKSNG  54
             G++ K G  ++ WKRRY VL GD L  AYY  + E  K +G
Sbjct  233  RGWLYKEGQHVRNWKRRYFVLTGDHL--AYYGKQGEAAKGDG  272

>PITG_10462
Length=1028

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 51/108 (47%), Gaps = 14/108 (13%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQD--LS  71
            EG++ K+G  +K WKRR+ V  G TL  +YY S++  K    P     L  C  QD  LS
Sbjct  118  EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISRKDRK----PNAVIPLEGCTVQDGGLS  171

Query  72   DEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGK  119
            +   S + +        P  G   Y +  E  I  T+WL+V   A+ +
Sbjct  172  ETWNSPRIYLTD-----PATGIM-YCLSAEEGIVVTQWLDVLRVAVAR  213

>SDRG_02438
Length=224

 Score = 43.5 bits (101),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 40/135 (30%), Positives = 58/135 (43%), Gaps = 20/135 (15%)

Query  2    HVNLSKIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKG-SF  60
            H    KIH +  EG + ++G + K W  RY VL    LL  YY S    +S  P +  +F
Sbjct  100  HALTRKIHGSLREGQLYRQGVLFKFWHARYFVLTPTALL--YYASP---RSPAPRRELTF  154

Query  61   VLSECEKQDLSDEGGSVKPFGFKFIGH----CPGQGYKEYMVFVETQIDQTKWLNVAHNA  116
                C  Q L     + K FG   + H    C    +K  ++   T+ D+T WL     A
Sbjct  155  AGRRCSVQSLR----ATKKFGSVAVVHLLRVC--VDHKHIVLACATESDKTAWLTALQQA  208

Query  117  LGKTTYIPSPSMESH  131
            + ++     PS  SH
Sbjct  209  MTQSL----PSAPSH  219

>PYIR_13120
Length=814

 Score = 44.7 bits (104),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 30/42 (71%), Gaps = 2/42 (5%)

Query  8    IHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEI  49
            + +T  EGY+ K+GH++++W+ RY +L G T   +YY SKE+
Sbjct  101  MFETDWEGYLWKQGHVVRSWRYRYAILSGTTF--SYYVSKEV  140

>PYIW_21108
Length=2593

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 91/206 (44%), Gaps = 14/206 (7%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            EGY+ KRG ++ T +RRY VL G   ++AYY +++  K    P+   VL   + +D   +
Sbjct  2    EGYLWKRGGLLSTMQRRYCVLKG--TMLAYYTNEDECKRQATPRD--VLEVVQARDW--D  55

Query  74   GGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSPSMESHGG  133
            G S     +K        G   Y    ++  D+  W+    +AL +   I    +E    
Sbjct  56   GASALRQHYKHAFEIDYLGGATYQCHCDSLEDKQLWMQAIQHALDEPNRIVQDEIEDAQR  115

Query  134  A----GHKESAGLMISLEAQIKNVKKTSHELL--QQAIN-DAKEADRIGDATVDEMAYQE  186
                   +E   + ++ +A +++ ++ + + L  +QA+  +A E   + +         E
Sbjct  116  RLLQDAEQEDQAMALAADA-VRSAQRLAQKALGYEQAMKENAAERHMLEEKLQHTKVLYE  174

Query  187  EVLNDAENTVDAMGKQMDRAEDLGKS  212
            E    +  T  A+G+  +RA D+  S
Sbjct  175  EAKKKSAETRQALGRARERAHDVALS  200

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 48/109 (44%), Gaps = 10/109 (9%)

Query  14    EGYVTKRGHMM-KTWKRRYMVLHGDTLLVAYYDSK----EIYKSNGPPKGSFVLSECEKQ  68
             EGYV  R H +   W+ R+ VL G  LL+ Y DS     E  +     K   +  E    
Sbjct  2157  EGYVRVRHHFLGAIWRERFAVLEGTRLLL-YTDSSAAMDEDRERTALEKHDLIAVEKWHP  2215

Query  69    DLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNAL  117
               S   GS   FGF+        GY E    V T+ +QTKWL V  +A+
Sbjct  2216  TYSANLGSGSRFGFRVENE--AGGYLE--CTVTTEDEQTKWLAVVSDAV  2260

 Score = 35.0 bits (79),  Expect = 0.80, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 6/50 (12%)

Query  14    EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGP---PKGSF  60
             EGY+ KRGH++ + ++RY VL  +  L  Y+ + E   S  P   P GSF
Sbjct  1234  EGYLVKRGHLIPSMRKRYCVLLKNASL-EYFATHE--DSRNPAIRPHGSF  1280

>HYAP_09511
Length=1295

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/101 (29%), Positives = 49/101 (49%), Gaps = 12/101 (12%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            EGY++K+  ++ +WK  Y VL  DT+  A+Y+++E + SN    G   L   E +D    
Sbjct  243  EGYLSKKSDVLVSWKATYCVLEEDTM--AFYETREDFISNMKLIGRIQLQAIEDEDAD--  298

Query  74   GGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAH  114
                KP GF+ I     +G +   +   T  ++ +W    H
Sbjct  299  ----KPNGFRLI----AEGNRINHLSSRTAFEKEQWKRAIH  331

>PHYRA_78815
Length=919

 Score = 44.7 bits (104),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 45/105 (43%), Gaps = 18/105 (17%)

Query  13   CEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSD  72
            C G++ K G  +K WKRRY  LHG TL   Y+ S      NG    SF +  C    L  
Sbjct  794  CSGWLRKEGGTVKNWKRRYFTLHGPTL--CYFKS-----DNGALLRSFTV--CHVVTLRT  844

Query  73   EGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNAL  117
                      K       +  ++ +V  ETQ D  +WL+  H A+
Sbjct  845  R---------KLCLEITTEVGRKLLVASETQADLDRWLDHLHRAI  880

 Score = 35.4 bits (80),  Expect = 0.61, Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 18/26 (69%), Gaps = 0/26 (0%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTL  39
            +G++ K G   KTWKRRYM L G ++
Sbjct  162  KGWLLKEGQNFKTWKRRYMTLTGRSI  187

 Score = 35.0 bits (79),  Expect = 0.79, Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 23/35 (66%), Gaps = 2/35 (6%)

Query  8   IHQTSCE--GYVTKRGHMMKTWKRRYMVLHGDTLL  40
           +  + C+  G+  K+G ++K+WKRRY VL G  L+
Sbjct  37  VRSSYCDHSGWGYKQGSIIKSWKRRYFVLKGRELI  71

 Score = 33.5 bits (75),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 0/27 (0%)

Query  13   CEGYVTKRGHMMKTWKRRYMVLHGDTL  39
            CEG++ KRG     W+RRY  L G  L
Sbjct  275  CEGWLYKRGQRSTEWQRRYFKLKGFKL  301

>PHYCA_564296
Length=957

 Score = 44.7 bits (104),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 51/108 (47%), Gaps = 14/108 (13%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQD--LS  71
            EG++ K+G  +K WKRR+ V  G TL  +YY S++  K    P     L  C  QD  LS
Sbjct  38   EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISRKDRK----PNAVIPLEGCTVQDGGLS  91

Query  72   DEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGK  119
            +   S + +        P  G   Y +  E  I  T+WL+V   A+ +
Sbjct  92   ETWNSPRIYLTD-----PATGIM-YCLSAEEGIVVTQWLDVLRVAVAR  133

>CCI41909
Length=282

 Score = 43.9 bits (102),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 50/114 (44%), Gaps = 16/114 (14%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            +G++ K+   +++W RRY  L+G  L   Y+DS++I +   PP+G     +       D 
Sbjct  51   KGWMRKQKETLRSWPRRYFTLNGKVL--TYFDSEDISR---PPRGVIKFIDVSSLTTEDN  105

Query  74   GGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSPS  127
            G S+            G   KE  +  +T +  + WL V   AL K      PS
Sbjct  106  GLSLH--------QASG---KEVRLIADTHVAYSAWLAVLSAALKKPESNKKPS  148

>PHYRA_82040
Length=1054

 Score = 44.7 bits (104),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 51/108 (47%), Gaps = 14/108 (13%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQD--LS  71
            EG++ K+G  +K WKRR+ V  G TL  +YY S++  K    P     L  C  QD  LS
Sbjct  143  EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISRKDRK----PNAVIPLEGCTVQDGGLS  196

Query  72   DEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGK  119
            +   S + +        P  G   Y +  E  I  T+WL+V   A+ +
Sbjct  197  ETWNSPRIYLTD-----PATGIM-YCLSAEEGIVVTQWLDVLRVAVAR  238

>SPRG_04912
Length=261

 Score = 43.9 bits (102),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 28/46 (61%), Gaps = 5/46 (11%)

Query  15  GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSF  60
           GYV K+G  +K WKRR M LH DTL   YY S+   ++   P+G F
Sbjct  43  GYVRKQGSFVKNWKRRIMALHDDTLF--YYVSE---RAMAKPRGVF  83

>PHALS_03540
Length=904

 Score = 44.7 bits (104),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 46/106 (43%), Gaps = 18/106 (17%)

Query  13   CEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSD  72
            C G++ K G  +K WKRRY  LHG TL   Y+ S      NG    SF +  C    L  
Sbjct  786  CSGWLRKEGGTVKNWKRRYFTLHGATL--CYFKS-----DNGALLRSFTV--CHVVTLRT  836

Query  73   EGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALG  118
            +         +       +  ++ +V  ETQ D  +WL+  H A+ 
Sbjct  837  K---------RLCLEITTEVGRKLLVASETQADLDRWLDHLHRAIA  873

 Score = 36.2 bits (82),  Expect = 0.30, Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 38/107 (36%), Gaps = 17/107 (16%)

Query  13   CEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSD  72
            CEG++ KRG     W+RRY +L G  L       + I+K  G   G  +   C       
Sbjct  272  CEGWLYKRGQRSTEWQRRYFILKGYQLQYQDGPGESIHKGAGTVVGLTLGEACSNSIFVQ  331

Query  73   EGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGK  119
               S                 +   V  ++QI   KW+      LGK
Sbjct  332  LSSS-----------------RVLCVSADSQISIDKWIQTICTLLGK  361

 Score = 35.8 bits (81),  Expect = 0.43, Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 18/26 (69%), Gaps = 0/26 (0%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTL  39
            +G++ K G   KTWKRRYM L G+ +
Sbjct  159  KGWLMKEGQNFKTWKRRYMTLTGNII  184

 Score = 33.5 bits (75),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 23/33 (70%), Gaps = 2/33 (6%)

Query  15  GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSK  47
           G+  K+G ++K+WKRR+ VL G  L+  Y++ +
Sbjct  46  GWGYKQGSIIKSWKRRFFVLKGRELI--YFEER  76

>CCA19118
Length=125

 Score = 42.0 bits (97),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 34/64 (53%), Gaps = 9/64 (14%)

Query  4   NLS--KIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFV  61
           NLS  +I   + EG +TKR   MK W++RY +L G+ L    Y SK     N  P G   
Sbjct  8   NLSTERIQNPAFEGELTKRSMWMKEWRKRYFILKGNKL----YFSK---SKNDAPHGFID  60

Query  62  LSEC  65
           L++C
Sbjct  61  LADC  64

>PYAP_22646
Length=815

 Score = 44.7 bits (104),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 30/42 (71%), Gaps = 2/42 (5%)

Query  8    IHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEI  49
            + +T  EGY+ K+GH++++W+ RY +L G T   +YY SK++
Sbjct  97   MFETDWEGYIWKQGHVVRSWRYRYAILSGTTF--SYYISKDV  136

>PPTG_08785
Length=944

 Score = 44.7 bits (104),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 51/108 (47%), Gaps = 14/108 (13%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQD--LS  71
            EG++ K+G  +K WKRR+ V  G TL  +YY S++  K    P     L  C  QD  LS
Sbjct  38   EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISRKDRK----PNAVIPLEGCTVQDGGLS  91

Query  72   DEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGK  119
            +   S + +        P  G   Y +  E  I  T+WL+V   A+ +
Sbjct  92   ETWNSPRIYLTD-----PATGIM-YCLSAEEGIVVTQWLDVLRVAVAR  133

>SPRG_00889
Length=994

 Score = 44.7 bits (104),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/127 (26%), Positives = 58/127 (46%), Gaps = 15/127 (12%)

Query  4    NLSKIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLS  63
            +L  + +   EG+V K+G  +  W+ RY+VL G TL   YY  +   +S    +G  VL+
Sbjct  113  DLGNVQEVHWEGHVRKKGDWLPRWEPRYLVLDGTTL--TYYSKQHDARSGKNLRGRMVLT  170

Query  64   ECEKQDLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNAL----GK  119
                  +  +  S K  GF        +G+K + +   T++++  W+ +   AL      
Sbjct  171  Y-----VGPDFKSKKAHGFMI----ETKGHKRFHLCCATELEKDMWVEMMQTALDEASSA  221

Query  120  TTYIPSP  126
            +T  P P
Sbjct  222  STKPPPP  228

>PHYKE_1044
Length=521

 Score = 44.3 bits (103),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 50/109 (46%), Gaps = 12/109 (11%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            EG++ K+G  +K WKRR+ V  G TL  +YY S++  K    P     L  C  QD    
Sbjct  38   EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISRKDRK----PNAVIPLEGCTVQD----  87

Query  74   GGSVKPFGFKFIGHC-PGQGYKEYMVFVETQIDQTKWLNVAHNALGKTT  121
            GG  + +    I    P  G   Y +  E  I  T+WL+V   A+ +  
Sbjct  88   GGLSETWNSPRIYLTDPATGIM-YCLSAEEGIVVTQWLDVLRVAVARVN  135

>H257_06698
Length=1199

 Score = 44.7 bits (104),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/118 (29%), Positives = 57/118 (48%), Gaps = 13/118 (11%)

Query  2    HVNLSKIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFV  61
            H+N   +   + EGY++K+G ++  WK  Y VL G TL  A YDS+E + ++   K   +
Sbjct  245  HMNKDSLGGIAFEGYLSKKGDLLAAWKSCYCVLEGLTL--AIYDSREDFMADVGLKVRVI  302

Query  62   LSECEKQDLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGK  119
            L E     ++D+    KP GF        +G+K   +   T  ++ +W+      L K
Sbjct  303  LLE-----VNDDVA--KPHGFAI----KTEGHKTQHLASRTAFEKEQWIRAIRLQLVK  349

>PHYSO_558498
Length=967

 Score = 44.7 bits (104),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 51/108 (47%), Gaps = 14/108 (13%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQD--LS  71
            EG++ K+G  +K WKRR+ V  G TL  +YY S++  K    P     L  C  QD  LS
Sbjct  38   EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISRKDRK----PNAVIPLEGCTVQDGGLS  91

Query  72   DEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGK  119
            +   S + +        P  G   Y +  E  I  T+WL+V   A+ +
Sbjct  92   ETWNSPRIYLTD-----PATGIM-YCLSAEEGIVVTQWLDVLRVAVAR  133

>PYIR_17453
Length=2619

 Score = 44.7 bits (104),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 54/129 (42%), Gaps = 24/129 (19%)

Query  13    CEGYVTKRGHMM-KTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDL-  70
             CEGYV  R H +   W+ R+ VL  DT L  Y D+          K        EK DL 
Sbjct  2160  CEGYVRVRHHFLGAAWRERFAVLE-DTRLYLYPDTSAALSEGREQKA------LEKHDLI  2212

Query  71    ----------SDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGK-  119
                       ++ G     FGF+        GY E  V +E +  QTKWL    NA+ + 
Sbjct  2213  AVKKWHPTYSTNLGNGSSRFGFRVENE--AGGYLECTVIIEDE--QTKWLAAITNAVSEI  2268

Query  120   TTYIPSPSM  128
             +T++ S  M
Sbjct  2269  STHVSSKVM  2277

 Score = 37.4 bits (85),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 31/54 (57%), Gaps = 7/54 (13%)

Query  10    QTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGP---PKGSF  60
             Q   EGY+ KRGH++ + ++RY VL  +TL   Y+ + E   S  P   P GSF
Sbjct  1218  QILMEGYLVKRGHLIPSMRKRYCVLVKNTL--EYFATHE--DSRNPAIRPHGSF  1267

>PITG_00020
Length=927

 Score = 44.7 bits (104),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 46/105 (44%), Gaps = 18/105 (17%)

Query  13   CEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSD  72
            C G++ K G  +K WKRRY  LHG TL   Y+ S      NG    SF +  C    L  
Sbjct  798  CSGWLRKEGGTVKNWKRRYFTLHGPTL--CYFKS-----DNGALLRSFTV--CHVVTLRT  848

Query  73   EGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNAL  117
            +         +       +  ++ +V  ETQ D  +WL+  H A+
Sbjct  849  K---------RLCLEITTEVGRKLLVASETQADLDRWLDHLHRAI  884

 Score = 33.9 bits (76),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 0/27 (0%)

Query  13   CEGYVTKRGHMMKTWKRRYMVLHGDTL  39
            CEG++ KRG     W+RRY  L G  L
Sbjct  274  CEGWLYKRGQRSTEWQRRYFKLKGFKL  300

 Score = 33.1 bits (74),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 17/26 (65%), Gaps = 0/26 (0%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTL  39
            +G++ K G   KTWKRRYM L   T+
Sbjct  161  KGWLLKEGQNFKTWKRRYMTLTERTI  186

>PYAR_24323
Length=883

 Score = 44.3 bits (103),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 49/110 (45%), Gaps = 17/110 (15%)

Query  9    HQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQ  68
            H+    GY+ KRG   +++KRRYM L+G  L  AYY  K   + NG P        CE+ 
Sbjct  150  HENDISGYLRKRGEHNRSYKRRYMELNGSVL--AYYKKKP--EKNGIPLSREDKKSCERG  205

Query  69   DLS-DEGGSVK-------PFGFKFIGHCPGQGYKEYMVFVETQIDQTKWL  110
             +  D   S++       PFG   +        + + +  E+  D  +WL
Sbjct  206  AIDLDRVTSIQPIDAKSEPFGINLV-----TTNRTWSIAAESDQDYQRWL  250

>PHYSO_350197
Length=557

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 42/91 (46%), Gaps = 12/91 (13%)

Query  27   WKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDEGGSVKPFGFKFIG  86
            WK+RY V++ D L + Y+ S E ++     +G    S     D        KP GF+F  
Sbjct  42   WKKRYCVVYKDELQIVYFLSLEDFEKRA-IRGKIPFSSVHAWD-------GKPNGFQF--  91

Query  87   HCPGQGYKEYMVFVETQIDQTKWLNVAHNAL  117
            + P      + V+ ET  DQ KWL V   AL
Sbjct  92   YTPSNNC--FRVYTETPEDQLKWLEVMQKAL  120

>CCA19033
Length=1883

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 52/116 (45%), Gaps = 15/116 (13%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            EGY+TK+ H     +RRY VL G T+L+ Y    E YKS+  P+        E  D+ D 
Sbjct  108  EGYLTKKSHRFAQMQRRYCVLKG-TMLLCYLTQDE-YKSHIVPRKVL-----EVVDVHDR  160

Query  74   GGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSPSME  129
            G S   F  + +G       + Y     +  +Q KW+N    AL +   I    +E
Sbjct  161  GHS--SFEVEQLGG------RTYFCTCTSDSNQAKWMNAMKEALEEPDRIAQEEIE  208

 Score = 38.5 bits (88),  Expect = 0.056, Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 50/107 (47%), Gaps = 8/107 (7%)

Query  14    EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
             EGY+ KRGH + + ++RY VL      + Y+++KE   ++    G   L E +  ++ D 
Sbjct  1021  EGYLLKRGHRIPSMRKRYFVLQSVNETLRYFETKE--DADSFQYGLKALGEFQIGNVCDW  1078

Query  74    GGSVKPFGFKF---IGHCPGQGYKEYMVFVETQIDQTKWLNVAHNAL  117
              G      +K    +  C G   + Y     ++ ++  W+   H+A+
Sbjct  1079  NGRTLTQTYKNGMQVEACDG---RVYFCAASSENERESWIRAFHHAI  1122

>CCI43793
Length=1117

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 24/34 (71%), Gaps = 0/34 (0%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKE  48
            GY+ K+G   K+W+RR+ +L  D  ++AYY SKE
Sbjct  175  GYLVKQGSFWKSWRRRFFILRRDIPVLAYYASKE  208

>PPTG_14630
Length=398

 Score = 43.5 bits (101),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 31/46 (67%), Gaps = 3/46 (7%)

Query  15  GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSF  60
           G+V K+G ++K WK+R+MVL G  L   YYD+ ++  +   PKGSF
Sbjct  12  GWVYKQGSLVKNWKKRFMVLSGRQL--TYYDTSKLVPTV-KPKGSF  54

 Score = 39.3 bits (90),  Expect = 0.027, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 27/39 (69%), Gaps = 2/39 (5%)

Query  10   QTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKE  48
            Q +  G++ K G  +K+WKRRY VL G+ L  +Y++S++
Sbjct  150  QVTHSGWLKKEGARVKSWKRRYFVLRGNAL--SYFNSED  186

>H310_01921
Length=341

 Score = 43.1 bits (100),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 32/46 (70%), Gaps = 3/46 (7%)

Query  15  GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSF  60
           G+V K+G M+K+WK+RYMVL    L   Y++S+++ + N   KGSF
Sbjct  24  GWVYKQGSMIKSWKKRYMVLKNKQL--TYFESEKV-EGNSKAKGSF  66

 Score = 37.4 bits (85),  Expect = 0.095, Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 5/47 (11%)

Query  13   CEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGS  59
            C G++ K G  +K WKRRY  L G +L   Y+D+  +    G  KG+
Sbjct  164  CFGWLAKEGGRVKNWKRRYFSLQGRSL--TYFDNANM---TGAAKGN  205

>PYAP_19753
Length=1340

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 35/117 (30%), Positives = 53/117 (45%), Gaps = 16/117 (14%)

Query  1    MHVNLSKI-HQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGS  59
            M    SKI H+    GY+ KRG   +++KRRYM L+G TL  +YY  K       P K  
Sbjct  145  MDSQTSKITHENDISGYLRKRGEHNRSYKRRYMELNGATL--SYYKKK-------PEKNG  195

Query  60   FVLSECEKQDLS------DEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWL  110
              LS  +K+         D   S++P   +  G       + + +  E++ D  +WL
Sbjct  196  IPLSRDDKKSYERGSIDLDRVSSIQPIDSEPFGMHLVTTTRTWAISAESEQDFLRWL  252

>CCI45127
Length=202

 Score = 42.4 bits (98),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/74 (30%), Positives = 38/74 (51%), Gaps = 0/74 (0%)

Query  149  QIKNVKKTSHELLQQAINDAKEADRIGDATVDEMAYQEEVLNDAENTVDAMGKQMDRAED  208
            Q+K +K    + + +A+   + A   G A  DE+  Q E L   E  +  +   ++ +E 
Sbjct  20   QVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQLGKVEQNLSNIESDLNHSEK  79

Query  209  LGKSIKHPILYKFT  222
            L KSI+HP+ Y F+
Sbjct  80   LIKSIRHPLRYFFS  93

>PYU1_G004386
Length=837

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 30/42 (71%), Gaps = 2/42 (5%)

Query  8    IHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEI  49
            + +T  EGY+ K+GH++++W+ RY +L G T   +YY SK++
Sbjct  133  MFETDWEGYLWKQGHVVRSWRYRYAILSGTTF--SYYVSKDV  172

>PYAP_16161
Length=889

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 47/106 (44%), Gaps = 10/106 (9%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            EGY+ K+G M+K WK+R+ V  G TL  +YY S+   K    P     L  C  +D    
Sbjct  30   EGYLQKKGQMLKGWKQRWFVCDGRTL--SYYGSRRDSK----PSVVMELKYCTVED----  79

Query  74   GGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGK  119
            GG  + +    I          Y +  E     T+WL V  N +G+
Sbjct  80   GGRSETWNSTRIHLTDSATGTLYCLSSEDGQIATEWLTVLKNCIGR  125

>PITG_02109
Length=522

 Score = 43.5 bits (101),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 31/46 (67%), Gaps = 3/46 (7%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSF  60
            G+V K+G ++K WK+R+MVL G  L   YYD+ ++  +   PKGSF
Sbjct  138  GWVYKQGSLVKNWKKRFMVLSGRQL--TYYDTSKLNPTVK-PKGSF  180

 Score = 38.5 bits (88),  Expect = 0.058, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 25/34 (74%), Gaps = 2/34 (6%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKE  48
            G++ K G  +K+WKRRY VL G+ L  +Y++S++
Sbjct  281  GWLKKEGARVKSWKRRYFVLRGNAL--SYFNSED  312

>H257_13567
Length=836

 Score = 43.5 bits (101),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 27/35 (77%), Gaps = 2/35 (6%)

Query  14  EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKE  48
           EG+V K+GH+++ WK RY  L G+  L++YY++KE
Sbjct  61  EGFVQKKGHLVRNWKVRYFTLEGN--LLSYYETKE  93

>PYVX_13084
Length=1267

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 24/34 (71%), Gaps = 0/34 (0%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKE  48
            GY+ K+G   KTW+RRY VL  D  +++Y+ SK+
Sbjct  242  GYLVKQGSFWKTWRRRYFVLRRDLPVMSYFSSKD  275

>PYIW_21526
Length=963

 Score = 43.5 bits (101),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 39/135 (29%), Positives = 53/135 (39%), Gaps = 12/135 (9%)

Query  9    HQTSC--EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECE  66
            +  SC  EGY+ K+G  +K WKRR+ V    TL  AYY    I + +  P     L  C 
Sbjct  31   YDPSCMKEGYLQKKGQRLKGWKRRWFVCDARTL--AYY----INRKDRKPNAVIPLEGCT  84

Query  67   KQDLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSP  126
             QD    GG  + +    I          Y +  E      +WL V  NA  K       
Sbjct  85   VQD----GGLSETWNSPRIYLTDAASGVMYCLSAEDGEAVAQWLTVLRNAATKVNGTDPS  140

Query  127  SMESHGGAGHKESAG  141
             + S+G +    S G
Sbjct  141  DLLSNGSSVTNASNG  155

>H310_08803
Length=916

 Score = 43.5 bits (101),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 31/48 (65%), Gaps = 3/48 (6%)

Query  15  GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVL  62
           G+V K+G  +KTWK+RYMVL G    + YYD K + + N   KG+ VL
Sbjct  10  GWVYKQGSRVKTWKKRYMVLQGRH--ITYYD-KSVLEPNPIEKGALVL  54

 Score = 36.6 bits (83),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 20/31 (65%), Gaps = 2/31 (6%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYY  44
            EG++ K G  MK WKRRY +L G  L+  YY
Sbjct  688  EGWMLKEGSKMKNWKRRYFILKGTELM--YY  716

 Score = 36.6 bits (83),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 23/35 (66%), Gaps = 1/35 (3%)

Query  11   TSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYD  45
            TS  G++ K G  +K+WKRRY  LH D +LV + D
Sbjct  453  TSHSGWLQKEGKSIKSWKRRYFTLH-DRMLVYHKD  486

 Score = 35.8 bits (81),  Expect = 0.43, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 20/31 (65%), Gaps = 2/31 (6%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYY  44
             G++ K G  ++ WKRRY VL GD L  AYY
Sbjct  239  RGWLHKEGQHVRNWKRRYFVLTGDHL--AYY  267

>CCA22329
Length=935

 Score = 43.5 bits (101),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 51/219 (23%), Positives = 100/219 (46%), Gaps = 33/219 (15%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            EGY+ K+  ++K+W  RY+ LH + + V  Y SK    + GP +GS+++S+   +  S  
Sbjct  120  EGYLYKQRKLVKSWTPRYVTLHDNAIKV--YKSKSHAIAKGPVRGSWLISQINSELPSTG  177

Query  74   GGSVK--P--FGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSPSME  129
             G+ K  P   GF  +      G + +++   + + +  W++    ++ +T  + +P  +
Sbjct  178  FGAAKLQPDVCGFTIVA---TDGSQIHLI-AWSPLVKAMWMHTVQLSVPQTDRVVTPRKK  233

Query  130  SHGGAGHKESAGLMISLEAQIKNVKKTSHELLQQAINDAKEADRIGDATVDEMAYQEEVL  189
            S+    H     L    + QI+           Q++N     +   ++T    + Q+ VL
Sbjct  234  SY--LSHLSGTHL---FDTQIR-----------QSLN---SNELTAESTKSTESEQDSVL  274

Query  190  NDAENTVDAMGK-QMDRAEDLGKS--IKHPILYKFTHIF  225
            N  +N  +A  K  + RAE    +  + H   YKF ++ 
Sbjct  275  N-RDNFSNASNKSSVSRAESAESNTLLAHRFFYKFVYLL  312

>PYIR_22246
Length=559

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 28/91 (31%), Positives = 45/91 (49%), Gaps = 12/91 (13%)

Query  27   WKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDEGGSVKPFGFKFIG  86
            WK+RY V++ ++L + Y+ S+  Y+  G  +G    S   K D        KP GF+F  
Sbjct  43   WKKRYCVIYKESLQIVYFQSEADYE-KGTIRGKIPFSTVHKWD-------GKPNGFQF--  92

Query  87   HCPGQGYKEYMVFVETQIDQTKWLNVAHNAL  117
            + P    K + V+ ET  +Q +WL     A+
Sbjct  93   YTPSN--KCFRVYTETAEEQEQWLAAMQTAI  121

>PYIW_17818
Length=1188

 Score = 43.5 bits (101),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 0/27 (0%)

Query  13   CEGYVTKRGHMMKTWKRRYMVLHGDTL  39
            C G++ K G  +KTWKRRY  LHG TL
Sbjct  830  CSGWLNKEGGTIKTWKRRYFSLHGTTL  856

 Score = 42.0 bits (97),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 25/32 (78%), Gaps = 2/32 (6%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDS  46
            G++ K+G ++K+WKRRY VL GD+L   Y+D+
Sbjct  505  GWLLKQGSLIKSWKRRYFVLEGDSL--QYFDN  534

 Score = 37.4 bits (85),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 19/29 (66%), Gaps = 0/29 (0%)

Query  11   TSCEGYVTKRGHMMKTWKRRYMVLHGDTL  39
            ++CEG++ K+G   K WKRRY  L  D L
Sbjct  343  STCEGWLLKQGRASKQWKRRYFSLAHDQL  371

 Score = 36.6 bits (83),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 18/57 (32%), Positives = 32/57 (56%), Gaps = 6/57 (11%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLS  71
            G++ K G  +K+WK+R+ VL G+ L   YY+ +     + P  G+ V+ + E   L+
Sbjct  179  GWLLKEGSKVKSWKKRFFVLRGNVL--TYYEDER----SSPKLGALVVRDVETNFLT  229

 Score = 36.2 bits (82),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 35/132 (27%), Positives = 52/132 (39%), Gaps = 20/132 (15%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            EG++ K+G   KTWK+RY VL    L+    D+K     +G   GS V+ E         
Sbjct  627  EGWLFKKGQNFKTWKQRYFVLERTRLVYYASDAK-----DGELLGSGVVFEVAV------  675

Query  74   GGSVKPF--GFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSPSMESH  131
             G  +P     +F      Q  +   V    Q+    WL+   NA   T    S   E +
Sbjct  676  -GDARPLCVDVRF------QNGRLLQVVAPDQLQFELWLHALQNASNLTESFLSQHDEGN  728

Query  132  GGAGHKESAGLM  143
             G  ++ S  + 
Sbjct  729  AGDNNRSSNAVF  740

 Score = 35.8 bits (81),  Expect = 0.38, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 19/38 (50%), Gaps = 0/38 (0%)

Query  3    VNLSKIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLL  40
            VNL     TS  G++ K G   KTWKRRY       LL
Sbjct  935  VNLDGKTVTSYSGWLEKEGQRFKTWKRRYFTYKKGALL  972

 Score = 33.9 bits (76),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 18/48 (38%), Positives = 26/48 (54%), Gaps = 6/48 (13%)

Query  15  GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVL  62
           G+ +K+G  +KTWK+R+ VL G  L+  YY       S G  KG   +
Sbjct  10  GWGSKQGSKVKTWKKRFFVLRGRELV--YYSG----SSGGDEKGRLTI  51

>PYAP_13695
Length=348

 Score = 42.7 bits (99),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 31/53 (58%), Gaps = 3/53 (6%)

Query  8   IHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSF  60
           +H     G++ K+G ++K WKRR+MVL G  L   YYD++ I       KGSF
Sbjct  5   MHGGEYAGWIYKQGSLVKNWKRRFMVLRGKQL--TYYDTERI-SPRVKEKGSF  54

 Score = 41.6 bits (96),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query  10   QTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKE  48
            Q    G++TK G  +K WKRR+  L GDTL  +Y+DS +
Sbjct  151  QVQHSGWLTKEGMRVKNWKRRWFTLRGDTL--SYFDSAD  187

>SDRG_05150
Length=787

 Score = 42.7 bits (99),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 25/41 (61%), Gaps = 2/41 (5%)

Query  8   IHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKE  48
           I  T  EGY+ K+GH+++ W+ RY VL G      YY SKE
Sbjct  29  IMDTDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKE  67

>SPRG_08346
Length=797

 Score = 42.7 bits (99),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 25/41 (61%), Gaps = 2/41 (5%)

Query  8   IHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKE  48
           I  T  EGY+ K+GH+++ W+ RY VL G      YY SKE
Sbjct  29  IMDTDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKE  67

>H257_03363
Length=316

 Score = 42.4 bits (98),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 32/46 (70%), Gaps = 3/46 (7%)

Query  15  GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSF  60
           G+V K+G M+K+WK+RYMVL    L   Y+++++I + N   KGSF
Sbjct  8   GWVYKQGSMVKSWKKRYMVLKNKQL--TYFENEKI-EGNSKAKGSF  50

 Score = 37.0 bits (84),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 14/37 (38%), Positives = 22/37 (59%), Gaps = 2/37 (5%)

Query  13   CEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEI  49
            C G++ K G  ++ WKRRY  L G +L   Y+D+  +
Sbjct  147  CTGWLAKEGGRVRNWKRRYFSLQGRSL--TYFDNANM  181

>SPRG_11900
Length=605

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 33/49 (67%), Gaps = 3/49 (6%)

Query  14  EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVL  62
            G+V K+G ++K+WK+R++V+ G    V YYD + +++ N   KGS VL
Sbjct  6   SGFVFKQGALIKSWKKRFLVVQGRH--VTYYD-RSVHEPNPREKGSLVL  51

 Score = 37.7 bits (86),  Expect = 0.099, Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 55/130 (42%), Gaps = 22/130 (17%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKG-SFVLSECEKQDLSDE  73
            GY+ K+G  +K W++RY  + G +  ++Y D+        PPKG   V+  C        
Sbjct  239  GYLLKKGRTVKAWRKRYFSIDGVSNQLSYSDAD-----GAPPKGFGHVVDVCVNTK----  289

Query  74   GGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSPSME-SHG  132
                +PF   +I    G   +   V   TQ +   WL V  +       +P   ++ SH 
Sbjct  290  ----RPFAL-YIHLASG---RRLAVAGSTQAEADTWLAVLEDIAAD---VPMQCVDGSHM  338

Query  133  GAGHKESAGL  142
            G   KE +G+
Sbjct  339  GWLQKEGSGV  348

 Score = 34.3 bits (77),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 19/26 (73%), Gaps = 0/26 (0%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLL  40
            G++ K G  +K+WKRR+  LHG +L+
Sbjct  339  GWLQKEGSGVKSWKRRFFTLHGRSLV  364

 Score = 33.9 bits (76),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (65%), Gaps = 2/31 (6%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYY  44
             G++ K G  ++ WKRR+ VL GD   VAY+
Sbjct  143  RGWLYKEGQRVRNWKRRFFVLTGDH--VAYF  171

>H310_07701
Length=811

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 26/41 (63%), Gaps = 2/41 (5%)

Query  8   IHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKE  48
           + +T  EGYV K+GH+++ W+ RY +L G      YY SKE
Sbjct  47  LFETDWEGYVWKQGHVVRNWRNRYGILTGTCF--TYYSSKE  85

>PYIR_13555
Length=355

 Score = 42.0 bits (97),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 30/44 (68%), Gaps = 5/44 (11%)

Query  5    LSKIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKE  48
            ++ IH +   G++ K G  +K+WK+RY  LHG+TL  +YYDS +
Sbjct  153  VAGIHHS---GWLKKEGSRVKSWKKRYFTLHGNTL--SYYDSAD  191

 Score = 40.8 bits (94),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 29/46 (63%), Gaps = 3/46 (7%)

Query  15  GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSF  60
           G+V K+G +++ WK+RYMVL G  L   YYD+  +  +    KGSF
Sbjct  10  GWVFKQGSLVRNWKKRYMVLRGKQL--TYYDTASL-TAKTKEKGSF  52

>PHALS_11367
Length=1329

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 52/113 (46%), Gaps = 12/113 (11%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            EGY++K+  ++ +WK  Y VL  DTL  A+Y+++E + SN    G   L   E +++   
Sbjct  259  EGYLSKKSDVLMSWKATYCVLEEDTL--AFYETREDFISNSKLIGRIQLQAIEDEEMG--  314

Query  74   GGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSP  126
                KP GF         G+  +M    T  ++ +W      A+ K   +  P
Sbjct  315  ----KPNGFCVTAE---GGHVSHMS-SRTAFEKEQWKRAISIAISKVPEVARP  359

>H257_10913
Length=1650

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 57/120 (48%), Gaps = 14/120 (12%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            EG++ K+GH+  T K RY VL+ D  LV   D K+  +     KGS VL+  +       
Sbjct  31   EGWLRKKGHLFATIKSRYFVLYADGHLVYLNDVKKKKQ-----KGSVVLAMSDIVAPHPT  85

Query  74   GGSVKPFGF---KFIGHCPGQGYKEYMV--FVETQIDQTKWLNVAHNALGKTTYIPSPSM  128
              + K FGF   K          K Y +  F  T +++++W+    +A+ + T +  PSM
Sbjct  86   KKNDKLFGFDLKKAATSSDLNATKPYTLTMFALTSVERSEWI----DAIRRVTTMQYPSM  141

>H257_07514
Length=810

 Score = 42.4 bits (98),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 26/41 (63%), Gaps = 2/41 (5%)

Query  8   IHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKE  48
           + +T  EGYV K+GH+++ W+ RY +L G      YY SKE
Sbjct  47  LFETDWEGYVWKQGHVVRNWRNRYGILTGTCF--TYYSSKE  85

>PHALS_06568
Length=388

 Score = 42.0 bits (97),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 30/45 (67%), Gaps = 3/45 (7%)

Query  15  GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGS  59
           G+V K+G ++K+WK+RYMVL G  L   YYD+ ++      PKGS
Sbjct  12  GWVYKQGSIVKSWKKRYMVLSGRQL--TYYDTAKV-DQKVKPKGS  53

 Score = 37.7 bits (86),  Expect = 0.092, Method: Compositional matrix adjust.
 Identities = 22/71 (31%), Positives = 41/71 (58%), Gaps = 5/71 (7%)

Query  10   QTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKE---IYKSNGPPKGSFVLSECE  66
            Q +  G++ K G  +K+W+RR+ VL G++L  +Y++S++   I K +G  +   V +   
Sbjct  148  QVTHSGWLKKEGARVKSWRRRFFVLRGNSL--SYFNSEDTGAIAKGSGDVRAVEVNTINN  205

Query  67   KQDLSDEGGSV  77
              D+S + G V
Sbjct  206  GLDISFDTGRV  216

>PHYRA_73432
Length=1313

 Score = 42.4 bits (98),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 45/104 (43%), Gaps = 22/104 (21%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSN--GPPKGSFVLSECEKQDLSD  72
            G++ K+G   KTWKRRY VL    L          Y +N  G   GS V+ E E      
Sbjct  520  GWLLKKGQNFKTWKRRYFVLESSRL---------AYSANAGGEVLGSGVVFEVEV-----  565

Query  73   EGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNA  116
              G+++PF      +   Q  +   V   TQ   +KW +V  NA
Sbjct  566  --GNLRPFSL----NIRFQNGRLLHVVAPTQESFSKWFDVLRNA  603

 Score = 38.5 bits (88),  Expect = 0.062, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 24/36 (67%), Gaps = 2/36 (6%)

Query  13   CEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKE  48
            C G++ K G  +K+WKRRY  L+G  L  +YY S++
Sbjct  713  CVGWLKKEGGNVKSWKRRYFTLYGSKL--SYYKSEK  746

 Score = 33.9 bits (76),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 0/27 (0%)

Query  13   CEGYVTKRGHMMKTWKRRYMVLHGDTL  39
            CEG++ K G   K WK+RYM L    L
Sbjct  239  CEGWLEKLGQSSKVWKKRYMSLANGML  265

 Score = 33.1 bits (74),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 17/30 (57%), Gaps = 2/30 (7%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYY  44
            G++ K G   KTWKRRY  L    L+  YY
Sbjct  835  GWLQKEGQRFKTWKRRYFTLKKSALI--YY  862

 Score = 32.7 bits (73),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 19/30 (63%), Gaps = 2/30 (7%)

Query  15  GYVTKRGHMMKTWKRRYMVLHGDTLLVAYY  44
           G+  K+G  ++TWK RY VL G  L+  YY
Sbjct  7   GWGAKQGSKVRTWKNRYFVLRGRELV--YY  34

>PYU1_G012870
Length=352

 Score = 42.0 bits (97),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 24/34 (71%), Gaps = 2/34 (6%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKE  48
            G++ K G  +K WK+RY  LHG+TL  +YYDS +
Sbjct  154  GWLKKEGSRIKNWKKRYFTLHGNTL--SYYDSAD  185

 Score = 40.0 bits (92),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (58%), Gaps = 3/52 (6%)

Query  15  GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECE  66
           G+V K+G +++ WK+R+MVL G  L   YYD+  I       KGSF +   E
Sbjct  7   GWVFKQGSLVRNWKKRFMVLRGKQL--TYYDTASI-SPKTKEKGSFQVITAE  55

>SDRG_06288
Length=641

 Score = 42.0 bits (97),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 36/54 (67%), Gaps = 3/54 (6%)

Query  15  GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQ  68
           G+V K+G ++K+WK+R++V+ G    V+YYD + +++ +   KGS VL +  + 
Sbjct  7   GFVFKQGSLIKSWKKRFLVVQGRH--VSYYD-RSVHEPDPREKGSLVLGDVTQN  57

 Score = 38.1 bits (87),  Expect = 0.063, Method: Compositional matrix adjust.
 Identities = 30/121 (25%), Positives = 50/121 (41%), Gaps = 24/121 (20%)

Query  12   SCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLS  71
            S  G++ K G  +K+WKRR+  LHG T+L  Y  S +       P G  V++        
Sbjct  360  SHHGWLQKEGSGVKSWKRRFFTLHGRTIL--YRKSLD-----AAPLGDGVVTSVAP----  408

Query  72   DEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSPSMESH  131
               G+ + F    +        +  +V   +  DQ  WL+   + L      P P++ + 
Sbjct  409  ---GTARAFAIDIVLASG----RVLVVAANSARDQELWLSALRDPL------PPPTLATK  455

Query  132  G  132
            G
Sbjct  456  G  456

 Score = 34.7 bits (78),  Expect = 0.80, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (65%), Gaps = 2/31 (6%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYY  44
             G++ K G  ++ WKRRY VL GD   +AY+
Sbjct  167  RGWLYKEGQRVRNWKRRYFVLTGDH--IAYF  195

 Score = 31.2 bits (69),  Expect = 9.9, Method: Compositional matrix adjust.
 Identities = 14/44 (32%), Positives = 25/44 (57%), Gaps = 5/44 (11%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKG  58
            G + K+G  +K W++RY  + G +  ++Y D++       PPKG
Sbjct  263  GILLKKGRTVKAWRKRYFSIDGVSNQLSYSDAE-----TEPPKG  301

>HYAP_07348
Length=973

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 50/108 (46%), Gaps = 14/108 (13%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQD--LS  71
            EG++ K+G  +K WKRR+ V  G TL  +YY SK+  K    P     L  C  +D  LS
Sbjct  40   EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISKKDRK----PNAVIPLEGCSVEDGGLS  93

Query  72   DEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGK  119
            +   S + +        P  G   Y +  E     T+WL+V   A+ +
Sbjct  94   ETWNSPRIYLTD-----PATGIM-YCLSAEEGTVVTQWLHVLRAAVAR  135

>HYAP_11712
Length=558

 Score = 42.0 bits (97),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 28/94 (30%), Positives = 41/94 (44%), Gaps = 18/94 (19%)

Query  27   WKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDEGGSVKPFGFKFI-  85
            WK+RY V++ + L + Y+ S E ++     +G    S     D        KP GF+F  
Sbjct  42   WKKRYCVIYANELQIVYFLSLEDFERRT-IRGKIPFSSVHAWD-------GKPNGFQFYT  93

Query  86   --GHCPGQGYKEYMVFVETQIDQTKWLNVAHNAL  117
               HC       + V+ ET  DQ KWL V    +
Sbjct  94   PADHC-------FRVYTETAADQLKWLEVMQKCI  120

>PHYKE_5588
Length=751

 Score = 42.0 bits (97),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 22/37 (59%), Gaps = 2/37 (5%)

Query  13   CEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEI  49
            C G++ K G  +K WKRRY  LHG TL   Y+ S  +
Sbjct  441  CSGWLRKEGGTVKNWKRRYFTLHGPTL--CYFKSDNV  475

 Score = 35.8 bits (81),  Expect = 0.42, Method: Compositional matrix adjust.
 Identities = 14/27 (52%), Positives = 17/27 (63%), Gaps = 0/27 (0%)

Query  13   CEGYVTKRGHMMKTWKRRYMVLHGDTL  39
            CEG++ KRG     W+RRY  L G TL
Sbjct  252  CEGWLYKRGQRSTEWQRRYFKLKGFTL  278

 Score = 35.4 bits (80),  Expect = 0.46, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 0/29 (0%)

Query  11   TSCEGYVTKRGHMMKTWKRRYMVLHGDTL  39
             S +G++ K G   KTWKRRYM L   T+
Sbjct  136  VSMQGWLLKEGQNFKTWKRRYMTLRDRTI  164

>PYAP_22685
Length=1104

 Score = 42.0 bits (97),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 35/131 (27%), Positives = 57/131 (44%), Gaps = 13/131 (10%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDEG  74
            G++TK+GH+ K WK R+ VL  D  L AYY +K   +  G  K +  +   +  D+    
Sbjct  149  GWLTKQGHVWKNWKNRFFVLFHDGTL-AYYKAKGKRRMKGCMKLNEGVVSVQHVDIRR--  205

Query  75   GSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSPSMESHGGA  134
             S K + F+       +GY        +Q++   W+    NAL K      P  E     
Sbjct  206  -STKAYVFQV-----EKGYYRMWCCCCSQLEAELWV----NALRKVRQCSPPCFEPLLTV  255

Query  135  GHKESAGLMIS  145
              ++  GL ++
Sbjct  256  HEEQFGGLAVN  266

>PYU1_G009178
Length=336

 Score = 41.6 bits (96),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 24/81 (30%), Positives = 42/81 (52%), Gaps = 13/81 (16%)

Query  1    MHVNLSKIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNG------  54
            M++ + ++  T+  G++ K+G   KTWK+R+ +LHG  L   YY    +  S+       
Sbjct  78   MNIPMQELKGTAYYGWLWKKGSSFKTWKKRFFLLHGRAL--TYYTQTCVIASDALGTQCL  135

Query  55   --PPKGSFVLSECEKQDLSDE  73
              P KG   +   ++ +LSDE
Sbjct  136  DVPAKGGLRV---QRVELSDE  153

>PHALS_05587
Length=1361

 Score = 42.0 bits (97),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 56/128 (44%), Gaps = 14/128 (11%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDEG  74
            G++ K+GHM K+WK R+ VL  D  +V YY +K   K  G    +  +   +  D+   G
Sbjct  139  GWLKKQGHMWKSWKARFFVLFSDGTVV-YYKNKSRKKIKGYMHLNDGVVSVQHVDIRVAG  197

Query  75   GSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSPSMESHGGA  134
               K + F+       +G+   +    +QID   W+     AL     +  P  E +  A
Sbjct  198  ---KAYVFQI-----EKGFYRLLCHCSSQIDAELWV----TALRSVRKVAPPCFEMNLTA  245

Query  135  GHKESAGL  142
              +E AG 
Sbjct  246  -REEKAGF  252

>SDRG_02135
Length=306

 Score = 41.2 bits (95),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 24/33 (73%), Gaps = 2/33 (6%)

Query  14  EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDS  46
           EGY+ K+GH++K W+RRY  L   +L  AYYDS
Sbjct  2   EGYLLKQGHVVKNWRRRYFRLVDASL--AYYDS  32

>PITG_03652
Length=710

 Score = 41.6 bits (96),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 48/103 (47%), Gaps = 9/103 (9%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            +G++ K G   KTW  R+ VL  D +L +YY  + + K     KGS  +    K D+S +
Sbjct  232  QGWLEKCGQQFKTWNWRFFVLRNDGVL-SYYVDETLKKL----KGSIDIGYGSKADVSVQ  286

Query  74   GGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNA  116
              S+    F F+   P    +  M+   TQ   TKW+   H A
Sbjct  287  TNSMDK-NFVFVIATP---QRNLMISAPTQRMMTKWIARLHAA  325

>PHYCA_504801
Length=398

 Score = 41.2 bits (95),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 32/52 (62%), Gaps = 3/52 (6%)

Query  15  GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECE  66
           G+V K+G ++K WK+R+MVL G  L   YYD+ ++  +    KGSF +   E
Sbjct  12  GWVYKQGSLVKNWKKRFMVLRGRQL--TYYDTAKVNPTT-KAKGSFQVITVE  60

 Score = 39.3 bits (90),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 27/39 (69%), Gaps = 2/39 (5%)

Query  10   QTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKE  48
            Q +  G++ K G  +K+WKRRY VL G+ L  +Y++S++
Sbjct  151  QVTHSGWLKKEGARVKSWKRRYFVLRGNAL--SYFNSED  187

>SPRG_08532
Length=1292

 Score = 41.6 bits (96),  Expect = 0.006, Method: Composition-based stats.
 Identities = 28/99 (28%), Positives = 49/99 (49%), Gaps = 11/99 (11%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSE-CEKQDLSD  72
            EG++ KRGH   TWK R+ VL+ D  LV YY + ++ K     KG   L +   K   +D
Sbjct  84   EGWLVKRGHNWHTWKTRWFVLYRDARLV-YYRNPKLKKV----KGCLRLDDGIVKVQFAD  138

Query  73   EGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLN  111
               + + + F+ +     +GY        T+++  +W++
Sbjct  139  TYQTKRKYSFQVV-----KGYYVLFCSCTTKVEADEWVH  172

>SDRG_06342
Length=1292

 Score = 41.6 bits (96),  Expect = 0.006, Method: Composition-based stats.
 Identities = 28/99 (28%), Positives = 49/99 (49%), Gaps = 11/99 (11%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSE-CEKQDLSD  72
            EG++ KRGH   TWK R+ VL+ D  LV YY + ++ K     KG   L +   K   +D
Sbjct  84   EGWLVKRGHNWHTWKTRWFVLYRDARLV-YYRNPKLKKV----KGCLRLDDGIVKVQFAD  138

Query  73   EGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLN  111
               + + + F+ +     +GY        T+++  +W++
Sbjct  139  TYQTKRKYSFQVV-----KGYYVLFCSCTTKVEADEWVH  172

>SPRG_02753
Length=309

 Score = 41.2 bits (95),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 33/49 (67%), Gaps = 3/49 (6%)

Query  14  EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVL  62
           +G+V K+G ++++WK+RYMVL    L  +Y+D++ +  S    KGSF +
Sbjct  7   QGWVFKQGSLVRSWKKRYMVLKNKQL--SYFDTENVTAST-KAKGSFAV  52

 Score = 38.9 bits (89),  Expect = 0.032, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 36/69 (52%), Gaps = 6/69 (9%)

Query  13   CEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEI---YKSNGPPKGSFVLSE-CEKQ  68
            C G++ K G  +K WKRR+  L G +L   YYD+ ++    K NG   G  V  E  +  
Sbjct  138  CSGWLAKEGGRVKNWKRRFFFLQGRSL--TYYDNDKMAGSAKGNGQVCGVRVNREKSQSL  195

Query  69   DLSDEGGSV  77
            D++ E G +
Sbjct  196  DITFEKGRI  204

>SDRG_01408
Length=916

 Score = 41.6 bits (96),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 28/114 (25%), Positives = 53/114 (46%), Gaps = 11/114 (10%)

Query  4    NLSKIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLS  63
            ++  + +   EG+V K+G  +  W+ RY+VL G TL   YY  +   +S    +G  VL+
Sbjct  115  DIGNVQEVHWEGHVRKKGDWLPRWEPRYLVLDGTTL--TYYSKQHDARSGKNLRGRMVLT  172

Query  64   ECEKQDLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNAL  117
                  +  +    K  GF        +G+K + +   T++++  W+ +   AL
Sbjct  173  Y-----VGPDFKGKKAHGFMI----ETKGHKRFHLCCATELEKDMWVEMMQTAL  217

>H257_06469
Length=76

 Score = 38.1 bits (87),  Expect = 0.006, Method: Composition-based stats.
 Identities = 15/30 (50%), Positives = 22/30 (73%), Gaps = 0/30 (0%)

Query  14  EGYVTKRGHMMKTWKRRYMVLHGDTLLVAY  43
           EGYV K+GH++K+W+RRY  L   T ++ Y
Sbjct  2   EGYVFKQGHVVKSWQRRYFRLDTSTSVLEY  31

>SDRG_14486
Length=308

 Score = 40.8 bits (94),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 33/49 (67%), Gaps = 3/49 (6%)

Query  14  EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVL  62
           +G+V K+G ++++WK+RYMVL    L  +Y+D++ +  S    KGSF +
Sbjct  7   QGWVFKQGSLVRSWKKRYMVLKNKQL--SYFDTENVTAST-KAKGSFAV  52

 Score = 39.3 bits (90),  Expect = 0.024, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 36/69 (52%), Gaps = 6/69 (9%)

Query  13   CEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEI---YKSNGPPKGSFVLSE-CEKQ  68
            C G++ K G  +K WKRR+  L G +L   YYD+ ++    K NG   G  V  E  +  
Sbjct  137  CSGWLAKEGGRVKNWKRRFFFLQGRSL--TYYDNDKMAGSAKGNGQVCGVRVNREKAQSL  194

Query  69   DLSDEGGSV  77
            D++ E G +
Sbjct  195  DITFEKGRI  203

>SPRG_13975
Length=331

 Score = 41.2 bits (95),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 48/107 (45%), Gaps = 21/107 (20%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDEG  74
            G++ K+    KTW RR+ VL  +T +++YYDS+++ +    P+G+             E 
Sbjct  21   GWMKKQKLHFKTWSRRFFVLTANTRVMSYYDSEDLRQ----PRGTL------------EV  64

Query  75   GSVKPFGFKFIG---HCPGQGYKEYMVFVETQIDQTKWLNVAHNALG  118
             SV P   +  G   HC     KE  +  +T +    W  V   A+ 
Sbjct  65   LSVHPLPGESNGLSLHCASG--KEEKLICDTNVAYNAWFAVLTRAVN  109

>PHYKE_9146
Length=557

 Score = 41.2 bits (95),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 43/99 (43%), Gaps = 12/99 (12%)

Query  19   KRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDEGGSVK  78
            K  H    WK+RY V++ D L + Y+ S E ++     +G    S     D        K
Sbjct  34   KPEHNSLLWKKRYCVVYKDELQITYFLSLEDFEKRS-IRGKIPFSSVHAWD-------GK  85

Query  79   PFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNAL  117
            P GF+F  + P      + V+ ET  DQ KWL V    L
Sbjct  86   PNGFQF--YTPSNTC--FRVYTETAEDQLKWLEVMQKVL  120

>SDRG_07012
Length=331

 Score = 40.8 bits (94),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 48/107 (45%), Gaps = 21/107 (20%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDEG  74
            G++ K+    KTW RR+ VL  +T +++YYDS+++ +    P+G+             E 
Sbjct  21   GWMKKQKLHFKTWSRRFFVLTANTRVMSYYDSEDLRQ----PRGTL------------EV  64

Query  75   GSVKPFGFKFIG---HCPGQGYKEYMVFVETQIDQTKWLNVAHNALG  118
             SV P   +  G   HC     KE  +  +T +    W  V   A+ 
Sbjct  65   LSVHPLPGESNGLSLHCASG--KEEKLICDTNVAYNAWFAVLTRAVN  109

>PHYSO_533422
Length=721

 Score = 41.2 bits (95),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 32/124 (26%), Positives = 58/124 (47%), Gaps = 21/124 (17%)

Query  14   EGYVTKR---GHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLS-ECEKQD  69
            EG++ KR   G ++  W+RRY  L    LL  YY + +    +  P+  + L+ +     
Sbjct  9    EGWLMKRSRSGRVVANWRRRYFRLTRTELL--YYKAPQ----DPAPRRRYELTLDSNVLR  62

Query  70   LSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYI-----P  124
             +D+G    P  F F    P  G   + +  E ++++ +WL+  +NA  +T  +     P
Sbjct  63   TNDQG---YPLCFVFQ---PAPGQPSFYMQAENEVEKDEWLSAIYNAYRRTPDVAQQQPP  116

Query  125  SPSM  128
            +P M
Sbjct  117  APEM  120

>HYAP_14013
Length=398

 Score = 41.2 bits (95),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 46/106 (43%), Gaps = 18/106 (17%)

Query  13   CEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSD  72
            C G++ K G  +K WKRRY  LH  + ++ Y+ S      NG    SF +  C    L  
Sbjct  299  CSGWLRKEGGTVKNWKRRYFTLH--STILCYFKS-----DNGALLRSFTV--CHVVTLRT  349

Query  73   EGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALG  118
            +         +       +  ++ +V  ETQ D  +WL+  H A+ 
Sbjct  350  K---------RLCLEITTEVGRKLLVASETQADLDRWLDHLHRAIA  386

 Score = 32.7 bits (73),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 17/49 (35%), Positives = 24/49 (49%), Gaps = 7/49 (14%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLS  63
            G++ K+G   K WKRR+  L G  L  A         S+ PP G  V++
Sbjct  102  GWLLKKGKNFKNWKRRFFKLDGKQLSYA-------SASDAPPLGRGVVA  143

>HYAP_09304
Length=1144

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 23/34 (68%), Gaps = 0/34 (0%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKE  48
            GY+ K+G   K+W+RR+ +L  D  +++YY S E
Sbjct  125  GYLVKQGSFWKSWRRRFFILRRDCPVLSYYTSAE  158

>PHYCA_539981
Length=712

 Score = 41.2 bits (95),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 48/103 (47%), Gaps = 9/103 (9%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            +G++ K G   KTW  R+ VL  D +L +YY  + + K     KGS  +    K D+S +
Sbjct  234  QGWLEKCGQQFKTWNWRFFVLRNDGVL-SYYADETLKKL----KGSIDIGYGSKADVSVQ  288

Query  74   GGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNA  116
              S+    F F+   P    +  M+   +Q   TKW+   H A
Sbjct  289  TNSMDK-NFVFLISTP---QRNLMISAPSQRMMTKWIARLHAA  327

>H257_05679
Length=367

 Score = 40.8 bits (94),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 30/98 (31%), Positives = 45/98 (46%), Gaps = 16/98 (16%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDEG  74
            G++ K+   +KTW RR+  L G TL  +YYDS++I   +G P+G  VL       L  E 
Sbjct  32   GWMRKQKAHLKTWNRRFFALSGSTL--SYYDSEDI---SGAPRG--VLDVASVHPLPSE-  83

Query  75   GSVKPFGFKFIGHCP--GQGYKEYMVFVETQIDQTKWL  110
                P G     HC    Q  ++  +  +T +    W 
Sbjct  84   ----PNGLLL--HCKSNNQRRRDEKLICDTNVAYNAWF  115

>H310_13911
Length=369

 Score = 40.8 bits (94),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 48/113 (42%), Gaps = 17/113 (15%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDEG  74
            G++ K+   +KTW RR+  L G TL  +YYDS++I   +G P+G  +L       L  E 
Sbjct  30   GWMRKQKAHLKTWNRRFFALSGSTL--SYYDSEDI---SGAPRG--ILEVASVHPLPSE-  81

Query  75   GSVKPFGFKFIGHCPGQG---YKEYMVFVETQIDQTKWLNVAHNALGKTTYIP  124
                P G     HC        ++  +  +T +    W  +   A    T  P
Sbjct  82   ----PNGLLL--HCKANNSTRRRDEKLICDTNVAYNAWFALLTRATTAETLEP  128

>PYU1_G003229
Length=810

 Score = 41.2 bits (95),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 34/50 (68%), Gaps = 7/50 (14%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSE  64
            G++ K+GH MK+WKRR+ V+ G T  + Y++  ++++    PKGS V+ +
Sbjct  402  GWLNKQGHRMKSWKRRFFVVEGST--ITYFE--QVHED---PKGSGVIQQ  444

 Score = 37.4 bits (85),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 25/76 (33%), Positives = 36/76 (47%), Gaps = 21/76 (28%)

Query  11  TSCE--GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQ  68
           T C+  G+ +K+G ++K+WKRRY VL G  L         IY S   P G  +       
Sbjct  25  TYCDYSGWASKQGSIIKSWKRRYFVLKGREL---------IYFSERSPSGKGI-------  68

Query  69  DLSDEGGSVKPFGFKF  84
              +E G +K  G +F
Sbjct  69  ---NEKGRLKIVGVEF  81

 Score = 37.0 bits (84),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 27/105 (26%), Positives = 42/105 (40%), Gaps = 18/105 (17%)

Query  13   CEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSD  72
            C G++ K G  +K WK RY  L G TL     D   + K+    K  +VL    K     
Sbjct  702  CSGWLRKEGSTVKNWKLRYFTLKGTTLTYFKSDKGPLLKA---LKVCYVLPMRTK-----  753

Query  73   EGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNAL  117
                      KF      +  ++ ++  +TQ +  +WL   H A+
Sbjct  754  ----------KFCLEVTMETGRKLLIAADTQAEHDRWLAALHQAV  788

 Score = 35.8 bits (81),  Expect = 0.39, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 18/26 (69%), Gaps = 0/26 (0%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTL  39
            +G++ K+G   KTWKRRY VL G  L
Sbjct  520  KGWLMKKGKNFKTWKRRYFVLDGKKL  545

 Score = 35.0 bits (79),  Expect = 0.77, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 20/34 (59%), Gaps = 2/34 (6%)

Query  13   CEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDS  46
            CEG++ KRG     WK+R+  L+G  L   Y DS
Sbjct  260  CEGWLYKRGQRSTAWKKRFFTLNGFQL--QYQDS  291

 Score = 32.3 bits (72),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 17/26 (65%), Gaps = 0/26 (0%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTL  39
            +G++ K G   KTWK+R+M L G  +
Sbjct  147  QGWLFKEGQNFKTWKKRFMTLEGRVI  172

>PYU1_G000724
Length=189

 Score = 40.0 bits (92),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 25/40 (63%), Gaps = 1/40 (3%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNG  54
            G++TK+GHM K+WK R+ VL  D    AYY +K   K  G
Sbjct  111  GWLTKQGHMWKSWKTRFFVLFADGTF-AYYKNKGKKKMQG  149

>PITG_08008
Length=712

 Score = 41.2 bits (95),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 33/115 (29%), Positives = 52/115 (45%), Gaps = 11/115 (10%)

Query  11   TSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSEC--EKQ  68
            +S  GY+ KRG  ++   +R+ VL G  L   YY S +    +  P+G   LS+C  E Q
Sbjct  326  SSVSGYLWKRGSRLRKMTKRHYVLQGSFLY--YYASPD----DTAPRGVTFLSDCYVEVQ  379

Query  69   DLSDE--GGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTT  121
             + +E     V  +G   +    G   ++  VF  +   Q +W     NA  KT+
Sbjct  380  PIQNEIVEKGVHYYGIDIVPEA-GSSREKRTVFTRSLDAQKRWAAALRNATDKTS  433

>HYAP_11713
Length=417

 Score = 40.8 bits (94),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 28/94 (30%), Positives = 41/94 (44%), Gaps = 18/94 (19%)

Query  27   WKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDEGGSVKPFGFKFI-  85
            WK+RY V++ + L + Y+ S E ++     +G    S     D        KP GF+F  
Sbjct  42   WKKRYCVIYANELQIVYFLSLEDFERRT-IRGKIPFSSVHAWD-------GKPNGFQFYT  93

Query  86   --GHCPGQGYKEYMVFVETQIDQTKWLNVAHNAL  117
               HC       + V+ ET  DQ KWL V    +
Sbjct  94   PADHC-------FRVYTETAADQLKWLEVMQKCI  120

>PPTG_19153
Length=1219

 Score = 41.2 bits (95),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 36/171 (21%), Positives = 75/171 (44%), Gaps = 17/171 (10%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDEG  74
            G +TK+G   + WK R+ +L  D   + Y+ S++  +      G   ++E +   L   G
Sbjct  147  GTLTKQGSWRRNWKTRFFILRSDCPSLCYFTSEDKLEL----LGEIPITE-DTIVLDRSG  201

Query  75   GSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAH---NALGKTTYIPSPSMESH  131
            G   PF F+             ++  E++ +Q +W++      +A+  + +  + SM S 
Sbjct  202  GGHAPFRFQIRTDA-----HTLLLEAESRENQKRWIDSCQELADAIRASKFSVNTSMSSF  256

Query  132  GGAGHKESAGLMISLEAQIKNVKKTSHELLQQAINDAKEADRIGDATVDEM  182
               G + S    +     +  ++ T  +LL+ + + ++  D    + VDEM
Sbjct  257  SIDGRRSS----LVRGTTVHTLRATEKDLLEASASSSQNWDDTETSGVDEM  303

>PHYRA_84786
Length=716

 Score = 40.8 bits (94),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 48/103 (47%), Gaps = 9/103 (9%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            +G++ K G   KTW  R+ VL  D +L +YY  + + K     KGS  +    K D+S +
Sbjct  238  QGWLEKCGQQFKTWNWRFFVLRNDGVL-SYYADETLKKL----KGSIDIGYGSKADVSVQ  292

Query  74   GGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNA  116
              ++    F F+   P    +  M+   +Q   TKW+   H A
Sbjct  293  ANAMDK-NFVFLISTP---QRNLMISAPSQRMMTKWIARLHAA  331

>PHYSO_343629
Length=977

 Score = 40.8 bits (94),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 21/30 (70%), Gaps = 0/30 (0%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAY  43
            EGYVTKRGH+++ WK R+  L G+ +   +
Sbjct  130  EGYVTKRGHLVRNWKMRFFTLEGNLVSCTW  159

>PPTG_18989
Length=1213

 Score = 40.8 bits (94),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (65%), Gaps = 0/34 (0%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKE  48
            GY+ K+G   K+W+RR+ +L  D  ++ YY S E
Sbjct  188  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTSAE  221

>CCI46733
Length=889

 Score = 40.8 bits (94),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 40/167 (24%), Positives = 70/167 (42%), Gaps = 26/167 (16%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            EGY+ ++  ++K+W  RY+ L   T  VA+Y SK    + GP +G        K D+ + 
Sbjct  118  EGYLYRQRKLVKSWTPRYVTLKNRT--VAFYKSKAHAIAKGPVRG--------KWDIREV  167

Query  74   GGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSPSMESHGG  133
              SV   GF  +   P     E   F     D T    +A ++L K+ ++          
Sbjct  168  SSSVPSTGFGGLKLQP-----ETNGFTLLATDDTTLHLIASSSLEKSMWV----------  212

Query  134  AGHKESAGLMISLEAQIKNVKKTSHELLQQAINDAKEADRIGDATVD  180
              H + A   + L  +I   ++  H + +    D ++   + D T+D
Sbjct  213  -HHIKLALSRVHLNRKIARSRRGGHTIRRTQSGDDRDNSSLLDTTLD  258

>PYU1_G001268
Length=263

 Score = 40.0 bits (92),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 49/106 (46%), Gaps = 16/106 (15%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            +G++ K+   +++W RRY  L+G TL   YYDS++  +   P +G  VL   +   L+ E
Sbjct  33   QGWMRKQKETLRSWGRRYFTLNGKTL--TYYDSEDTSR---PARG--VLEFVDVTALTTE  85

Query  74   GGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGK  119
                       IG       KE  +  +T +  T W+ V   A+ K
Sbjct  86   ---TNGLALHLIGG------KEVRLIADTHVAYTAWMAVLSAAVKK  122

>H257_03931
Length=695

 Score = 40.8 bits (94),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 52/110 (47%), Gaps = 16/110 (15%)

Query  11   TSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYY----DSKEIYKSNGPPKGSFVLSECE  66
            TS  G + K+ + +K WK+R+MVL G ++   YY     S+E +     P+G   LS  +
Sbjct  109  TSKSGVLVKQANHLKNWKKRFMVLRGQSMF--YYVSGTSSEETF-----PRGVISLSGVD  161

Query  67   KQDLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNA  116
               L D     K F F+ I H     Y+   +  + + D  +WL+   +A
Sbjct  162  VHPL-DTAKFKKQFCFE-ISH---PNYRSLYMVAKNEADLVQWLSSIKSA  206

>SPRG_14312
Length=661

 Score = 40.4 bits (93),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 49/102 (48%), Gaps = 8/102 (8%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDEG  74
            G + K+ + +K WK+R+MVL G +L   YY S      +  PKG   L   E Q L D  
Sbjct  113  GVLVKQANHLKNWKKRFMVLRGQSLF--YYVSGAA-SEDSYPKGLISLVGVEVQ-LVDVA  168

Query  75   GSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNA  116
               K F F+ + H     Y+   +  + + D T+W++   +A
Sbjct  169  RFKKQFCFE-LSH---PYYRPLYLMAKNEADLTQWMSCIKSA  206

>PHALS_07930
Length=1200

 Score = 40.8 bits (94),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (65%), Gaps = 0/34 (0%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKE  48
            GY+ K+G   K+W+RR+ +L  D  ++ YY S E
Sbjct  184  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTSAE  217

>CCI45895
Length=1721

 Score = 40.8 bits (94),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 25/105 (24%), Positives = 48/105 (46%), Gaps = 2/105 (2%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            EGY+ KRGH + + ++RY VL      + Y+++KE   + G   GS  L E +  ++   
Sbjct  843  EGYLLKRGHRIPSMRKRYFVLQSVDPTLRYFETKE--DAEGFECGSKPLGEFQVANVCSW  900

Query  74   GGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALG  118
             G       +       +  + Y     ++I++  W+   H+A+ 
Sbjct  901  HGRTLTQTHRNGMQIEARDGRIYFCVASSEIEKENWIRAFHHAIA  945

>PYVX_21894
Length=1365

 Score = 40.8 bits (94),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 48/100 (48%), Gaps = 12/100 (12%)

Query  15   GYVTKRGHM---MKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLS  71
            G++TK+GH    +KTWK R+ VL  D    AYY SK   K  G  + +  +   +  D+ 
Sbjct  136  GWLTKQGHACGAVKTWKTRFFVLFSDGTF-AYYKSKGRKKIQGCIQLNDGVVSVQHVDVR  194

Query  72   DEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLN  111
              G   KP+ F+       +G+   + +  +Q +   W++
Sbjct  195  RAG---KPYAFQI-----EKGFYRLLCYCCSQFEAELWVS  226

>HYAP_13757
Length=262

 Score = 39.7 bits (91),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 8/68 (12%)

Query  15  GYVTKRGHMMKTWKRRYMVLHGDTL------LVAYYD--SKEIYKSNGPPKGSFVLSECE  66
           G++ KRGH  KTWK+R+ +L+G  L       V  +D     I   + P +G   +++ E
Sbjct  15  GWLWKRGHTFKTWKKRFFLLNGAALTYYKQCCVITWDILGGGIRCLDLPVRGGLRVAQAE  74

Query  67  KQDLSDEG  74
             DL+  G
Sbjct  75  ASDLTSFG  82

>PPTG_09008
Length=1660

 Score = 40.8 bits (94),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 71/173 (41%), Gaps = 38/173 (22%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVA--YYDSKEIYKSN--GPPKGSFVLSECEKQDL  70
            G++ K+ ++MKTWKRRY VL   T L    Y+ S + Y+ +  G  +G   L +      
Sbjct  225  GWLFKQANVMKTWKRRYFVLTKRTNLATGEYWASLQYYRGSNFGKLRGEMHLQDGMSVRF  284

Query  71   SDEGGSVKPFGFKFIGHCPGQGYKEYMVFV---ETQIDQTKWLNVAHNALGKTTYIPSPS  127
             +   + +PF F+  G        E   FV       D + W+ +              S
Sbjct  285  LEPDETRRPFCFEVAG--------EDFSFVCSGSNDDDASAWVCLLQ------------S  324

Query  128  MESHGGAGHKESAGLMISLEAQIKNVKKTSHELLQQAINDAKEADRIGDATVD  180
            +   G +    SAGL+ +  A           LLQ +  D  + +RI  +T+D
Sbjct  325  LSGGGSSTIPPSAGLLGTAAAS---------SLLQPS--DGSKGNRIRTSTID  366

>PHYSO_478611
Length=522

 Score = 40.4 bits (93),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 25/35 (71%), Gaps = 2/35 (6%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEI  49
            G+V K+G ++K WK+R+MVL G  L   YYD+ ++
Sbjct  141  GWVYKQGSLVKNWKKRFMVLRGRQL--TYYDTAKV  173

 Score = 39.3 bits (90),  Expect = 0.028, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 27/39 (69%), Gaps = 2/39 (5%)

Query  10   QTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKE  48
            Q +  G++ K G  +K+WKRRY VL G+ L  +Y++S++
Sbjct  278  QVAHSGWLKKEGARVKSWKRRYFVLRGNAL--SYFNSED  314

>PYIW_20891
Length=291

 Score = 40.0 bits (92),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 24/34 (71%), Gaps = 2/34 (6%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKE  48
            G++ K G  +K WK+RY  LHG+TL  +Y+DS +
Sbjct  97   GWLKKEGSRVKNWKKRYFTLHGNTL--SYFDSAD  128

 Score = 37.4 bits (85),  Expect = 0.095, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 29/52 (56%), Gaps = 3/52 (6%)

Query  9   HQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSF  60
           H     G+V K+G +++ WK+R++VL G  L   YYD+  +       KGSF
Sbjct  3   HDGEHAGWVFKQGSLVRNWKKRFLVLRGKQL--TYYDTASLTPKT-KEKGSF  51

>PHYRA_81944
Length=1149

 Score = 40.4 bits (93),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (65%), Gaps = 0/34 (0%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKE  48
            GY+ K+G   K+W+RR+ +L  D  ++ YY S E
Sbjct  123  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTSAE  156

>SPRG_08326
Length=501

 Score = 40.4 bits (93),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 30/52 (58%), Gaps = 1/52 (2%)

Query  14   EGYVTKRGH-MMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSE  64
            EGY+ K+   + + W+RR+  +   TL++ Y+ SKE       P+GSF LS 
Sbjct  368  EGYLEKKSSSIFRGWERRWFKVDTRTLVLTYFHSKEDQMRGFAPRGSFALSR  419

>PHYRA_73430
Length=395

 Score = 40.0 bits (92),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 27/39 (69%), Gaps = 2/39 (5%)

Query  10   QTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKE  48
            Q +  G++ K G  +K+WKRRY VL G+ L  +Y++S++
Sbjct  147  QVTHSGWIKKEGARVKSWKRRYFVLRGNAL--SYFNSED  183

 Score = 39.3 bits (90),  Expect = 0.028, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 25/35 (71%), Gaps = 2/35 (6%)

Query  15  GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEI  49
           G+V K+G +++ WK+R+MVL G  L   YYD+ ++
Sbjct  12  GWVFKQGSLVRNWKKRFMVLRGRQL--TYYDTAKV  44

>PYAR_18690
Length=2455

 Score = 40.4 bits (93),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 56/115 (49%), Gaps = 12/115 (10%)

Query  9     HQTSC---EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSN--GPPKGSFVLS  63
             H+TS    EGY+ KRGH++ + ++RY VL  + L   YY ++E  +++    P GSF + 
Sbjct  1130  HETSSILMEGYLVKRGHLVPSMRKRYCVLVKNVL--TYYLTQEDSRNSDTSQPLGSFRV-  1186

Query  64    ECEKQDLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALG  118
                 + +SD  G      ++F         K +     +  ++T+W+   H+ + 
Sbjct  1187  ----EIVSDWHGKTAMQTYEFGMELETHDGKTFFCAAFSSEEKTQWIRAFHHGIA  1237

>PYU1_G011261
Length=1328

 Score = 40.4 bits (93),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 34/122 (28%), Positives = 54/122 (44%), Gaps = 30/122 (25%)

Query  6    SKIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSEC  65
            S +  T   G++ K+G   +++KRRYM L+G  L  +YY  K   KS  P      LS  
Sbjct  160  STVESTFISGFLRKKGEKNRSFKRRYMELNGTVL--SYYKKKPEKKSGIP------LSAA  211

Query  66   EKQDLSDEGGSV---------------KPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWL  110
            EK+  + E GS+               +PFG   +        + +++  E+  D  +WL
Sbjct  212  EKK--AYERGSIDLDRVSSLQPMENKSEPFGIHLVTTA-----RTWVIAAESDQDYQRWL  264

Query  111  NV  112
             V
Sbjct  265  KV  266

>PYIW_24869
Length=269

 Score = 39.7 bits (91),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 48/106 (45%), Gaps = 16/106 (15%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            +G++ K+   +++W RRY VL+G  L   YYDS++  +   P +G     +       + 
Sbjct  37   QGWMRKQKETLRSWGRRYFVLNGKVL--TYYDSEDTSR---PSRGVLEFEDVTALTTENN  91

Query  74   GGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGK  119
            G S+         H  G   KE  +  +T +  T W+ V   A+ K
Sbjct  92   GLSL---------HLVGG--KEVRLIADTHVAYTAWMAVMSAAVKK  126

>SDRG_05128
Length=512

 Score = 40.0 bits (92),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (59%), Gaps = 1/51 (2%)

Query  14   EGYVTKRGH-MMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLS  63
            EGY+ K+   + + W+RR+  +   TL++ Y+ SKE       P+GSF LS
Sbjct  376  EGYLEKKSSSIFRGWERRWFKVDTRTLVMTYFHSKEDQMRGFAPRGSFALS  426

>H310_09363
Length=1954

 Score = 40.4 bits (93),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 32/56 (57%), Gaps = 4/56 (7%)

Query  10   QTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYK---SNGPPKGSFVL  62
            +TSC GY+ KRG +  T +RRYM+L  D  LV Y  + E+ K       P+GS  L
Sbjct  843  RTSCAGYLMKRGEVNVTMQRRYMILQ-DNELVYYKTNPELNKGWFGKEKPRGSLHL  897

>PHYRA_94409
Length=1270

 Score = 40.4 bits (93),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 23/33 (70%), Gaps = 1/33 (3%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSK  47
            G++TK+GHM K+WK R+ VL  D    AYY +K
Sbjct  113  GWLTKQGHMWKSWKTRFFVLFSDGTF-AYYKNK  144

>CCI45290
Length=939

 Score = 40.4 bits (93),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 22/65 (34%), Positives = 37/65 (57%), Gaps = 2/65 (3%)

Query  14   EGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            EGY+ K+  ++K+W  RY+ LH  T+ V  Y SK    + GP +GS+ +++   +  S  
Sbjct  121  EGYLYKQRKLVKSWTPRYVTLHDSTIKV--YKSKAHAIAKGPMRGSWSITQINSELPSTG  178

Query  74   GGSVK  78
             G+ K
Sbjct  179  FGAAK  183

>CCA27157
Length=553

 Score = 40.0 bits (92),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 50/99 (51%), Gaps = 13/99 (13%)

Query  15   GYVTKRGHMMKT-WKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEKQDLSDE  73
            G++ KR       WK+RY V+  ++L + YY+++E ++  G  +G    +   K D    
Sbjct  29   GFLYKRPEQNSLLWKKRYCVIVKNSLQIVYYENEEDFEK-GVIRGKIPFASVHKWD----  83

Query  74   GGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNV  112
                KP GF+F  + P    K Y V+ +T  +Q +W+ +
Sbjct  84   ---GKPNGFQF--YTPSN--KCYRVYTDTPKEQEEWVAI  115

>PITG_03318
Length=1343

 Score = 40.0 bits (92),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 23/33 (70%), Gaps = 1/33 (3%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSK  47
            G++TK+GHM K+WK R+ VL  D    AYY +K
Sbjct  139  GWLTKQGHMWKSWKTRFFVLFSDGTF-AYYKNK  170

>PHYSO_248481
Length=1283

 Score = 40.0 bits (92),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 23/33 (70%), Gaps = 1/33 (3%)

Query  15   GYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSK  47
            G++TK+GHM K+WK R+ VL  D    AYY +K
Sbjct  92   GWLTKQGHMWKSWKTRFFVLFSDGTF-AYYKNK  123

Lambda      K        H        a         alpha
   0.314    0.130    0.370    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 21375256245

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40