Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
H310_09212147571113109956290.0
H257_06305147571099110047760.0
SDRG_01764147571092110734170.0
SPRG_063541475788488428050.0
PYIR_13453147571186119122600.0
PYAP_17746147571169114421320.0
PYIW_187931475799779619610.0
PYU1_G0017341475780079319390.0
PITG_18457147571170118318680.0
PHALS_06477147571166115318250.0
PHYRA_95901147571075114418060.0
PHYSO_32115714757118078816450.0
PPTG_1712814757117781916110.0
PHYCA_344751475769273914600.0
CCA18898147571147113813991e-173
CCI45122147571105114213891e-172
PYAR_13581147577303516832e-75
PHYKE_8394147574282675052e-54
PYIR_1697212339936109880.26
HYAP_04567108131275140870.38
PHYSO_298246864542575860.42
PYAP_17482108131354131812.0
PYIR_237348122105654812.0
PHYCA_7562108131246118802.4
PYU1_G00708432752336120802.6
PITG_15637126132036115802.6
PYAP_187081087956377793.1
PPTG_1080532982242793.3
PITG_037393275174340767.8
PPTG_17651143671871105768.7
PHYSO_4892961421109861758.8
CCA163761780638175758.9
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= H310_09212

Length=1113
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

H310_09212                                                            2172       0.0   
H257_06305                                                            1844       0.0   
SDRG_01764                                                            1320       0.0   
SPRG_06354                                                            1085       0.0   
PYIR_13453                                                            875        0.0   
PYAP_17746                                                            825        0.0   
PYIW_18793                                                            759        0.0   
PYU1_G001734                                                          751        0.0   
PITG_18457                                                            724        0.0   
PHALS_06477                                                           707        0.0   
PHYRA_95901                                                           700        0.0   
PHYSO_321157                                                          638        0.0   
PPTG_17128                                                            625        0.0   
PHYCA_34475                                                           566        0.0   
CCA18898                                                              543        1e-173
CCI45122                                                              539        1e-172
PYAR_13581                                                            267        2e-75 
PHYKE_8394                                                            199        2e-54 
PYIR_16972                                                            38.5       0.26  
HYAP_04567                                                            38.1       0.38  
PHYSO_298246                                                          37.7       0.42  
PYAP_17482                                                            35.8       2.0   
PYIR_23734                                                            35.8       2.0   
PHYCA_7562                                                            35.4       2.4   
PYU1_G007084                                                          35.4       2.6   
PITG_15637                                                            35.4       2.6   
PYAP_18708                                                            35.0       3.1   
PPTG_10805                                                            35.0       3.3   
PITG_03739                                                            33.9       7.8   
PPTG_17651                                                            33.9       8.7   
PHYSO_489296                                                          33.5       8.8   
CCA16376                                                              33.5       8.9   

>H310_09212
Length=1113

 Score = 2172 bits (5629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1099/1099 (100%), Positives = 1099/1099 (100%), Gaps = 0/1099 (0%)

Query  1     MEKLCQQYHAEDVGRILLQAQDELRSMREKVHENNNLDVNQIHAILERAEADLRAKAEIV  60
             MEKLCQQYHAEDVGRILLQAQDELRSMREKVHENNNLDVNQIHAILERAEADLRAKAEIV
Sbjct  1     MEKLCQQYHAEDVGRILLQAQDELRSMREKVHENNNLDVNQIHAILERAEADLRAKAEIV  60

Query  61    LNGVVNNSMKMLPAIDAPGGQRYLSKFSSKLAQKRDLAATMARENTYEPGSPTYGHDTSY  120
             LNGVVNNSMKMLPAIDAPGGQRYLSKFSSKLAQKRDLAATMARENTYEPGSPTYGHDTSY
Sbjct  61    LNGVVNNSMKMLPAIDAPGGQRYLSKFSSKLAQKRDLAATMARENTYEPGSPTYGHDTSY  120

Query  121   REHPSLSGPIEPMERDRTPGRRPVGRIVKAGSLVKHKTTKPRRILPKMNRldptapppal  180
             REHPSLSGPIEPMERDRTPGRRPVGRIVKAGSLVKHKTTKPRRILPKMNRLDPTAPPPAL
Sbjct  121   REHPSLSGPIEPMERDRTPGRRPVGRIVKAGSLVKHKTTKPRRILPKMNRLDPTAPPPAL  180

Query  181   ldddaRGGVHNLLTRGFLPPSVDVTPAFTHGTSVIQNTRVKIYDRASQPVKSMPYTNPSG  240
             LDDDARGGVHNLLTRGFLPPSVDVTPAFTHGTSVIQNTRVKIYDRASQPVKSMPYTNPSG
Sbjct  181   LDDDARGGVHNLLTRGFLPPSVDVTPAFTHGTSVIQNTRVKIYDRASQPVKSMPYTNPSG  240

Query  241   FNMASLKFDMVtptpptVANVPINQGGdippsktsiptpiditFDGHANNAVPFRPEQPK  300
             FNMASLKFDMVTPTPPTVANVPINQGGDIPPSKTSIPTPIDITFDGHANNAVPFRPEQPK
Sbjct  241   FNMASLKFDMVTPTPPTVANVPINQGGDIPPSKTSIPTPIDITFDGHANNAVPFRPEQPK  300

Query  301   GGNDPSGKDCASADDGAGGNDSTSIHNLRRNVEKIRGYNELLDTYSLHQFIIRKGKTLAD  360
             GGNDPSGKDCASADDGAGGNDSTSIHNLRRNVEKIRGYNELLDTYSLHQFIIRKGKTLAD
Sbjct  301   GGNDPSGKDCASADDGAGGNDSTSIHNLRRNVEKIRGYNELLDTYSLHQFIIRKGKTLAD  360

Query  361   TPEFISFQRTTEDLWGSVSKSIQELEAMLTNYSVPLAYVDGQKLMKIAAMDGTARGTMEL  420
             TPEFISFQRTTEDLWGSVSKSIQELEAMLTNYSVPLAYVDGQKLMKIAAMDGTARGTMEL
Sbjct  361   TPEFISFQRTTEDLWGSVSKSIQELEAMLTNYSVPLAYVDGQKLMKIAAMDGTARGTMEL  420

Query  421   LSCILNMDEVSSLMRRPGQRFKGKSGPDLAAVLLQSVWRMYITKKRLKNHHGNEDAAVIQ  480
             LSCILNMDEVSSLMRRPGQRFKGKSGPDLAAVLLQSVWRMYITKKRLKNHHGNEDAAVIQ
Sbjct  421   LSCILNMDEVSSLMRRPGQRFKGKSGPDLAAVLLQSVWRMYITKKRLKNHHGNEDAAVIQ  480

Query  481   RIYRSYRCFSQLQQRLKSVREADLRIWDAQMQRFRANWDSIKMQRRVVVHVPSFSSEERT  540
             RIYRSYRCFSQLQQRLKSVREADLRIWDAQMQRFRANWDSIKMQRRVVVHVPSFSSEERT
Sbjct  481   RIYRSYRCFSQLQQRLKSVREADLRIWDAQMQRFRANWDSIKMQRRVVVHVPSFSSEERT  540

Query  541   RLKMENFSIQQNLQMARMCAIADPNVDIIYISPFELSPDIQKYQVRLLQLGGIADPQTRI  600
             RLKMENFSIQQNLQMARMCAIADPNVDIIYISPFELSPDIQKYQVRLLQLGGIADPQTRI
Sbjct  541   RLKMENFSIQQNLQMARMCAIADPNVDIIYISPFELSPDIQKYQVRLLQLGGIADPQTRI  600

Query  601   RMLHPENVDRFPEHFSLTTVLLYSPHCLKKIKRFVRGKDAYIVTGNVGPEDKRLAIALQL  660
             RMLHPENVDRFPEHFSLTTVLLYSPHCLKKIKRFVRGKDAYIVTGNVGPEDKRLAIALQL
Sbjct  601   RMLHPENVDRFPEHFSLTTVLLYSPHCLKKIKRFVRGKDAYIVTGNVGPEDKRLAIALQL  660

Query  661   PLLGMDPDKALLYGTRSGGKRIFMAADVNIPMGAHDIYDEDELIQSLSKLIAADIDQTEW  720
             PLLGMDPDKALLYGTRSGGKRIFMAADVNIPMGAHDIYDEDELIQSLSKLIAADIDQTEW
Sbjct  661   PLLGMDPDKALLYGTRSGGKRIFMAADVNIPMGAHDIYDEDELIQSLSKLIAADIDQTEW  720

Query  721   LIKIDADQSNTGIASLNVDKMQSVAKFRAEKREMKHGAAEYFQQPDVRDAVLRSVYSELN  780
             LIKIDADQSNTGIASLNVDKMQSVAKFRAEKREMKHGAAEYFQQPDVRDAVLRSVYSELN
Sbjct  721   LIKIDADQSNTGIASLNVDKMQSVAKFRAEKREMKHGAAEYFQQPDVRDAVLRSVYSELN  780

Query  781   ESYFAANVTPCFPEMYASWAAMRPIALRVGVVIEAYPSKVLSHVRTNIFIEPSGGVHITS  840
             ESYFAANVTPCFPEMYASWAAMRPIALRVGVVIEAYPSKVLSHVRTNIFIEPSGGVHITS
Sbjct  781   ESYFAANVTPCFPEMYASWAAMRPIALRVGVVIEAYPSKVLSHVRTNIFIEPSGGVHITS  840

Query  841   AHDVFMCPVNKHLPQCAVFPQSSVPYQAIRGASLAIASSMFIKGIIGYASIDYISFADPK  900
             AHDVFMCPVNKHLPQCAVFPQSSVPYQAIRGASLAIASSMFIKGIIGYASIDYISFADPK
Sbjct  841   AHDVFMCPVNKHLPQCAVFPQSSVPYQAIRGASLAIASSMFIKGIIGYASIDYISFADPK  900

Query  901   AMVSGRPRQRLWAMQVVPGLTNTAVSFVMFAFLSCSQFNPITGKSHLQVAPAPVATLSTA  960
             AMVSGRPRQRLWAMQVVPGLTNTAVSFVMFAFLSCSQFNPITGKSHLQVAPAPVATLSTA
Sbjct  901   AMVSGRPRQRLWAMQVVPGLTNTAVSFVMFAFLSCSQFNPITGKSHLQVAPAPVATLSTA  960

Query  961   NAPITPTQQEIATILsppssaaaasVCGPERTYMVLDYIYHPNMATLQFATFFNTCRLHG  1020
             NAPITPTQQEIATILSPPSSAAAASVCGPERTYMVLDYIYHPNMATLQFATFFNTCRLHG
Sbjct  961   NAPITPTQQEIATILSPPSSAAAASVCGPERTYMVLDYIYHPNMATLQFATFFNTCRLHG  1020

Query  1021  VSFDLQRAIGAAYILADSLTAGVVGLICIGESDKEAFRIARQAVELIGDQVGVQALPNSL  1080
             VSFDLQRAIGAAYILADSLTAGVVGLICIGESDKEAFRIARQAVELIGDQVGVQALPNSL
Sbjct  1021  VSFDLQRAIGAAYILADSLTAGVVGLICIGESDKEAFRIARQAVELIGDQVGVQALPNSL  1080

Query  1081  SGERLGNFPHLLAIVRNKS  1099
             SGERLGNFPHLLAIVRNKS
Sbjct  1081  SGERLGNFPHLLAIVRNKS  1099

>H257_06305
Length=1099

 Score = 1844 bits (4776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 913/1100 (83%), Positives = 989/1100 (90%), Gaps = 16/1100 (1%)

Query  1     MEKLCQQYHAEDVGRILLQAQDELRSMREKVHENNNLDVNQIHAILERAEADLRAKAEIV  60
             M+KLCQQYHAEDVGRILLQAQDELRSMREKV+E NN+DVN+I+AILERAEADLRAKAEIV
Sbjct  1     MDKLCQQYHAEDVGRILLQAQDELRSMREKVNEKNNVDVNEINAILERAEADLRAKAEIV  60

Query  61    LNGVVNNSMKMLPAIDAPGGQRYLSKFSSKLAQKRDLAATMARENTYEPGSPTYGHDTSY  120
             LNGVVNNSMKMLPAI+APGG+  LSKFSSKLAQKR+LAATM R+++YEP SPTY  +   
Sbjct  61    LNGVVNNSMKMLPAIEAPGGKTSLSKFSSKLAQKRELAATMTRDSSYEPASPTYRQED--  118

Query  121   REHPSLSGPIEPMERDRTPGRRPVGRIVKAGSLVKHKTTKPRRILPKMNRldptapppal  180
                P   GPIEPMERDR PGRRPVGRI+KAGSLVK KTTKP R+LPKMNR DPTAP P L
Sbjct  119   -REPRFGGPIEPMERDRAPGRRPVGRIIKAGSLVKKKTTKPHRLLPKMNRTDPTAPSPDL  177

Query  181   ldddaRGGVHNLLTRGFLPPSVDVTPAFTHGTSVIQNTRVKIYDRASQPVKSMPYTNPSG  240
             +++DARGGVHNL+TRGFLPPSVDVTPAFTHGTSVIQN+RVKIYDRASQPVKSMPYTNPSG
Sbjct  178   VEEDARGGVHNLVTRGFLPPSVDVTPAFTHGTSVIQNSRVKIYDRASQPVKSMPYTNPSG  237

Query  241   FNMASLKFDMVtptpptVANVPINQGGdippsktsiptpiditFDGHANNAVPFRPEQPK  300
             FNMASLKFDM T    +  + P+            + TPIDI+FD  +++  P   EQPK
Sbjct  238   FNMASLKFDMSTTPATSTPS-PVAAVVSGGDVSKMVVTPIDISFDAPSSSHPPV--EQPK  294

Query  301   GGNDPSGKDCASADDGAGGNDSTSIHNLRRNVEKIRGYNELLDTYSLHQFIIRKGKTLAD  360
             GG        A+  D   G DS++IHNLRRNVEKIRGYNELLDTYSLHQFIIRKGKTL+D
Sbjct  295   GG--------ATGGDDTNGGDSSTIHNLRRNVEKIRGYNELLDTYSLHQFIIRKGKTLSD  346

Query  361   TPEFISFQRTTEDLWGSVSKSIQELEAMLTNYSVPLAYVDGQKLMKIAAMDGTARGTMEL  420
             TPEFISFQRTTEDLWGSVS SIQELE MLT+YSVPLAYVDGQKLMKIAAMD T RGT EL
Sbjct  347   TPEFISFQRTTEDLWGSVSTSIQELETMLTSYSVPLAYVDGQKLMKIAAMDATTRGTTEL  406

Query  421   LSCILNMDEVSSLMRRPGQRFKGKSGPDLAAVLLQSVWRMYITKKRLKNHHGNEDAAVIQ  480
             LSCILNMDEVSSLMRRPGQR+KG  GPDLA VL+QSVWRM++TKKRLKNHHGNEDAAVIQ
Sbjct  407   LSCILNMDEVSSLMRRPGQRYKGSQGPDLAVVLIQSVWRMFLTKKRLKNHHGNEDAAVIQ  466

Query  481   RIYRSYRCFSQLQQRLKSVREADLRIWDAQMQRFRANWDSIKMQRRVVVHVPSFSSEERT  540
             RIYRSYRCFSQLQQRLK VREADLRIWDAQMQRFRANWD++KMQRRVVVHVPSF+S++RT
Sbjct  467   RIYRSYRCFSQLQQRLKLVREADLRIWDAQMQRFRANWDTMKMQRRVVVHVPSFASDDRT  526

Query  541   RLKMENFSIQQNLQMARMCAIADPNVDIIYISPFELSPDIQKYQVRLLQLGGIADPQTRI  600
             RLKM+NFSI+QNLQMARMCAIADPNVDIIYISPFELSPDIQ+YQVRLLQLGGI DPQTRI
Sbjct  527   RLKMDNFSIRQNLQMARMCAIADPNVDIIYISPFELSPDIQRYQVRLLQLGGITDPQTRI  586

Query  601   RMLHPENVDRFPEHFSLTTVLLYSPHCLKKIKRFVRGKDAYIVTGNVGPEDKRLAIALQL  660
             RMLHPENVDRFPEHFSLTT+LLYSPHCLKKIKRFVRGK+AYIVTGNVGPEDKRLAIALQ+
Sbjct  587   RMLHPENVDRFPEHFSLTTLLLYSPHCLKKIKRFVRGKNAYIVTGNVGPEDKRLAIALQI  646

Query  661   PLLGMDPDKALLYGTRSGGKRIFMAADVNIPMGAHDIYDEDELIQSLSKLIAADIDQTEW  720
             PLLGMDPDKALLYGTRSGGKRIFMAADVNIPMGAHDIYDEDELIQSLSKLIAAD+DQ EW
Sbjct  647   PLLGMDPDKALLYGTRSGGKRIFMAADVNIPMGAHDIYDEDELIQSLSKLIAADVDQNEW  706

Query  721   LIKIDADQSNTGIASLNVDKMQSVAKFRAEKREMKHGAAEYFQQPDVRDAVLRSVYSELN  780
             L+KIDADQS+TGIAS+NV +MQSVAK RAEKR+MKH AAEYFQQPDVRDAVLRS+++EL 
Sbjct  707   LVKIDADQSDTGIASINVQQMQSVAKVRAEKRDMKHMAAEYFQQPDVRDAVLRSIFNELT  766

Query  781   ESYFAANVTPCFPEMYASWAAMRPIALRVGVVIEAYPSKVLSHVRTNIFIEPSGGVHITS  840
             ESYFAAN+TPCFP++YASWA +RP+ALRVGVVIEAYPSKVLS VR N+FIEPSGGVHITS
Sbjct  767   ESYFAANITPCFPDVYASWAELRPVALRVGVVIEAYPSKVLSQVRANVFIEPSGGVHITS  826

Query  841   AHDVFMCPVNKHLPQCAVFPQSSVPYQAIRGASLAIASSMFIKGIIGYASIDYISFADPK  900
             AHD+FM P NKHLPQCA+FPQ+SVPYQAIRGASLAIASSMFIKGIIGYASIDY+SFADPK
Sbjct  827   AHDLFMSPANKHLPQCALFPQTSVPYQAIRGASLAIASSMFIKGIIGYASIDYMSFADPK  886

Query  901   AMV-SGRPRQRLWAMQVVPGLTNTAVSFVMFAFLSCSQFNPITGKSHLQVAPAPVATLST  959
              +V  GRPRQRLWAMQVVPGLTNTAVSFVMFAFLSCSQFNPITGK HLQVA  P    S 
Sbjct  887   TLVGGGRPRQRLWAMQVVPGLTNTAVSFVMFAFLSCSQFNPITGKCHLQVAAPPPIAASA  946

Query  960   ANAPITPTQQEIATILsppssaaaasVCGPERTYMVLDYIYHPNMATLQFATFFNTCRLH  1019
               APIT  Q+ + TIL        A VCGPERTYMVLDYIYHPNMATL F+TFFNTCRL+
Sbjct  947   TVAPITQAQKAVETIL-SARPPNGAVVCGPERTYMVLDYIYHPNMATLHFSTFFNTCRLN  1005

Query  1020  GVSFDLQRAIGAAYILADSLTAGVVGLICIGESDKEAFRIARQAVELIGDQVGVQALPNS  1079
             GVSFDLQRAIGAA+ILADSLTAGV+GL+CIGE+DKEAFRIARQAVELIGDQVGVQALP+S
Sbjct  1006  GVSFDLQRAIGAAFILADSLTAGVMGLMCIGENDKEAFRIARQAVELIGDQVGVQALPDS  1065

Query  1080  LSGERLGNFPHLLAIVRNKS  1099
             LSGERLGNFPHLLAIVRNKS
Sbjct  1066  LSGERLGNFPHLLAIVRNKS  1085

>SDRG_01764
Length=1092

 Score = 1320 bits (3417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 656/1107 (59%), Positives = 831/1107 (75%), Gaps = 39/1107 (4%)

Query  1     MEKLCQQYHAEDVGRILLQAQDELRSMREKVHENNNLDVNQIHAILERAEADLRAKAEIV  60
             M++L QQYH EDVGRILLQAQDELR+MRE+V  +NN+D++ + AILERAE DLR+KAEIV
Sbjct  1     MDRLAQQYHVEDVGRILLQAQDELRNMREQVLTSNNIDIDALQAILERAELDLRSKAEIV  60

Query  61    LNGVVNNSMKMLPAIDAPGG-QRYLSKFSSKLAQKRDLAATMARENTYEPGSPTYGHDTS  119
             LNGVVNN+MK LP I+APGG Q  +SKFSSKLA++R+LA  MAR+ + +        D  
Sbjct  61    LNGVVNNTMKTLPVIEAPGGGQPSVSKFSSKLAKQRELADAMARDGSLD--------DHR  112

Query  120   YREHP------SLSGPIEPMERDRTPGRRPVGRIVKAGSLVKHKTTKPRRILPKMNRldp  173
              R  P       L  P+ P+ERDR PG+RP+GR ++ G L+K K T P+R+LPK+NR+DP
Sbjct  113   TRSSPVERLRQQLGQPVVPVERDRPPGKRPIGRTMQVGRLIKKKVTGPQRLLPKVNRIDP  172

Query  174   tapppalldddaRGGVHNLLTRGFLPPSVDVTPAFTHGTSVIQNTRVKIYDRASQPVKSM  233
              AP P L DDDA+ GV NL+ RGF+P S D++ AFTHG  +IQN+++++YDR+ QPVKS 
Sbjct  173   LAPVPDLEDDDAKRGVLNLVNRGFIPTSADLSLAFTHGDGIIQNSKLRLYDRSEQPVKSQ  232

Query  234   PYTNPSGFNMASLKFDMVtptpptVANVPINQGGdippsktsiptpiditFDGHANNAVP  293
             PY N S FN+ASLK D+  P                          +         + VP
Sbjct  233   PYMNSSSFNVASLKLDLAPPPTEPDPTPLTRLAVARNKKSAVATVQLTFPGAKDEGDVVP  292

Query  294   FRPEQPKGGNDPSGKDCASADDGAGGNDSTSIHNLRRNVEKIRGYNELLDTYSLHQFIIR  353
                       DP+       DDG     + +I  LR NVEKIRGYN+LLDTYSLHQFIIR
Sbjct  293   V--------EDPT------TDDGPI-EPTDTIDELRNNVEKIRGYNDLLDTYSLHQFIIR  337

Query  354   KGKTLADTPEFISFQRTTEDLWGSVSKSIQELEAMLTNYSVPLAYVDGQKLMKIAAMDGT  413
             KG+TLA+TPEFISF+R TEDLWGSVS +I+ELE +L NYSVPLAY+DGQKL+KIAAMD  
Sbjct  338   KGQTLAETPEFISFKRITEDLWGSVSMAIRELETLLINYSVPLAYIDGQKLLKIAAMDAV  397

Query  414   ARGTMELLSCILNMDEVSSLMRRPGQRFKGKSGPDLAAVLLQSVWRMYITKKRLKNHHGN  473
             +R   ELL+C+LN+DEV++ M RPGQRFKG+     AA+LLQSV+RM++T++RL+ HHG+
Sbjct  398   SRSKSELLTCVLNVDEVTTFMARPGQRFKGEDSRHAAAILLQSVYRMHLTRRRLRQHHGH  457

Query  474   EDAAVIQRIYRSYRCFSQLQQRLKSVREADLRIWDAQMQRFRANWDSIKMQRRVVVHVPS  533
               A+ IQR+YR+Y+   ++Q +L+  READ R W+ QM  F ANWD IKMQRRVVVHVPS
Sbjct  458   SYASHIQRVYRTYKSVKEIQVKLRLAREADARTWETQMTAFHANWDKIKMQRRVVVHVPS  517

Query  534   FSSEERTRLKMENFSIQQNLQMARMCAIADPNVDIIYISPFELSPDIQKYQVRLLQLGGI  593
             FS+EERTRL M+NF+I+QNLQMAR+CAIADPNVD+IYISPFELS DIQKY +RLLQLGG+
Sbjct  518   FSAEERTRLNMDNFAIRQNLQMARLCAIADPNVDVIYISPFELSADIQKYMMRLLQLGGV  577

Query  594   ADPQTRIRMLHPENVDRFPEHFSLTTVLLYSPHCLKKIKRFVRGKDAYIVTGNVGPEDKR  653
             ADP +R+RMLHPEN +RFPEHFSL T+LLYSPHCLKKIKR+VRGK+AYIV G VGPEDKR
Sbjct  578   ADPHSRVRMLHPENAERFPEHFSLATILLYSPHCLKKIKRYVRGKEAYIVAGTVGPEDKR  637

Query  654   LAIALQLPLLGMDPDKALLYGTRSGGKRIFMAADVNIPMGAHDIYDEDELIQSLSKLIAA  713
             LAI LQLPLLGMDPD+ALLYGTRSG KR+F  ADVNIP GAHDIYDEDELI SL+KL AA
Sbjct  638   LAIRLQLPLLGMDPDRALLYGTRSGAKRLFTQADVNIPFGAHDIYDEDELILSLAKLTAA  697

Query  714   DIDQTEWLIKIDADQSNTGIASLNVDKMQSVAKFRAEKREMKHGAAEYFQQPDVRDAVLR  773
             ++ Q  WLIK+DAD S+TG+AS+++  ++ V K R EKR MK+   EY+ QP++++ ++R
Sbjct  698   NLHQGMWLIKLDADPSDTGLASIDMHALECVNKVRTEKRAMKND--EYYSQPNIKEGIVR  755

Query  774   SVYSELNESYFAANVTPCFPEMYASWAAMRPIALRVGVVIEAYPSKVLSHVRTNIFIEPS  833
             ++ +EL+E  F   ++PCFP++Y +W  MRP+  R+G VIEAYP KVL+ VR N+FIEPS
Sbjct  756   AIVAELSEQ-FHRLISPCFPDVYPTWQHMRPVVNRIGAVIEAYPPKVLARVRANVFIEPS  814

Query  834   GGVHITSAHDVFMCPVNKHLPQCAVFPQSSVPYQAIRGASLAIASSMFIKGIIGYASIDY  893
             GGVH+TSA +  M   NKH    AV+P ++VPY AIRGASLA+A +M+  GIIGYASIDY
Sbjct  815   GGVHLTSAQEQLMQAKNKHQSVGAVYPSTTVPYAAIRGASLAVAQAMYASGIIGYASIDY  874

Query  894   ISFADPKAM--VSGRPRQRLWAMQVVPGLTNTAVSFVMFAFLSCSQFNPITGKSHLQVAP  951
             ++F D K +   +G P  RLWA+Q++P LT TA+SFV+F FLSC+  +  TG+S L   P
Sbjct  875   VAFLDVKTVNGKAGPPHLRLWALQLLPCLTPTAMSFVLFTFLSCATLDAATGRSFLP-QP  933

Query  952   APVATLSTANAPITPTQQEIATILsppssaaaasVCGPERTYMVLDYIYHPNMATLQFAT  1011
             AP  + +T   P+T TQ  +  ILS    ++     GPER Y+  +YI+HPNMATLQ+A 
Sbjct  934   APHPSPATGQLPVTETQLAVEKILSESPRSSN---VGPERAYIAHEYIFHPNMATLQYAV  990

Query  1012  FFNTCRLHGVSFDLQRAIGAAYILADSLTAGVVGLICIGESDKEAFRIARQAVELIGDQV  1071
             FFN CR+HGVSFDLQ++IGAA++LADSLTAGVVGL+CIGESDKEA R+ R A+ELIGDQV
Sbjct  991   FFNMCRVHGVSFDLQKSIGAAFVLADSLTAGVVGLLCIGESDKEAVRLTRAALELIGDQV  1050

Query  1072  GVQALPNSLSGERLGNFPHLLAIVRNK  1098
             GVQ  P++L+GERLGNF  +L  +R++
Sbjct  1051  GVQPAPDALTGERLGNFAAVLGAIRSR  1077

>SPRG_06354
Length=884

 Score = 1085 bits (2805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 530/884 (60%), Positives = 674/884 (76%), Gaps = 24/884 (3%)

Query  215   IQNTRVKIYDRASQPVKSMPYTNPSGFNMASLKFDMVtptpptVANVPINQGGdippskt  274
             +QN+++++YDR+ QPVKS PY N SGFN+ASLK D+  P     A  P      +   + 
Sbjct  1     MQNSKLRLYDRSEQPVKSQPYMNSSGFNVASLKLDLAPPPTEPDAVPPTRPA--VARKRK  58

Query  275   siptpiditFDGHANNAVPFRPEQPKGGNDPSGKDCASADDGAGGNDSTSIHNLRRNVEK  334
             S    + ++F G  +  V   P +     DP+       DDG     + +I  LR NVEK
Sbjct  59    STVATVQLSFPGAKDELVDAVPVE-----DPA------TDDGPI-EPTDTIDELRNNVEK  106

Query  335   IRGYNELLDTYSLHQFIIRKGKTLADTPEFISFQRTTEDLWGSVSKSIQELEAMLTNYSV  394
             IRGYN+LLDTYSLHQFIIRKG+TL++TPEFISF+R TEDLWGSVS +I+ELE +L +YSV
Sbjct  107   IRGYNDLLDTYSLHQFIIRKGQTLSETPEFISFKRITEDLWGSVSMAIRELETLLVHYSV  166

Query  395   PLAYVDGQKLMKIAAMDGTARGTMELLSCILNMDEVSSLMRRPGQRFKGKSGPDLAAVLL  454
             PLAY+DGQKL+KIAAMD  +R   ELL+C+LN+DEV++ M RPGQRFKG  G   AA+++
Sbjct  167   PLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGGDGRHAAAIVI  226

Query  455   QSVWRMYITKKRLKNHHGNEDAAVIQRIYRSYRCFSQLQQRLKSVREADLRIWDAQMQRF  514
             QSV+RM+ T++ L+ HHG+  A  IQR+YR+Y+C   +Q +L+  READ R W+ QM  F
Sbjct  227   QSVYRMHRTRRLLRQHHGHSYATHIQRVYRTYKCVKDIQVKLRLAREADARTWETQMTTF  286

Query  515   RANWDSIKMQRRVVVHVPSFSSEERTRLKMENFSIQQNLQMARMCAIADPNVDIIYISPF  574
              ANWD IKMQRRVVVHVPSFS+EER RL M+NF+I+QNLQMAR+CAIADPNVD+IYISPF
Sbjct  287   HANWDKIKMQRRVVVHVPSFSAEERARLNMDNFAIRQNLQMARLCAIADPNVDVIYISPF  346

Query  575   ELSPDIQKYQVRLLQLGGIADPQTRIRMLHPENVDRFPEHFSLTTVLLYSPHCLKKIKRF  634
             ELS DIQKY +RLLQLGG+ADP +R+RMLHPEN +RFPEHFSL T+LLYSPHCLKKIKR+
Sbjct  347   ELSVDIQKYMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLATILLYSPHCLKKIKRY  406

Query  635   VRGKDAYIVTGNVGPEDKRLAIALQLPLLGMDPDKALLYGTRSGGKRIFMAADVNIPMGA  694
             VRGK+AYIV G VGPEDKRLAI LQLPLLGMDPD+ALLYGTRSG KR+F  ADVNIP GA
Sbjct  407   VRGKEAYIVAGTVGPEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKRLFTQADVNIPYGA  466

Query  695   HDIYDEDELIQSLSKLIAADIDQTEWLIKIDADQSNTGIASLNVDKMQSVAKFRAEKREM  754
             HDIYDEDELI SL+KL AA++ Q  WLIK+DAD S+TG+A++++  ++ V K RAEKR M
Sbjct  467   HDIYDEDELILSLAKLTAANLHQGMWLIKLDADPSDTGLAAIDMHALECVNKVRAEKRAM  526

Query  755   KHGAAEYFQQPDVRDAVLRSVYSELNESYFAANVTPCFPEMYASWAAMRPIALRVGVVIE  814
             K+   EY+ QP++++ ++R++ +EL+E  F   ++PCFP++Y +W  MRP+  R+G VIE
Sbjct  527   KND--EYYSQPNIKEGIVRAIVAELSEQ-FHRLISPCFPDVYPTWQHMRPVVNRIGAVIE  583

Query  815   AYPSKVLSHVRTNIFIEPSGGVHITSAHDVFMCPVNKHLPQCAVFPQSSVPYQAIRGASL  874
             AYP KVL+ VR N+FIEPSGGVH+TSA +  M   NKH    AV+P ++VPY AIRGASL
Sbjct  584   AYPPKVLARVRANVFIEPSGGVHVTSAQEQLMHVKNKHQSVGAVYPPTAVPYAAIRGASL  643

Query  875   AIASSMFIKGIIGYASIDYISFADPKAM--VSGRPRQRLWAMQVVPGLTNTAVSFVMFAF  932
             A+A +M+  GIIGYASIDY++F D K +   +G P  RLWA+Q++P LT TA+SFV+F F
Sbjct  644   AVAQAMYASGIIGYASIDYVAFLDVKTVNGKAGPPHLRLWALQLLPCLTPTAMSFVLFTF  703

Query  933   LSCSQFNPITGKSHLQVAPAPVATLSTANAPITPTQQEIATILsppssaaaasVCGPERT  992
             LSC+  +  TG+S L + PAP  + S A  P T TQ  +  IL     ++ A+  G ER 
Sbjct  704   LSCATLDAATGRSFLPL-PAPRPS-SLAGPPATETQLAVEKIL---GESSPAATMGAERA  758

Query  993   YMVLDYIYHPNMATLQFATFFNTCRLHGVSFDLQRAIGAAYILADSLTAGVVGLICIGES  1052
             Y+  +YI+HPNMATLQ+A FFN CR+HGVSFDLQ++IGAA++LADSLTAGVVGL+CIGES
Sbjct  759   YIAHEYIFHPNMATLQYAVFFNMCRVHGVSFDLQKSIGAAFVLADSLTAGVVGLLCIGES  818

Query  1053  DKEAFRIARQAVELIGDQVGVQALPNSLSGERLGNFPHLLAIVR  1096
             DKEA R+ R A+ELIGDQVGVQ  P++L+GERLGNF  +L  +R
Sbjct  819   DKEAVRLTRAALELIGDQVGVQPAPDALTGERLGNFAAVLGAIR  862

>PYIR_13453
Length=1186

 Score = 875 bits (2260),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 498/1191 (42%), Positives = 709/1191 (60%), Gaps = 119/1191 (10%)

Query  1     MEKLCQQYHAEDVGRILLQAQDELRSMREKVHENNNL---------------DVNQIHAI  45
             M++  QQ+H EDVGRILLQ Q++LR MRE++   +                 DV     I
Sbjct  1     MDQFQQQHHVEDVGRILLQTQEQLRLMREQMAATSTTPSSSMRFASSGASQPDVLAFQEI  60

Query  46    LERAEADLRAKAEIVLNGVVNNSMKM--LPAIDAPGGQRYLSKFSSKLAQKRDLAATMAR  103
             L+RAE ++RAKAE+VLNG VN S +   LP + +        K  ++L Q         R
Sbjct  61    LQRAEVEIRAKAELVLNGFVNTSSQASALPTVSSSANGNASPK--ARLRQNVTSLTAARR  118

Query  104   ENTYEPGSPTYGHDTSYREHPSL---SGPIEPMERDRTPGRRPVGRIVKAGSLVKHKTTK  160
              +      P   +  +   +P++   S P+ P          PV RI K G LVK K  +
Sbjct  119   NSRLASDEPDLDYFRARFHNPAVEFVSSPVLP---------SPVQRITK-GQLVKKKMAQ  168

Query  161   PRRILPKMNRldptapppalldddaRGGVHNLLTRGFLPPSVDVTPAF--THGTSVIQNT  218
               R+LP +N+ DP+AP P L + DA+ G+ +L+ RGFLP   D+TPAF   HG S+I+N+
Sbjct  169   NARLLPSVNKSDPSAPTPELSEQDAKSGMLSLVNRGFLPVGADLTPAFINNHG-SIIKNS  227

Query  219   RVKIYDRASQPVKSMPYTNPSGFNMASLKFDMV-----------------tptpptVANV  261
             + +IYDR  QP++SMP TNPSGFN+ASLKFD+                  +      A  
Sbjct  228   KTRIYDRQEQPIRSMPSTNPSGFNVASLKFDIAPPSTTVSDRENSNGSEPSLQRTAAATQ  287

Query  262   PINQGGdippsktsiptpiditFDGHANNAVPFRPEQPKGGNDPS-GKDCASA-------  313
              +++GG    S        ++   G     V F+ +  +G    S G   A+A       
Sbjct  288   FVSKGGSSLLSPRQYENSANVRSRGAKVVTVNFQGDAVRGNLQASVGSVTAAAMLSTDQS  347

Query  314   ----------DD--GAGGND--------STSIHNLRRNVEKIRGYNELLDTYSLHQFIIR  353
                       DD   +GGND        ++++  LR+NVEKIRGYNELLDTYSLHQFII 
Sbjct  348   QEAESPETNLDDEVNSGGNDNADDDNDDTSAMDELRKNVEKIRGYNELLDTYSLHQFIIH  407

Query  354   KGKTLADTPEFISFQRTTEDLWGSVSKSIQELEAMLTNYSVPLAYVDGQKLMKIAAMDGT  413
             KG+ + +TPEF+SF+R  +++WGSV + I+ LEA+LT Y VPLAY+DGQ+LM +AAM+  
Sbjct  408   KGRAMRETPEFVSFKRVAQEVWGSVEEVIRALEALLTRYFVPLAYIDGQRLMTVAAMEMA  467

Query  414   ARGTMELLSCILNMDEVSSLMRRPGQRFKGKSGPDLAAVLLQSVWRMYITKKRL-KNHHG  472
             A    +LLSCI+N D+V SL+RRPGQR+KGK     AA+ +Q+ +RM+  +K+  +  H 
Sbjct  468   AFSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAITIQNFFRMWWNQKKYTRFRHH  527

Query  473   NEDAAVIQRIYRSYRCFSQLQQRLKSVREADLRIWDAQMQRFRANWDSIKMQRRVVVHVP  532
                   IQR++R++     L+++LK  R      W+A+MQR + +W  IK  RRVV+HVP
Sbjct  528   LASVVTIQRVWRAFASHESLKRKLKFQRAQQHEQWEAKMQRLKRDWTHIKGNRRVVIHVP  587

Query  533   SFSSEERTRLKMENFSIQQNLQMARMCAIADPNVDIIYISPFELSPDIQKYQVRLLQLGG  592
             S S +ER+R+  +NFS++QN+Q++R+C + DPNVDI+Y+SPFEL+ D+ +Y ++LLQLGG
Sbjct  588   SLSIDERSRISADNFSVKQNIQLSRLCGLIDPNVDIVYVSPFELTADVAQYSMKLLQLGG  647

Query  593   IADPQTRIRMLHPENVDRFPEHFSLTTVLLYSPHCLKKIKRFVRGKDAYIVTGNVGPEDK  652
             IADP  R+++++PE   RFP HFSLTT+LLYSPHCL++I+R++R K+AY+VTG  G EDK
Sbjct  648   IADPVARVKLVYPEQAARFPAHFSLTTLLLYSPHCLRRIQRYIRNKEAYLVTGIPGREDK  707

Query  653   RLAIALQLPLLGMDPDKALLYGTRSGGKRIFMAADVNIPMGAHDIYDEDELIQSLSKLIA  712
             RLA+AL +P+LGMDP  AL   T+SG KR FM ADVN+P G +DIYDEDEL+ SL+KLI 
Sbjct  708   RLAVALNVPILGMDPLSALPLMTKSGSKRFFMRADVNVPTGTYDIYDEDELVFSLAKLIM  767

Query  713   ADIDQTEWLIKIDADQSNTGIASLNVDKMQSVAKFRAEKREMKHGAAEYFQQPDVRDAVL  772
             + I+Q+ W++KID D   TG A L+V  M  + + R EK+     + EY++QP  RD   
Sbjct  768   SHIEQSVWVLKIDYDPFGTGTALLDVSTMTVLREIRREKK-----SPEYWKQPSTRDNAA  822

Query  773   RSVYSELNESYFAANVTPCFPEMYASWAAMRPIALRVGVVIEAYPSKVLSHVRTNIFIEP  832
             R++ +EL E   A  VTP  PE+Y SW        + GVV+EA PS V+ HVR N+FIEP
Sbjct  823   RAIIAEL-ERTLAHLVTPLHPEVYPSWQEFVDAISQFGVVVEAAPSAVIGHVRANLFIEP  881

Query  833   SGGVHITSAHDVFMCPVNKHLPQCA---------------VFPQSSVPYQAIRGASLAIA  877
             SG VH++S  D+     N                       FPQ++ PY+AIRGAS AI 
Sbjct  882   SGEVHVSSTQDIITTSSNSSSSGGGAGKKAGAYRSKTVGYAFPQTAAPYEAIRGASTAIG  941

Query  878   SSMFIKGIIGYASIDYISFADPKAMVSGRPRQRLWAMQVVPGLTNTAVSFVMFAFLSCSQ  937
               +  + + GY+SIDY+ F + K   +     RLWAM + P LT++A +F  F  L+   
Sbjct  942   KLLADECVFGYSSIDYLVFQEDKTHAA-----RLWAMALHPYLTDSASTFATFHLLNRGA  996

Query  938   FNPITGKSHLQVAPAPVATL---------STANAPITPTQQEIATILsppssaaaasVCG  988
              N  +G  HL    A  ++          S A      +  ++    +  S   +    G
Sbjct  997   LNASSGLYHLPPVAASPSSSSTKSLKPSHSRAAGATGTSAADLVMQEATHSGLVSLEKAG  1056

Query  989   PERTYMVLDYIYHPNMATLQFATFFNTCRLHGVSFDLQRAIGAAYILADSLTAGVVGLIC  1048
              +RTY+V +YI+HPN++T+Q++ FF+TCRLHGV FD++R +G+ ++LADSLTAGV G++C
Sbjct  1057  AQRTYVVSEYIFHPNVSTMQYSAFFHTCRLHGVCFDVERCVGSVFLLADSLTAGVFGIMC  1116

Query  1049  IGESDKEAFRIARQAVELIGDQVGVQALPNSLSG---ERLGNFPHLLAIVR  1096
               +S   A    R A+E+IG +VG QAL +   G      GNF  +LA++R
Sbjct  1117  CSDSASGALGFLRTALEVIGREVGTQALMDEFMGGGESETGNFADVLAVIR  1167

>PYAP_17746
Length=1169

 Score = 825 bits (2132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 476/1144 (42%), Positives = 679/1144 (59%), Gaps = 77/1144 (7%)

Query  1     MEKLCQQYHAEDVGRILLQAQDELRSMREKVHENN----------NLDVNQIHAILERAE  50
             ME+L Q++H EDVGRILLQ QD+LR +RE++  +N          N    +I  IL+RAE
Sbjct  1     MEQLQQRHHVEDVGRILLQTQDQLRQLREQLVGSNGPGNGSVIASNNAGAEIEEILQRAE  60

Query  51    ADLRAKAEIVLNGVVNNSMKMLPAIDAPGGQRYLSKFSSKLAQKRDLAATMARENTYEPG  110
              +LR KAE+VL+ +V        A D  GG   L      + +         +   ++ G
Sbjct  61    DELRMKAELVLSNIVTAGPASPGANDREGGLIPLPT----VRRPPIARRRRRKAELHDGG  116

Query  111   SPTYGHDTSYREH-------PSLSGPIEPMERDRTPGRRPVGRIVKAGSLVKHKTTKPRR  163
             S  Y  D  Y             S  +    R R  G  P       G +VKHKTT   R
Sbjct  117   S--YDLDIEYFRQRFKRTAVDDASSTMTTAPRQRGGGPTPTH---AHGKVVKHKTTSNAR  171

Query  164   ILPKMNRldptapppalldddaRGGVHNLLTRGFLPPSVDVTPAFT---------HGTSV  214
             +LP +N+ DPTAP P L   DA+ GV +LL RGFLPP+VD+TPAF          + TSV
Sbjct  172   LLPFVNKYDPTAPRPVLSPVDAKQGVLSLLNRGFLPPNVDLTPAFQSVSSPKSQGNPTSV  231

Query  215   IQNTRVKIYDRASQPVKSMPYTNPSGFNMASLKFDMVtptpptVA-NVPINQGGdippsk  273
             IQN  VK++ R  QPV++  Y++P  FN+A+LKFDM      T A N  I    +     
Sbjct  232   IQNGSVKLHRREEQPVRATAYSSPGNFNLATLKFDMAAVNTVTAAENRSIEPHDESEALP  291

Query  274   tsiptpiditFDGHANNAVPFRP--EQPKGGNDPSGKDCASAD----DGAGGNDSTSIHN  327
                   + I+F    + + P     E    G    G D A  +    D      + S+ +
Sbjct  292   LRAMKTVTISFHNGKSESSPRNNARESEHDGRREDGNDTAPLEREDLDVTADEAANSMED  351

Query  328   LRRNVEKIRGYNELLDTYSLHQFIIRKGKTLADTPEFISFQRTTEDLWGSVSKSIQELEA  387
             LR NVEKIRGYNELLD YSLHQFII KG+ L DTPEF SF+R  +++WGS+ + IQ LE 
Sbjct  352   LRNNVEKIRGYNELLDAYSLHQFIIHKGRALRDTPEFQSFKRVAQEIWGSIEEVIQALEI  411

Query  388   MLTNYSVPLAYVDGQKLMKIAAMDGTARGTMELLSCILNMDEVSSLMRRPGQRFKGKSGP  447
             +LT Y VPLAY+DGQ+LM +A+M+     T ELL+C++N D+V+SL+RRPGQR+KGK   
Sbjct  412   LLTRYFVPLAYIDGQRLMTLASMEMAKLSTCELLTCVVNEDQVASLIRRPGQRYKGKDRK  471

Query  448   DLAAVLLQSVWRMYITKKRLKNHHGNEDAA-VIQRIYRSYRCFSQLQQRLKSVREADLRI  506
               AA  LQ+ +RM + + R +    N  +A +IQ+ +RSY C   L++RL  VRE  L  
Sbjct  472   RRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSLRRRLAHVREERLGE  531

Query  507   WDAQMQRFRANWDSIKMQRRVVVHVPSFSSEERTRLKMENFSIQQNLQMARMCAIADPNV  566
             W A+++R R+ W  I+ QRRVV+HV S S +ERTRL MENFS++QNLQ++R+  + D NV
Sbjct  532   WKAKVRRMRSQWRDIRQQRRVVIHVASISVDERTRLSMENFSVKQNLQLSRLAGLVDQNV  591

Query  567   DIIYISPFELSPDIQKYQVRLLQLGGIADPQTRIRMLHPENVDRFPEHFSLTTVLLYSPH  626
             +I+Y++PFELS ++ +Y ++LLQL GIA+  TR+R++ PE+  +FP+HFSL T L+YSP+
Sbjct  592   EIVYVTPFELSTEVSQYFIKLLQLSGIANAHTRVRLVFPEHAAQFPQHFSLATHLIYSPN  651

Query  627   CLKKIKRFVRGKDAYIVTGNVGPEDKRLAIALQLPLLG-MDPDKALLYGTRSGGKRIFMA  685
             C+++I+R V+GK+AY+V G  GPED+RLA+ALQ+P+LG  DP   L   TRSG KR F+ 
Sbjct  652   CIRRIQRLVQGKEAYLVMGVPGPEDQRLAVALQVPILGPEDPTSILPLMTRSGSKRFFIK  711

Query  686   ADVNIPMGAHDIYDEDELIQSLSKLIAADIDQTEWLIKIDADQSNTGIASLNVDKMQSVA  745
             ADVN+P G +DIYD DEL+ SL+KLI + ++Q  WL+K+DAD   TG A L+V  M ++ 
Sbjct  712   ADVNVPTGTYDIYDIDELLFSLAKLIISHLNQNVWLLKLDADPLGTGTAILDVSLMTTLR  771

Query  746   KFRAEKREMKHGAAEYFQQPDVRDAVLRSVYSELNESYFAANVTPCFPEMYASWAAMRPI  805
               R EKR       EY++QP +RD + R++  EL E    + + P  PE++ASW      
Sbjct  772   DIRREKR-----PPEYWKQPGIRDTIARALLQEL-EREIGSLLKPSHPEIFASWKEFASA  825

Query  806   ALRVGVVIEAYPSKVLSHVRTNIFIEPSGGVHITSAHDVF-----MCPVNKHLPQCAVFP  860
                 GVV+EA P  V   +R NIFIEPSG VH+ S +DV           +  P   VFP
Sbjct  826   IPEFGVVVEALPFHVAGVIRMNIFIEPSGDVHVMSTNDVLSGNGTTLSQRQRRPAAFVFP  885

Query  861   QSSVPYQAIRGASLAIASSMFIK-GIIGYASIDYISFADPKAMVSGRPRQRLWAMQVVPG  919
             Q+ VP++AI GAS A+   ++ +    GYAS+D +  +  +++ S    +RLWA+ + P 
Sbjct  886   QTLVPHEAIVGASSAVGRVLYEEHAFCGYASVD-LQLSQEESLTSPHKAERLWAVSLFPY  944

Query  920   LTNTAVSFVMFAFLSCSQFNPITGKSHLQVAPAPVATLSTANAPITPTQQEIATILspps  979
             LT++A +F  F  L     NP TG+ +L    +            TP + + A +    S
Sbjct  945   LTDSAATFAAFHALHRGVLNPATGRYNLTARES------------TPPESDSALV---SS  989

Query  980   saaaasVCGPERTYMVLDYIYHPNMATLQFATFFNTCRLHGVSFDLQRAIGAAYILADSL  1039
                     G  R+Y V +Y++HPN++ + +  FF+TCRLHGV FD++R +G+ ++LADSL
Sbjct  990   VIGTLDRIGAPRSYAVAEYVFHPNVSIMSYNAFFHTCRLHGVCFDVERCVGSVFLLADSL  1049

Query  1040  TAGVVGLICIGESDKEAFRIARQAVELIGDQVGVQALPNSLSG-----ERLGNFPHLLAI  1094
             TAG+ G++  GES  +A +  R A E+IG +VG Q++ +  S      +  GNF  +L +
Sbjct  1050  TAGIFGVLSSGESATQALQYLRTAFEVIGREVGTQSMVSGDSDIGSSVQLSGNFAEILGL  1109

Query  1095  VRNK  1098
             +R++
Sbjct  1110  LRHR  1113

>PYIW_18793
Length=997

 Score = 759 bits (1961),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/796 (47%), Positives = 535/796 (67%), Gaps = 30/796 (4%)

Query  320   NDSTSIHNLRRNVEKIRGYNELLDTYSLHQFIIRKGKTLADTPEFISFQRTTEDLWGSVS  379
             +D+ ++  LR+NVEKIRGYNELLDTYSLHQFII KG+ + +TPEF+SF+R  +++WGSV 
Sbjct  194   DDANAMDELRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFVSFKRVAQEVWGSVD  253

Query  380   KSIQELEAMLTNYSVPLAYVDGQKLMKIAAMDGTARGTMELLSCILNMDEVSSLMRRPGQ  439
             + I+ LEA+LT Y VPLAYVDGQ+LM +AAM+  +    +LLSCI+N D+V SL+RRPGQ
Sbjct  254   EVIKALEALLTRYFVPLAYVDGQRLMTVAAMEMASYSKRDLLSCIVNEDQVGSLIRRPGQ  313

Query  440   RFKGKSGPDLAAVLLQSVWRMYITKKRL-KNHHGNEDAAVIQRIYRSYRCFSQLQQRLKS  498
             R+KGK     AAV +Q+ +RM+  +K+  +  H       IQR++R Y     L++R+KS
Sbjct  314   RYKGKDRKRRAAVTIQNFFRMWWNQKKYSRFRHHLASVVAIQRVWRVYASHDDLKRRIKS  373

Query  499   VREADLRIWDAQMQRFRANWDSIKMQRRVVVHVPSFSSEERTRLKMENFSIQQNLQMARM  558
              R+     W+A+MQR + +W  IK  RRVV+HVPSFS +ER RL  +NFS++QNLQ++R+
Sbjct  374   QRDQQHAQWEAKMQRLKRDWIRIKGNRRVVIHVPSFSVDERLRLSADNFSVKQNLQLSRL  433

Query  559   CAIADPNVDIIYISPFELSPDIQKYQVRLLQLGGIADPQTRIRMLHPENVDRFPEHFSLT  618
             C + D NVDI+Y+SPFEL+ D+ +Y ++LLQLGGIADP  R++++ PE+  RFP HFSLT
Sbjct  434   CGLVDSNVDIVYVSPFELTTDVVQYSMKLLQLGGIADPVARVKLVFPEHAPRFPTHFSLT  493

Query  619   TVLLYSPHCLKKIKRFVRGKDAYIVTGNVGPEDKRLAIALQLPLLGMDPDKALLYGTRSG  678
             T+LLYSPHCL++I+R+++ K+AY+VTG  GPEDKRLA+AL +P+LGMDP  AL   T+SG
Sbjct  494   TLLLYSPHCLRRIQRYIKNKEAYLVTGMPGPEDKRLAMALNVPILGMDPLSALPLMTKSG  553

Query  679   GKRIFMAADVNIPMGAHDIYDEDELIQSLSKLIAADIDQTEWLIKIDADQSNTGIASLNV  738
             GKR FM ADVN+P G +DIYDEDEL+ SL+KLI + I+Q+ W++KID D  +TG A L+V
Sbjct  554   GKRFFMRADVNVPTGTYDIYDEDELVFSLAKLIVSHIEQSVWVLKIDYDPFSTGTALLDV  613

Query  739   DKMQSVAKFRAEKREMKHGAAEYFQQPDVRDAVLRSVYSELNESYFAANVTPCFPEMYAS  798
               M ++ + R EKR     + EY++QP  RD   R + +EL E      VTP  PE+Y S
Sbjct  614   STMVALREIRREKR-----SPEYWRQPGTRDNAARVIIAEL-ERTLGNLVTPLHPELYPS  667

Query  799   WAAMRPIALRVGVVIEAYPSKVLSHVRTNIFIEPSGGVHITSAHDVFMCPVN--------  850
             W       ++ GVV+EA PS V+ HVR N+F+EPSG VH++S  D+ +            
Sbjct  668   WQDYADAIVQFGVVVEAAPSAVVGHVRANLFVEPSGEVHVSSTQDILLSSSGGCGGKPGG  727

Query  851   --KHLPQCAVFPQSSVPYQAIRGASLAIASSMFIKGIIGYASIDYISFADPKAMVSGRPR  908
               +H      FPQ++ PY+AIRGAS AI   +    + GYASID++ F + K+  +    
Sbjct  728   AYRHKSVGYAFPQTAAPYEAIRGASTAIGKLLAEDNVFGYASIDFLVFQEDKSHTA----  783

Query  909   QRLWAMQVVPGLTNTAVSFVMFAFLSCSQFNPITGKSHL---QVAPAPVATLSTANAPIT  965
              RLWAM + P LT++A +F  F  L+    N  +G  +L    V  A +  L +++A   
Sbjct  784   -RLWAMALRPYLTDSAATFTTFHLLNRGALNTTSGLYYLPAATVTSASLVQLQSSSAAFA  842

Query  966   PTQQEIATILsppssaaaasV--CGPERTYMVLDYIYHPNMATLQFATFFNTCRLHGVSF  1023
                     +L   + +   S+   G + TY+V +YI+HPN++T+Q++ FF+TCRLHGV F
Sbjct  843   SGASAADLVLHEATHSGLVSLEKVGAQHTYVVSEYIFHPNVSTMQYSAFFHTCRLHGVCF  902

Query  1024  DLQRAIGAAYILADSLTAGVVGLICIGESDKEAFRIARQAVELIGDQVGVQALPNSLS--  1081
             D++R +G+ ++LADSLTAGV GL+C  ++   A    R A+E++G +VG QAL +  +  
Sbjct  903   DVERCVGSVFLLADSLTAGVFGLMCCSDTASGALGFLRTALEVVGREVGTQALTDEFTSG  962

Query  1082  GE-RLGNFPHLLAIVR  1096
             GE   GNF  +LA +R
Sbjct  963   GEAETGNFADVLAAIR  978

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 69/90 (77%), Gaps = 3/90 (3%)

Query  163  RILPKMNRldptapppalldddaRGGVHNLLTRGFLPPSVDVTPAF--THGTSVIQNTRV  220
            R+LP +N+ DP+AP P L + DA+ G+ +L+ RGFLP   D+T AF  +HG  +IQN + 
Sbjct  6    RLLPSVNKCDPSAPTPELSEQDAKNGMLSLVNRGFLPVGTDLTSAFVNSHG-GIIQNHKT  64

Query  221  KIYDRASQPVKSMPYTNPSGFNMASLKFDM  250
            +IYDR  QP++++P+TNPSGFN+A+LKFD+
Sbjct  65   RIYDRQEQPIRAVPHTNPSGFNIATLKFDL  94

>PYU1_G001734
Length=800

 Score = 751 bits (1939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/793 (47%), Positives = 527/793 (66%), Gaps = 36/793 (5%)

Query  327   NLRRNVEKIRGYNELLDTYSLHQFIIRKGKTLADTPEFISFQRTTEDLWGSVSKSIQELE  386
             +LR+NVEKIRGYNELLDTYSLHQFII KGK + +TPEF+SF+R  +++WG V + I+ LE
Sbjct  3     DLRKNVEKIRGYNELLDTYSLHQFIIHKGKAMRETPEFVSFKRVAQEIWGGVEEVIKALE  62

Query  387   AMLTNYSVPLAYVDGQKLMKIAAMDGTARGTMELLSCILNMDEVSSLMRRPGQRFKGKSG  446
              +LT Y VPLAYVDGQ+LM +A+M+  +    +LLSCI+N D+V SL+RRPGQR+KGK  
Sbjct  63    TLLTRYFVPLAYVDGQRLMTVASMEMASFSKQDLLSCIVNEDQVGSLIRRPGQRYKGKDR  122

Query  447   PDLAAVLLQSVWRMYITKKRLKNHHGNEDAAV-IQRIYRSYRCFSQLQQRLKSVREADLR  505
                AA+ +Q+V+RM+  +K+   +  +  + V IQ+++R+Y     L+++LK+ R+    
Sbjct  123   KRRAAITIQNVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAYASHEDLRRKLKAQRQQQHE  182

Query  506   IWDAQMQRFRANWDSIKMQRRVVVHVPSFSSEERTRLKMENFSIQQNLQMARMCAIADPN  565
              W+A+MQR +  W  IK  RRV++HVPS S +ER R++ +NF+++QNLQ++R+C I D N
Sbjct  183   QWEARMQRLQREWPRIKANRRVIIHVPSLSIDERFRIRADNFAVKQNLQLSRLCGIIDAN  242

Query  566   VDIIYISPFELSPDIQKYQVRLLQLGGIADPQTRIRMLHPENVDRFPEHFSLTTVLLYSP  625
             VDI+Y+SPFEL+ ++ +Y ++LLQLGGIADP TR++++ PE   RFP HFSLTTVLLYSP
Sbjct  243   VDIVYVSPFELTSEVGQYFMKLLQLGGIADPVTRVKLVFPEQATRFPAHFSLTTVLLYSP  302

Query  626   HCLKKIKRFVRGKDAYIVTGNVGPEDKRLAIALQLPLLGMDPDKALLYGTRSGGKRIFMA  685
             HCL++I+R V+GK+AY+VTG  G EDKRLA+AL +P+LGMDP   L   T+SG KR FM 
Sbjct  303   HCLRRIRRCVKGKEAYLVTGMPGQEDKRLAMALNVPILGMDPLATLPLMTKSGSKRFFMR  362

Query  686   ADVNIPMGAHDIYDEDELIQSLSKLIAADIDQTEWLIKIDADQSNTGIASLNVDKMQSVA  745
             ADVN+P G +DIYDEDELI SL+KLI + I+Q  WL+KID D   TG A ++   + ++ 
Sbjct  363   ADVNVPTGTYDIYDEDELIFSLAKLIVSHIEQNVWLLKIDYDPFGTGTAIVDASVVTALR  422

Query  746   KFRAEKREMKHGAAEYFQQPDVRDAVLRSVYSELNESYFAANVTPCFPEMYASWAAMRPI  805
             + R EK+     + EY++QP  RD   R + +EL E      VTP  PE+Y +W      
Sbjct  423   EIRREKK-----SPEYWRQPGTRDNAARMIIAEL-ERTIGKLVTPLHPEVYPTWQEFADA  476

Query  806   ALRVGVVIEAYPSKVLSHVRTNIFIEPSGGVHITSAHDVFMCPVNKHLPQCA--VFPQSS  863
               + GVVIEA PS ++ ++R N+F+EPSG VH++S  DV +   + H  + A   FPQ++
Sbjct  477   IAQFGVVIEAAPSAIVGYIRANLFVEPSGEVHVSSTQDVILSTASIHKRKVAGYAFPQTT  536

Query  864   VPYQAIRGASLAIASSMFIKGIIGYASIDYISFADPKAMVSGRPRQRLWAMQVVPGLTNT  923
              PY+AIRGAS+AI   +    + GY+S+DY+ F + K  V      RLWAM + P LT++
Sbjct  537   APYEAIRGASMAIGKVLVDDSVFGYSSVDYLVFREDKTHVP-----RLWAMALHPYLTDS  591

Query  924   AVSFVMFAFLSCSQFNPITGKSHLQVAPAPVAT----------------LSTANAPITPT  967
             A +F +F  L+    N  TG+ HL   PAP A+                 S+  A  + T
Sbjct  592   ASTFAVFHLLNRGALNIHTGQYHL---PAPAASGVPSSSTASSVSLKLNASSTRAAGSAT  648

Query  968   QQEIATILsppssaaaasVCGPERTYMVLDYIYHPNMATLQFATFFNTCRLHGVSFDLQR  1027
                +    +      +    G +RTY V +YI+HPN++T+Q+++FF+TCRLHGV FD++R
Sbjct  649   SANLVLQEATHLGLVSLEKAGAQRTYAVNEYIFHPNVSTMQYSSFFHTCRLHGVCFDVER  708

Query  1028  AIGAAYILADSLTAGVVGLICIGESDKEAFRIARQAVELIGDQVGVQALPNSLSGE---R  1084
               G  ++LADSLTAGV G+IC G++   A    R A+E+IG +VG QAL + L G     
Sbjct  709   CFGTIFMLADSLTAGVFGIICCGDTASAALGFLRTALEVIGREVGTQALTDDLRGGGDCE  768

Query  1085  LGNFPHLLAIVRN  1097
              GNF  +L +VR 
Sbjct  769   SGNFAEVLTVVRT  781

>PITG_18457
Length=1170

 Score = 724 bits (1868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/1183 (37%), Positives = 664/1183 (56%), Gaps = 119/1183 (10%)

Query  1     MEKLCQQYHAEDVGRILLQAQDELRSMREKVHEN-----------------NNLDVNQIH  43
             M+K+ QQ+H EDVGR+LLQ Q++LR MRE++                       +V   +
Sbjct  1     MDKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHNAIVTTAEVQAFN  60

Query  44    AILERAEADLRAKAEIVLNGVVNNSMK----------MLPAIDAPGGQRYLSKFSSKLAQ  93
             AIL++ E +LRAKAE+VLNG+VN+S            +LPA+        + +     A 
Sbjct  61    AILQQTETELRAKAELVLNGMVNSSSSARNNQAQSGTLLPAVTVAAAPSIMHRSGYDKAN  120

Query  94    K-RDLAATMARENTYEPGSPTYGHDTSYREHPSLSGPIEPMERDRTPGRRPVGRIVKAGS  152
             K R + A+           P       +R     +  +E  +    P  R  G  +  G 
Sbjct  121   KPRQMDAS---------SIPVEFFREQFR-----NNSVEIRQSLPEPWERHFG--IHHGR  164

Query  153   LVKHKTTKPRRILPKMNRldptapppalldddaRGGVHNLLTRGFLPPSVDVTPAF----  208
             L++ KTT+  R+LP +N+ DP+ P P L ++DA+ GV NL+TRGFLP   D+TP F    
Sbjct  165   LMRKKTTQHCRLLPSVNKTDPSVPTPELREEDAKHGVLNLVTRGFLPAYADLTPVFSGTS  224

Query  209   -THGTSVIQNTRVKIYDRASQPVKSMPYTNPSGFNMASLKFDM-----------------  250
                G  V++    +IY+R+ Q V+S P+T  +G+N+ASLKFD+                 
Sbjct  225   DGSGGGVMKQRATRIYNRSEQVVRSTPFTQSTGYNLASLKFDLRAPPTPPPVVPEATFPD  284

Query  251   -------------VtptpptVANVPINQGGdippsktsiptpiditFDGHANNAVPFRPE  297
                          +    P   +VPI+             + +        N        
Sbjct  285   STTRRRSTRRSSALQGPNPFTRSVPISSSKIKNGRSAHPTSLMSAAVAAFTNQGEDTENN  344

Query  298   QPKGGNDPSGKDCASADDGAGGNDSTSIHNLRRNVEKIRGYNELLDTYSLHQFIIRKGKT  357
             + +  +D    +   +D+    ++   +  L  NV+KIRGYNELLD YSLHQF+I KG+T
Sbjct  345   RDRFSDDDISDEEQESDEN-DKDEYAEMEKLGANVDKIRGYNELLDVYSLHQFLIHKGRT  403

Query  358   LADTPEFISFQRTTEDLWGSVSKSIQELEAMLTNYSVPLAYVDGQKLMKIAAMDGTARGT  417
             + DTPEF+SF+R T++LWGSV ++++ LE +L  Y VPLAYVDGQ+L+ +A         
Sbjct  404   MRDTPEFVSFRRVTQELWGSVEEALRALETLLAQYFVPLAYVDGQRLLALAGTGQPRFSK  463

Query  418   MELLSCILNMDEVSSLMRRPGQRFKGKSGPDLAAVLLQSVWRMYITKKRLKNHHGNE-DA  476
              ELLSCI+N D+V S++RRPGQR+KG+     AA  +++  RM++ ++R      ++ +A
Sbjct  464   RELLSCIVNEDQVMSVLRRPGQRYKGRDRKRRAATTIEACVRMWLVRRRYARTRASDFNA  523

Query  477   AVIQRIYRSYRCFSQLQQRLKSVREADLRIWDAQMQRFRANWDSIKMQRRVVVHVPSFSS  536
             + IQ  +R+Y C + L+ RL+ V    L  W+ +M   +++W  I  +RRVVVHVPS S 
Sbjct  524   SKIQLAWRAYSCHTSLKARLREVHLEKLEKWEKRMHNLKSHWPQIAGRRRVVVHVPSLSL  583

Query  537   EERTRLKMENFSIQQNLQMARMCAIA-DPNVD-IIYISPFELSPDIQKYQVRLLQLGGIA  594
             +E +RL  ENF+IQQNLQ+ R+CA A D NV+ ++Y+SPFEL+ D+ +Y ++LLQLGG+ 
Sbjct  584   DEHSRLGAENFAIQQNLQLTRVCAAALDSNVELLLYVSPFELTSDVSQYFLKLLQLGGLV  643

Query  595   DPQTRIRMLHPENVDRFPEHFSLTTVLLYSPHCLKKIKRFVRGKDAYIVTGNVGPEDKRL  654
             D + R++++ PE   RFP HFSL+++LLYSPHCL++I+ +  GK+AY+V G  G ED+RL
Sbjct  644   DSRPRVKLVFPEQTTRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRL  703

Query  655   AIALQLPLLGMDPDKALLYGTRSGGKRIFMAADVNIPMGAHDIYDEDELIQSLSKLIAAD  714
             A+AL LP+LG  P +AL   TRSGGKR+ + ADVN+P G +++YDE E+  +L+KL  A 
Sbjct  704   AMALDLPILGAPPAQALPLLTRSGGKRLLIRADVNVPNGTYELYDEHEVCAALAKLAIAH  763

Query  715   IDQTEWLIKIDADQSNTGIASLNVDKMQSVAKFRAEKREMKHGAAEYFQQPDVRDAVLRS  774
             +DQ  WLIK+D D  + G A +++  MQ++ + R EKR       EY++QP  RDA  + 
Sbjct  764   MDQPRWLIKLDYDPLDVGEAVVDLSNMQAMRELRREKR-----TPEYWRQPGPRDAAAKL  818

Query  775   VYSELNESYFAANV-TPCFPEMYASWAAMRPIALRVGVVIEAYP----------SKVL--  821
             + +EL      A + TP   E++  W          G V+EA P          S VL  
Sbjct  819   ILAELERPGMLARIATPMQTEIFPKWREFIDAVGHFGCVVEAVPPTAIAASSEASTVLVE  878

Query  822   -SHVRTNIFIEPSGGVHITSAHDVFMC---PVNKHLPQCAVFPQSSVPYQAIRGASLAIA  877
              ++VR N+F++P G VHI+S  +V       +N+       FPQ++ PY+AI+GA  A  
Sbjct  879   PAYVRANLFVDPDGSVHISSTQNVLAAGGGGLNRK-TVAFTFPQTAAPYEAIKGACNAAG  937

Query  878   SSMFIKGIIGYASIDYISFADPKAMVSGRPRQRLWAMQVVPGLTNTAVSFVMFAFLSCSQ  937
               +    + GY S+D++ F D K+  +  P  RLWA+ V P LT++A SF  F  L+   
Sbjct  938   KLLVETNVWGYVSLDFVVFQDEKS--NDAP--RLWALAVHPFLTDSATSFACFHLLARGV  993

Query  938   FNPITGKSHLQVAPAPVATLSTANAPITPTQQEIATILsppssaaaasVCGPERTYMVLD  997
              +  +G     V      +L+TAN+           +L   +  A +S+ G  R ++   
Sbjct  994   LDTNSG-----VYRVANKSLTTANSGRKSESGSATDLLLREALLAKSSLVGARRCFVACS  1048

Query  998   YIYHPNMATLQFATFFNTCRLHGVSFDLQRAIGAAYILADSLTAGVVGLICIGESDKEAF  1057
             Y++HP++ T+Q+  FF+ CRLHGV FD++R +G  ++LADSLTAGV G++ IGE+ + A 
Sbjct  1049  YVFHPHVITMQYTAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGILSIGETTEGAL  1108

Query  1058  RIARQAVELIGDQVG----VQALPNSLSGERLGNFPHLLAIVR  1096
                R A+E+IG + G    V + P+     R GNF  +L+ +R
Sbjct  1109  AFLRTALEVIGREAGSTISVASSPSRSVASRSGNFAQILSAIR  1151

>PHALS_06477
Length=1166

 Score = 707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/1153 (37%), Positives = 643/1153 (56%), Gaps = 79/1153 (7%)

Query  1     MEKLCQQYHAEDVGRILLQAQDELRSMRE---------------KVHEN--NNLDVNQIH  43
             MEK+ Q YH EDVGR+LL+ Q++LR+MRE               K H +   N +V   H
Sbjct  16    MEKVQQHYHVEDVGRLLLETQEQLRAMREQMTAAAASMEANKSPKRHSSVITNAEVQAFH  75

Query  44    AILERAEADLRAKAEIVLNGVVNNSMKMLPAIDAPGGQRYLSKFSSKLAQKRDLAATMAR  103
             A+L++ E++LRAKAE+VLNG++N+S     ++     QR     +++L      A +  +
Sbjct  76    ALLQQTESELRAKAELVLNGIINSS----NSVHNSQVQR-----NTRLPAVSVAAPSPIK  126

Query  104   ENTYEPGSPTYGHDTSYREHP-SLSGPIEPMERDRTPGRR-----PVGRIVKAGSL-VKH  156
                 +  +  +GH      +  S+    +    +R   R+     P     K+G+  V+ 
Sbjct  127   HRRGDSRADEFGHINRIDNNSTSMEFFRQQFRNNRVEIRQSLMTSPENWRRKSGARRVRK  186

Query  157   KTTKPRRILPKMNRldptapppalldddaRGGVHNLLTRGFLPPSVDVTPAFT-------  209
             KTT+  R+LP +N+ DP+ P P L ++DA  G+ NL+TRGFLP   D+TPAF        
Sbjct  187   KTTQHYRLLPCVNKADPSEPTPDLREEDATCGLLNLVTRGFLPAYADLTPAFAGPNGKSN  246

Query  210   -HGTSVIQNTRVKIYDRASQPVKSMPYTNPSGFNMASLKFDMVtptpptVANVPINQGGd  268
               G   +++    IYDR+ +  +  P     GFN+A LKFD  T + P+ A  P +    
Sbjct  247   GSGGCALKHRATYIYDRSKRSARCTPLVYSIGFNLAGLKFDFRTSSTPSSAPKPNHSATV  306

Query  269   ippsktsiptpiditFDGHANNAVPFRPEQPKGGNDPSGKDCASA----DDGAGGNDST-  323
                   +  + I  T               P+  N+    +C  +    +D  G +DS  
Sbjct  307   SASMPNTKFSSIMQTVSSGPAKRNSLVVAAPRNQNEDIENNCTHSFEDQEDEEGSDDSDI  366

Query  324   ------SIHNLRRNVEKIRGYNELLDTYSLHQFIIRKGKTLADTPEFISFQRTTEDLWGS  377
                   S  +L  NV KIR YN+L+D YSLHQ +I KG+ + DTPEF SF+R   DLWGS
Sbjct  367   IKDEGFSTKDLAVNVAKIREYNDLVDAYSLHQILIYKGRAIRDTPEFTSFRRVVHDLWGS  426

Query  378   VSKSIQELEAMLTNYSVPLAYVDGQKLMKIAAMDGTARGTMELLSCILNMDEVSSLMRRP  437
             V + ++ LEA+L  Y VPLA+VDGQ+L+ +A+ +       ELLSCI+N ++V S++RRP
Sbjct  427   VEEVLRALEAILFQYFVPLAHVDGQRLIALASTNQPQFSRRELLSCIVNKEQVMSVLRRP  486

Query  438   GQRFKGKSGPDLAAVLLQSVWRMYITKKR-LKNHHGNEDAAVIQRIYRSYRCFSQLQQRL  496
             GQR+ G+     AA  +Q+  RM++   R +K+   N +A  IQ  +R+Y   + L+ RL
Sbjct  487   GQRYNGRDRKHRAATTIQACARMWMVHHRYVKSRSSNINAIKIQSAFRAYSRCTALKARL  546

Query  497   KSVREADLRIWDAQMQRFRANWDSIKMQRRVVVHVPSFSSEERTRLKMENFSIQQNLQMA  556
             + +R      W+A+M  F++ W  I  +RR+VVHVPS S  E +RL  ENF++QQNLQ+ 
Sbjct  547   REIRCEKAAKWEARMYEFKSQWSQIAARRRIVVHVPSMSLGEHSRLNAENFAVQQNLQLT  606

Query  557   RMCAIA-DPNVDI-IYISPFELSPDIQKYQVRLLQLGGIADPQTRIRMLHPENVDRFPEH  614
             R+CA A D  VD+ +Y+SP+EL+ D+ +Y  +LLQL G AD + R++ ++PE   RFP H
Sbjct  607   RICAAALDLQVDLLVYVSPYELTADVSQYFHKLLQLSGPADSRPRVKFVYPEQAARFPAH  666

Query  615   FSLTTVLLYSPHCLKKIKRFVRGKDAYIVTGNVGPEDKRLAIALQLPLLGMDPDKALLYG  674
             FSL++++LYSP+CL++I+ +  G +AY+V G  GPED+RLAI L LP+LG  P +AL   
Sbjct  667   FSLSSLILYSPYCLRRIRHYTAGNEAYLVMGLPGPEDQRLAITLDLPILGALPSQALPLL  726

Query  675   TRSGGKRIFMAADVNIPMGAHDIYDEDELIQSLSKLIAADIDQTEWLIKIDADQSNTGIA  734
             TRSGGKR+ + AD+N+P G +++YDE E+  +L+KL  A IDQ++WLIK+D D    G A
Sbjct  727   TRSGGKRLLIQADINVPTGTYELYDEHEISVALAKLAVAHIDQSKWLIKLDYDPLGVGEA  786

Query  735   SLNVDKMQSVAKFRAEKREMKHGAAEYFQQPDVRDAVLRSVYSELNE-SYFAANVTPCFP  793
              +++  MQ++ +   EKR       EY++QP  RDA      +E       A   TP   
Sbjct  787   VVDLSSMQAMRELHREKR-----TPEYWRQPGTRDAAANLFLTEFERPGKLARLTTPIHT  841

Query  794   EMYASWAAMRPIALRVGVVIEAYPSKVL-------SHVRTNIFIEPSGGVHITSAHDVFM  846
             E+Y +W          G VIEA P           +++R NIF++P+G VH+TS  +V  
Sbjct  842   ELYPTWREYAAAIGHFGCVIEAVPPTASAASMEEPTYLRANIFVDPNGTVHMTSTQNVLT  901

Query  847   CPVN--KHLPQCAVFPQSSVPYQAIRGASLAIASSMFIKGIIGYASIDYISFADPKAMVS  904
                       +   FPQ+  P+ AI+GA  A+   +    + GY S+D++ F D K+  +
Sbjct  902   TTRGGLSRKSEIFAFPQTVAPHAAIKGACNAVGKQLAETNVWGYVSLDFVVFQDIKSNAA  961

Query  905   GRPRQRLWAMQVVPGLTNTAVSFVMFAFLSCSQFNPITGKSHLQVAPAPVATLSTANAPI  964
                  RLWA+ + P LTN+A +F  F  L+    +  +G   +   P     L TA    
Sbjct  962   ----VRLWALAIHPFLTNSAATFACFHLLTRGCLDANSG---IYRVPG-TKKLQTACTAE  1013

Query  965   TPTQQEIATILsppssaaaasVCGPERTYMVLDYIYHPNMATLQFATFFNTCRLHGVSFD  1024
                  +   +L   +S   A   G  R Y+V  Y++HPN+   Q+ TFF  CRLHGV FD
Sbjct  1014  QSGNHDAMDLLLREASLTKAIFQGATRCYVVCSYVFHPNVTATQYTTFFQNCRLHGVCFD  1073

Query  1025  LQRAIGAAYILADSLTAGVVGLICIGESDKEAFRIARQAVELIGDQVG-VQALPNSLSGE  1083
             + RA+G  ++LADSLTAGV G++ IGE+ ++A    R A+E+IG + G  + + +S S  
Sbjct  1074  VSRALGTLFLLADSLTAGVFGILSIGETAQDALSYLRTALEVIGREAGATKGIVSSSSRS  1133

Query  1084  RLGNFPHLLAIVR  1096
              LGNF  +L+ VR
Sbjct  1134  VLGNFADVLSTVR  1146

>PHYRA_95901
Length=1075

 Score = 700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/1144 (37%), Positives = 650/1144 (57%), Gaps = 136/1144 (12%)

Query  1     MEKLCQQYHAEDVGRILLQAQDELRSMREKVHEN-----------------NNLDVNQIH  43
             MEK+ QQ+H EDVGR+LLQ Q++LR MRE++                       +V   +
Sbjct  1     MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSAVVTTAEVQAFN  60

Query  44    AILERAEADLRAKAEIVLNGVVNNSMK----------MLPAID--APGGQRYLSKFSSKL  91
             AIL++ E +LRAKAE+VL G+VN+S            +LP +   AP   R+ S +    
Sbjct  61    AILQQTEVELRAKAELVLKGMVNSSSSAQTNQSQSGTLLPVVTVAAPPSTRHRSGY----  116

Query  92    AQKRDLAATMARENTYEPGSPTYGHDTSYREHPSLSGPIEPMERDRTPGRRPVGRIVKAG  151
                  +     RE           H++S     SL     P    R  G       ++ G
Sbjct  117   GDASSIPIEFFREQF---------HNSSVEVRQSLMP--SPQHWQRHLG-------IQHG  158

Query  152   SLVKHKTTKPRRILPKMNRldptapppalldddaRGGVHNLLTRGFLPPSVDVTPAFTHG  211
              L++ KTT+  R+LP +N++DPTAP P L ++DA+ GV NL+TR         +     G
Sbjct  159   RLLRKKTTQHCRLLPSVNKVDPTAPTPELREEDAKHGVLNLVTR---------SSGTKDG  209

Query  212   TSVIQNTRVKIYDRASQPVKSMPYTNPSGFNMASLKFDMVtptpptVANVPINQGGdipp  271
             + V++    +IYDR+ QP ++ P+T  +G+N+A+LKFD+ +                   
Sbjct  210   SGVMKQRATRIYDRSEQPARATPFTQSTGYNLAALKFDLRSTGTGK--------------  255

Query  272   sktsiptpiditFDGHANNAVPFRPEQPKGGNDPSGKDCASADDGAGGNDSTSIHNLRRN  331
                          +  +N+ +    E   G  + S +D   AD+    ++   +  L  N
Sbjct  256   -------------NDRSNDDMEGNREHIDG--EISDEDQGGADNDK--DEEAEMEELGAN  298

Query  332   VEKIRGYNELLDTYSLHQFIIRKGKTLADTPEFISFQRTTEDLWGSVSKSIQELEAMLTN  391
             V+KIRGYN+LLD YSLHQF+I KG+++ DTPEF+SF+R  ++LWGSV ++++ LE +LT 
Sbjct  299   VDKIRGYNDLLDAYSLHQFLIHKGRSMRDTPEFVSFRRVAQELWGSVEEALRALETLLTQ  358

Query  392   YSVPLAYVDGQKLMKIAAMDGTARGTMELLSCILNMDEVSSLMRRPGQRFKGKSGPDLAA  451
             Y VPLAYVDGQ+L+ +AA         ELL+CI+N ++V S++RRPGQR+KG+     AA
Sbjct  359   YFVPLAYVDGQRLLSLAATGQPRFSKSELLACIVNEEQVMSVLRRPGQRYKGRDRKRRAA  418

Query  452   VLLQSVWRMYITKKR-LKNHHGNEDAAVIQRIYRSYRCFSQLQQRLKSVREADLRIWDAQ  510
               +Q+  RM+  ++R +++   +  A  IQ  +RSY C + L+ RL+ VR   L  W+A+
Sbjct  419   TTIQACVRMWSIRRRYVRSRASDISATRIQLAWRSYSCHAALKTRLREVRREQLERWEAR  478

Query  511   MQRFRANWDSIKMQRRVVVHVPSFSSEERTRLKMENFSIQQNLQMARMCAIA-DPNVDI-  568
             MQ  R  W  I  +RRVVVHVPS S +E +RL  ENF++QQNLQ+ R+CA A D +VD+ 
Sbjct  479   MQDLRTQWPQIAGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSHVDLL  538

Query  569   IYISPFELSPDIQKYQVRLLQLGGIADPQTRIRMLHPENVDRFPEHFSLTTVLLYSPHCL  628
             +Y+SPFEL+ D+ +Y ++LLQLGG+AD + R++++ PE   RFP+HFSL+++LLYSPHCL
Sbjct  539   VYVSPFELTADVSQYFLKLLQLGGLADSRPRVKLVFPEQAARFPDHFSLSSLLLYSPHCL  598

Query  629   KKIKRFVRGKDAYIVTGNVGPEDKRLAIALQLPLLGMDPDKALLYGTRSGGKRIFMAADV  688
             ++I+ +  GK+AY+V G  G ED+RLA+AL LP+LG  P +AL   TRSGGKR+ + ADV
Sbjct  599   RRIRHYTAGKEAYLVMGLPGAEDQRLAVALDLPILGAPPAQALPLLTRSGGKRLLIRADV  658

Query  689   NIPMGAHDIYDEDELIQSLSKLIAADIDQTEWLIKIDADQSNTGIASLNVDKMQSVAKFR  748
             N+P G +++YDE EL  +L+KL  A ++Q +WL+K+D D    G A +++  MQ++ + R
Sbjct  659   NVPTGTYELYDEHELFAALAKLAVAHMEQPKWLLKLDYDPLGIGEAVVDLSGMQAMRELR  718

Query  749   AEKREMKHGAAEYFQQPDVRDAVLRSVYSELNE-SYFAANVTPCFPEMYASWAAMRPIAL  807
              EKR       EY++QP  RDA  + V +EL      A   TP   E++ +W        
Sbjct  719   REKR-----TPEYWRQPGPRDAAAKLVLAELERPGVLARLATPMHTEIFPAWRDFTEAIG  773

Query  808   RVGVVIEAYP----------SKVL---SHVRTNIFIEPSGGVHITSAHDVFMCPVNKHLP  854
               G VIEA P          S +L   ++VR N+F+ P G   + S+       +N+   
Sbjct  774   HFGCVIEAVPPAGIAATPESSSLLVEPAYVRANLFVYPDGKNVLASSGG----GLNRK-T  828

Query  855   QCAVFPQSSVPYQAIRGASLAIASSMFIKGIIGYASIDYISFADPKAMVSGRPRQRLWAM  914
                 FPQ++ P++A++GA  A    +    + GY S+D++ F D K    G P  RLWA+
Sbjct  829   VAFTFPQTAAPHEAVQGACDATGKLLVETSVWGYVSLDFVVFQDEKN--GGSP--RLWAL  884

Query  915   QVVPGLTNTAVSFVMFAFLSCSQFNPITGKSHLQVAPAPVATLSTANAPITPTQQEIATI  974
              V P LT++A SF  F  L+   +      S +   P    +   A+            +
Sbjct  885   AVHPFLTDSAASFACFHLLARGAYRVAASNSMVNANPGRSGSGGAAD------------L  932

Query  975   LsppssaaaasVCGPERTYMVLDYIYHPNMATLQFATFFNTCRLHGVSFDLQRAIGAAYI  1034
             L   +S   A++ G  R ++V  Y++HP++ T+Q++ FF+ CRLHGV FD++R +G  ++
Sbjct  933   LLREASLTKAALAGAPRCFVVCSYVFHPHVTTMQYSAFFHACRLHGVCFDVERTLGTLFL  992

Query  1035  LADSLTAGVVGLICIGESDKEAFRIARQAVELIGDQVG--VQALPNSLSGERLGNFPHLL  1092
             LADSLTAGV G++ +GE+ + A    R A+E+IG +VG  ++   +     R GNF  +L
Sbjct  993   LADSLTAGVFGILSVGETTEGALAFLRTALEVIGREVGATIEMATSRPVSTRNGNFAQVL  1052

Query  1093  AIVR  1096
             + VR
Sbjct  1053  SAVR  1056

>PHYSO_321157
Length=1180

 Score = 638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/788 (42%), Positives = 485/788 (62%), Gaps = 35/788 (4%)

Query  331   NVEKIRGYNELLDTYSLHQFIIRKGKTLADTPEFISFQRTTEDLWGSVSKSIQELEAMLT  390
             NV+KIRGYNELLD YSLHQF+I KG+T+ DTPEF+SF+R  ++LWGSV ++++ LE +LT
Sbjct  387   NVDKIRGYNELLDAYSLHQFLIHKGRTMRDTPEFVSFRRVAQELWGSVEEALRALETLLT  446

Query  391   NYSVPLAYVDGQKLMKIAAMDGTARGTMELLSCILNMDEVSSLMRRPGQRFKGKSGPDLA  450
              Y VPLAY DGQ+L+ +A+         ELLSCI+N ++V +++RRPGQR+KG+     A
Sbjct  447   QYFVPLAYADGQRLLSLASTGQPRFSKRELLSCIVNEEQVMAVLRRPGQRYKGRDRKRRA  506

Query  451   AVLLQSVWRMYITKKR-LKNHHGNEDAAVIQRIYRSYRCFSQLQQRLKSVREADLRIWDA  509
             A  +Q+  RM+  ++R +++   +  A  IQ  +R++ C + L+ RL+ +R   L  W+A
Sbjct  507   ATTIQACVRMWSIRRRYVRSRASDFSATKIQLAWRAFSCHAALKARLRELRREQLDNWEA  566

Query  510   QMQRFRANWDSIKMQRRVVVHVPSFSSEERTRLKMENFSIQQNLQMARMCAIA-DPNVDI  568
             +M   +  W  I  +RRVVVHVPS S +E +RL  ENF++QQNLQ+ R+CA A D NVD+
Sbjct  567   KMNDLKTQWHQIAGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSNVDL  626

Query  569   -IYISPFELSPDIQKYQVRLLQLGGIADPQTRIRMLHPENVDRFPEHFSLTTVLLYSPHC  627
              +Y++PFEL+ D+  Y ++LLQLGG+AD + R++++ PE   RFP HFSL++VLLYSPHC
Sbjct  627   LVYVAPFELTADVSHYFLKLLQLGGLADSRPRVKLVFPEQAARFPAHFSLSSVLLYSPHC  686

Query  628   LKKIKRFVRGKDAYIVTGNVGPEDKRLAIALQLPLLGMDPDKALLYGTRSGGKRIFMAAD  687
             L++I+ +  GKDAY+V G  G ED+RLAIAL LP+LG  P +AL   TRSGGKR+ + AD
Sbjct  687   LRRIRHYTAGKDAYLVMGLPGTEDQRLAIALDLPILGAPPPQALPLLTRSGGKRLLIRAD  746

Query  688   VNIPMGAHDIYDEDELIQSLSKLIAADIDQTEWLIKIDADQSNTGIASLNVDKMQSVAKF  747
             VN+P G +++YDE EL  +L+KL  A +DQ  WL+K+D D    G A +++  MQ++ + 
Sbjct  747   VNVPTGTYELYDEHELFAALAKLAVAHMDQPRWLLKLDYDPLGVGEAVVDLSGMQAMREL  806

Query  748   RAEKREMKHGAAEYFQQPDVRDAVLRSVYSELNE-SYFAANVTPCFPEMYASWAAMRPIA  806
             R EK+       EY++QP  RDA  + V +EL      A   TP   E++ SW       
Sbjct  807   RREKK-----TPEYWRQPGPRDAASKLVLAELERPGVLARLATPMHTEIFPSWREYTEAI  861

Query  807   LRVGVVIEAYPSKVL-------------SHVRTNIFIEPSGGVHITSAHDVFMCPVNKHL  853
                G V+EA P                 ++VR N+FI+P G VHITS  +V       + 
Sbjct  862   SHFGCVVEAVPPTSFVASPETASSSVEPAYVRANLFIDPDGTVHITSTQNVLASGGGLNR  921

Query  854   PQCA-VFPQSSVPYQAIRGASLAIASSMFIKGIIGYASIDYISFADPKAMVSGRPRQRLW  912
                A  FPQ+  P++A++GA  A    +    + GY S+D++ F D K+   G P  RLW
Sbjct  922   KTVAFTFPQTVAPHEAVKGACTAAGKLLVETNVWGYVSLDFVVFQDDKS--GGAP--RLW  977

Query  913   AMQVVPGLTNTAVSFVMFAFLSCSQFNPITGKSHLQVAPAPVATLSTANAPITPTQQEIA  972
             A+ V P LT++A SF  F  L+    +  +G   +  A + +A +++  +          
Sbjct  978   ALAVHPFLTDSAASFACFHLLARGVLDASSGGYRMAAANSTLAAVNSGRS----GGGGTT  1033

Query  973   TILsppssaaaasVCGPERTYMVLDYIYHPNMATLQFATFFNTCRLHGVSFDLQRAIGAA  1032
              +L   +S A  +  G  R Y+V  Y++HP++ T+Q+  FF+ CRLHGV FD++R +G  
Sbjct  1034  DLLLREASLAKGAQAGTPRCYVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTL  1093

Query  1033  YILADSLTAGVVGLICIGESDKEAFRIARQAVELIGDQVG----VQALPNSLSGERLGNF  1088
             ++L DSLTAGV G++ +GE+   A    R A+E+IG + G    +   P+     R GNF
Sbjct  1094  FLLTDSLTAGVFGVLSVGETTDGALAFMRTALEVIGREAGATVEMATSPSRPGSARSGNF  1153

Query  1089  PHLLAIVR  1096
               +L+ VR
Sbjct  1154  AQVLSAVR  1161

 Score = 129 bits (324),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 103/287 (36%), Positives = 156/287 (54%), Gaps = 51/287 (18%)

Query  1    MEKLCQQYHAEDVGRILLQAQDELRSMREKVHEN-----------------NNLDVNQIH  43
            MEK+ QQ+H EDVGR+LLQ Q++LR MRE++                       +V   +
Sbjct  1    MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSAVVTTAEVQAFN  60

Query  44   AILERAEADLRAKAEIVLNGVVNNSM----------KMLPAID--APGGQRYLSKFSSKL  91
            AIL++ EA+LRAKAE+VLNG+VN+S            +LPA+   AP   R+ S ++   
Sbjct  61   AILQQTEAELRAKAELVLNGMVNSSSSAQNNQSQSGTLLPAVTVAAPPSTRHRSGYAKPR  120

Query  92   AQKRDLAATMARENTYEPGSPTYGHDTSYREHPSLSGPIEPMERDRTPGRRPVGRIVKAG  151
              K   A+++  E   E        ++S     +L     P+   R  G       +  G
Sbjct  121  VAKSMDASSIPMEFFRE-----QFRNSSVEVRQTLMP--SPLHLQRHLG-------IHHG  166

Query  152  SLVKHKTTKPRRILPKMNRldptapppalldddaRGGVHNLLTRGFLPPSVDVTPAFT--  209
             L++ KTT+  R+LP +N++DP+AP P L ++DA+ GV NL+TRGFLP   D+TPAF   
Sbjct  167  RLMRKKTTQHCRLLPSVNKVDPSAPTPELREEDAKHGVLNLVTRGFLPAYADLTPAFAGP  226

Query  210  ------HGTSVIQNTRVKIYDRASQPVKSMPYTNPSGFNMASLKFDM  250
                   G  V++    +I+DR+ Q V+  P+T  +G+N+A+LKFD+
Sbjct  227  SGANDGSGGGVMKQRATRIHDRSEQSVRPTPFTQSTGYNLAALKFDL  273

>PPTG_17128
Length=1177

 Score = 625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/819 (42%), Positives = 506/819 (62%), Gaps = 45/819 (5%)

Query  303   NDPSGKDCASADDGAGGNDSTSIHNLRRNVEKIRGYNELLDTYSLHQFIIRKGKTLADTP  362
             +D S +D    +D  G ++   +  L  NV+KIRGYNELLD YSLHQF+I KG+T+ DTP
Sbjct  360   DDVSDED--QENDENGKDEDAEMEELGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTP  417

Query  363   EFISFQRTTEDLWGSVSKSIQELEAMLTNYSVPLAYVDGQKLMKIAAMDGTARGTMELLS  422
             EFISF+R  ++LWGSV ++++ LEA+LT Y VPLAYVDGQ+L+ +A          ELLS
Sbjct  418   EFISFRRVAQELWGSVEEALRALEALLTQYFVPLAYVDGQRLLALAGTGQPRFSKRELLS  477

Query  423   CILNMDEVSSLMRRPGQRFKGKSGPDLAAVLLQSVWRMYITKKRLKNHHGNE-DAAVIQR  481
             CI+N D++ S++RRPGQR+KG+     AA  +Q+  RM++ ++R      ++ +A  IQ 
Sbjct  478   CIVNEDQIMSVLRRPGQRYKGRDRKRRAATTVQACIRMWLVRRRYARSRASDINATKIQL  537

Query  482   IYRSYRCFSQLQQRLKSVREADLRIWDAQMQRFRANWDSIKMQRRVVVHVPSFSSEERTR  541
              +R+Y C + L+ RL+ VR   L  W+ +M   ++ W  I  +RRVVVHVPS S +E  R
Sbjct  538   AWRAYSCHTALKTRLREVRREKLEKWEKRMCTLKSQWSQIAARRRVVVHVPSLSLDEHYR  597

Query  542   LKMENFSIQQNLQMARMCAIA-DPNVDI-IYISPFELSPDIQKYQVRLLQLGGIADPQTR  599
             L  ENF++QQNLQ+ R+CA+A D NVD+ +Y+SPFEL+ D+ +Y ++LLQLGG+ D   R
Sbjct  598   LSAENFAVQQNLQLTRVCAVALDSNVDLLVYVSPFELTADVLQYFLKLLQLGGLVDSGPR  657

Query  600   IRMLHPENVDRFPEHFSLTTVLLYSPHCLKKIKRFVRGKDAYIVTGNVGPEDKRLAIALQ  659
             ++ + PE   RFP HFSL+++LLYSPHCL++I+ +  GK+AY+V G  G ED+RLAIAL 
Sbjct  658   VKFVFPEQSTRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAIALD  717

Query  660   LPLLGMDPDKALLYGTRSGGKRIFMAADVNIPMGAHDIYDEDELIQSLSKLIAADIDQTE  719
             LP+LG  P +AL   TRSGGKR+ + ADVN+P G +++YDE EL  +L+KL  A +DQ +
Sbjct  718   LPILGAPPAQALPLLTRSGGKRLLIRADVNVPNGTYELYDEHELCAALAKLAIAHMDQPK  777

Query  720   WLIKIDADQSNTGIASLNVDKMQSVAKFRAEKREMKHGAAEYFQQPDVRDAVLRSVYSEL  779
             WLIK+D D    G A +++  +Q++ + R EKR       EY++QP  RDA  + + +EL
Sbjct  778   WLIKLDYDPLGVGEAVVDLSNIQAMRELRREKR-----TPEYWRQPGPRDAAAKMILAEL  832

Query  780   NESYFAANV-TPCFPEMYASWAAMRPIALRVGVVIEAYPSKVL-------------SHVR  825
                   A +  P   EM+ +W          G VIEA P   +             ++VR
Sbjct  833   ERPGMLARLAAPMHSEMFPTWRDYIDAVGHFGCVIEAVPPTAIAASPEASTALVEPAYVR  892

Query  826   TNIFIEPSGGVHITSAHDVFMC---PVNKHLPQCAVFPQSSVPYQAIRGASLAIASSMFI  882
              N+F++P G VH+TS  +V       +N+       FPQ++ P++AI+GA  A    +  
Sbjct  893   ANLFVDPDGSVHVTSTQNVLATGGGGLNRKT-VAFTFPQTAAPHEAIKGACNAAGKLLVE  951

Query  883   KGIIGYASIDYISFADPKAMVSGRPRQRLWAMQVVPGLTNTAVSFVMFAFLSCSQFNPIT  942
               + GY S+D++ F D K+  +G P  RLWA+ V P LT++A SF  F  L+    +  +
Sbjct  952   TNVWGYVSLDFVVFQDEKS--NGAP--RLWALAVHPFLTDSAASFACFHLLARGVLDTNS  1007

Query  943   GKSHLQVAPAPVATLSTANAPITPTQQEIATILsppssaaaasVCGPERTYMVLDYIYHP  1002
             G    +VA   + T++  N     T      +L   +S A  S+ G  R ++V  Y++HP
Sbjct  1008  GA--YRVASKSLTTVTGRNGSGCTTD-----LLLREASLAKDSLAGAPRCFVVCSYVFHP  1060

Query  1003  NMATLQFATFFNTCRLHGVSFDLQRAIGAAYILADSLTAGVVGLICIGESDKEAFRIARQ  1062
             ++ T+Q+  FF+ CRLHGV FD++R +G  ++LADSLTAGV G++ IGE+ + A    R 
Sbjct  1061  HVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGVLSIGETMEGALAFLRT  1120

Query  1063  AVELIGDQVG-----VQALPNSLSGERLGNFPHLLAIVR  1096
             A+E+IG + G     V +    +SG R GNF  +L+ VR
Sbjct  1121  ALEVIGREAGSTINMVSSPSRPVSG-RSGNFAQVLSAVR  1158

 Score = 128 bits (322),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 154/288 (53%), Gaps = 51/288 (18%)

Query  1    MEKLCQQYHAEDVGRILLQAQDELRSMREKVHEN-----------------NNLDVNQIH  43
            MEK+ QQ H EDVGR+LLQ Q++LR MRE++                       +V   +
Sbjct  1    MEKVQQQQHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSAIVTTAEVQAFN  60

Query  44   AILERAEADLRAKAEIVLNGVV----------NNSMKMLPAIDAPG--GQRYLSKFSSKL  91
            AIL++ E +LR+KAE+VLNG+V            S   LPA+        ++ S ++   
Sbjct  61   AILQQTETELRSKAELVLNGMVNSSNNAQNNQTQSGNFLPAVTVAALPSTKHRSGYNGAN  120

Query  92   AQKRDLAATMARENTYEPGSPTYGHDTSYREHPSLSGPIEPMERDRTPGRRPVGRIVKAG  151
              ++  A+++  E   E        ++S     SL    EP +R            V  G
Sbjct  121  KPRQMDASSIPMEFFRE-----QFRNSSVEIRQSLMPSPEPWQRHFG---------VHHG  166

Query  152  SLVKHKTTKPRRILPKMNRldptapppalldddaRGGVHNLLTRGFLPPSVDVTPAFT--  209
             L++ KTT+  R+LP +N++DP+AP P L ++DA+ GV NL+TRGFLP   D+TPAF   
Sbjct  167  RLMRKKTTQHCRLLPSVNKVDPSAPAPELREEDAKHGVLNLVTRGFLPAYADLTPAFAGP  226

Query  210  HGTS------VIQNTRVKIYDRASQPVKSMPYTNPSGFNMASLKFDMV  251
            +GTS      +++    +IYDR+ Q V+S P+T  +G+N+ASLKFD+ 
Sbjct  227  NGTSNGSCGGIMKQRATRIYDRSEQAVRSTPFTQSTGYNLASLKFDLC  274

>PHYCA_34475
Length=692

 Score = 566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/739 (41%), Positives = 446/739 (60%), Gaps = 67/739 (9%)

Query  336   RGYNELLDTYSLHQFIIRKGKTLADTPEFISFQRTTEDLWGSVSKSIQELEAMLTNYSVP  395
             RGYNELLD YSLHQF+I KG+T+ DTPEFISF R  ++LWGSV ++++ LE +LT+Y VP
Sbjct  1     RGYNELLDAYSLHQFLIHKGRTMRDTPEFISFHRVAQELWGSVEEALRALETLLTHYFVP  60

Query  396   LAYVDGQKLMKIAAMDGTARGTMELLSCILNMDEVSSLMRRPGQRFKGKSGPDLAAVLLQ  455
             LAYVDGQ+L+ +AA         ELLSCI+N ++V + +RRPGQR+KG+     AA  +Q
Sbjct  61    LAYVDGQRLLSLAATGQPRFSKRELLSCIVNEEQVMAALRRPGQRYKGRDRKRRAATTIQ  120

Query  456   S-VWRMYITKKRLKNHHGNEDAAVIQRIYRSYRCFSQLQQRLKSVREADLRIWDAQMQRF  514
             + V      ++  ++   + +A  IQ  +R+Y C + L+ RL+ VR   L  W+A+M R 
Sbjct  121   AFVRMWAARRRYARSRARDINATRIQLAWRAYSCHAALKARLREVRREQLEKWEARMHRL  180

Query  515   RANWDSIKMQRRVVVHVPSFSSEERTRLKMENFSIQQNLQMARMCAIA-DPNVDI-IYIS  572
             ++ W  I   RRVVVHVPS S +E +RL  EN +++QNLQ+ R+CA A D  VD+ +Y+S
Sbjct  181   KSQWAQIASHRRVVVHVPSLSLDEYSRLSAENLAVRQNLQLTRICAAALDSRVDLLVYVS  240

Query  573   PFELSPDIQKYQVRLLQLGGIADPQTRIRMLHPENVDRFPEHFSLTTVLLYSPHCLKKIK  632
             PFEL+ D+ +Y ++LLQLGG+AD + R+++L PE   RFP HFSL+++LLYSPHCL++I+
Sbjct  241   PFELTTDVSQYFIKLLQLGGLADSRPRVKLLFPEQATRFPAHFSLSSLLLYSPHCLRRIR  300

Query  633   RFVRGKDAYIVTGNVGPEDKRLAIALQLPLLGMDPDKALLYGTRSGGKRIFMAADVNIPM  692
              +  GK+AY+V G  G ED+RLA+ L LP+LG  P +AL   TRSGGKR+ + ADVN+P 
Sbjct  301   HYTAGKEAYLVMGLPGAEDQRLAMTLDLPILGAPPAQALPLLTRSGGKRLLIRADVNVPA  360

Query  693   GAHDIYDEDELIQSLSKLIAADIDQTEWLIKIDADQSNTGIASLNVDKMQSVAKFRAEKR  752
             G +++YDE EL  +L+KL  A +DQ +WL K+D D    G A +++  MQ++ + R EKR
Sbjct  361   GTYELYDEHELFSALAKLAVAHMDQPKWLFKLDYDPLGVGEAVVDLSGMQAMRELRREKR  420

Query  753   EMKHGAAEYFQQPDVRDAVLRSVYSELNE-SYFAANVTPCFPEMYASWAAMRPIALRVGV  811
                    EY++QP  RDA  + V +EL      A    P   +++ SW          G 
Sbjct  421   -----TPEYWRQPGPRDAAAKLVLTELERPGTLARLAMPVHKDIFPSWLEFAEAIGHFGC  475

Query  812   VIEAYPSKVL-------------SHVRTNIFIEPSGGVHITSAHDVFMC---PVNKHLPQ  855
             VIEA P   +             +++R N+F++P G VH+TS  ++       +N+    
Sbjct  476   VIEAVPLTAIAVTPETSTALLEPAYIRANLFVDPDGSVHVTSTLNMLATGGGGLNRR-TV  534

Query  856   CAVFPQSSVPYQAIRGASLAIASSMFIKGIIGYASIDYISFADPKAMVSGRPRQRLWAMQ  915
                FPQ++ P++A++GA  A    +    + GY S+D++ F D K+  +G P  RLWA+ 
Sbjct  535   AFTFPQTAAPHEAVKGACSAAGKLLVETNVWGYVSLDFVVFQDDKS--NGAP--RLWALA  590

Query  916   VVPGLTNTAVSFVMFAFLSCSQFNPITGKSHLQVAPAPVATLSTANAPITPTQQEIATIL  975
             V P LT++A SF  F  L+    +  +G   +  A  P                      
Sbjct  591   VHPFLTDSAASFACFHLLARGVLDANSGVYRMAAASTP----------------------  628

Query  976   sppssaaaasVCGPERTYMVLDYIYHPNMATLQFATFFNTCRLHGVSFDLQRAIGAAYIL  1035
                            R ++V  Y++HP++ T+Q+  FF+ CRLHGV FD++R +G  ++L
Sbjct  629   ---------------RCFVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLL  673

Query  1036  ADSLTAGVVGLICIGESDK  1054
             ADSLTAGV G++ IGE+ +
Sbjct  674   ADSLTAGVFGVLSIGETTE  692

>CCA18898
Length=1147

 Score = 543 bits (1399),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 371/1138 (33%), Positives = 594/1138 (52%), Gaps = 139/1138 (12%)

Query  1     MEKLCQQYHAEDVGRILLQAQDELRSMREKV-------------------------HENN  35
             ME++ Q+YH EDVGRILLQ Q ELR +R ++                         +EN 
Sbjct  26    MEQVEQKYHKEDVGRILLQTQQELRDIRAEISARKQAGISHVVDAHPHREDHASLANENQ  85

Query  36    NLDVNQIHAILERAEADLRAKAEIVLNGVVNNSMKM---LPAIDAPGGQRYLSKFSSKLA  92
             + D+  +H IL+RAE +++AK +++  G  N    M   LPA+ +P   R +S  +  L+
Sbjct  86    SKDLETLHDILDRAEREIQAKVDLMFRGAANFGQMMQTGLPAVTSPP--RQVSTTTKSLS  143

Query  93    QKRDLAATMARENTYEPGSPTYGHDTSYREHPSL--SGPIEPMERDRTPGRRPVGRIVKA  150
              +  + +T   +        T   D  Y+  PS+  S  I P        +RP       
Sbjct  144   DQ--IFSTQESKVDGTRKQLTAAKD-DYKCSPSMQQSELISP--------KRPTQ-----  187

Query  151   GSLVKHKTTKPR-----RILPKMNRldptapppalldddaRGGVHNLLTRGFLP-PSVDV  204
               L+  K +K R     + LP +     +    AL D  +    H L +R   P  S+++
Sbjct  188   -GLLTSKASKKRYNVSLKSLPAVQNGHASTSSSALADQSSETA-HFLNSRHGSPLNSIEI  245

Query  205   TPAFTHGTSVIQNTRVKIYDRASQPVKSMPYTNPSGFNMASLKFDMVt-ptpptVANVPI  263
             + + T+  +++Q T  ++++R  +P+++ P T+    ++ SLKFD        +   V I
Sbjct  246   SQS-TYDRALMQRT-AQLHNRLEEPIRTTPCTSTISHDITSLKFDFSAPTILQSPGKVQI  303

Query  264   NQGGdippsktsiptpiditFDGHANNAVPFRPEQPK-------GGNDPSGKDCASADDG  316
             ++                  F+  A      R    +       G  + + K   S D  
Sbjct  304   HE--------------QVTHFNDQALGECNCRLSTNQVSMALINGFREDNSKLSPSRDHS  349

Query  317   AGGNDSTSIHNLRRNV--EKIRGYNELLDTYSLHQFIIRKGKTLADTPEFISFQRTTEDL  374
                     I + + N   E  +G N     +++HQ I+ + ++     +F SFQ    D+
Sbjct  350   KKMGIPKVIKSTKINTDTESHKGNNSSNHDFTIHQGIVDRRRS-----DFKSFQCFANDV  404

Query  375   WGSVSKSIQELEAMLTNYSVPLAYVDGQKLMKIAAMDGTARGTMELLSCILNMDEVSSLM  434
             W +V + +  LE +L+ Y +P+A+++GQ+++ ++  +       +LLSC+ N  EV  L+
Sbjct  405   WNNVEEVVTTLERLLSVYFIPIAHINGQRILTLSQENNKIITNRDLLSCVKNEHEVRMLL  464

Query  435   RRPGQRFKGKSGPDLAAVLLQSVWRMYITKKR-----LKNHHGNEDAAVIQRIYRSYRCF  489
              +PGQRF+G      AA+ +QS  RM IT +R     + NH        IQ+ +R Y  +
Sbjct  465   LKPGQRFQGVEKCTRAAMAVQSFMRM-ITFRRTYLLMISNH---RKVRAIQQNWRRYAAY  520

Query  490   SQLQQRLKSVREADLRIWDAQMQRFRANWDSIKMQRRVVVHVPSFSSEERTRLKMENFSI  549
                + +++++RE    +++  M+ F +NWD I+ QRR V+H+PS S + R R+K E FSI
Sbjct  521   KATKIKIEAIRERQDIVFNEIMRSFCSNWDKIRTQRRTVMHIPSISIDPRHRMKTEQFSI  580

Query  550   QQNLQMARMCAIADPNVDIIYISPFELSPDIQKYQVRLLQLGGIADPQTRIRMLHPENVD  609
             QQNLQ+ R+CA+ D NV++IYI PFEL+ DI +Y ++LLQL GI+D   RI+++ PEN  
Sbjct  581   QQNLQLQRLCALIDENVELIYICPFELTDDIVQYYMKLLQLAGISDAAARIKLMCPENAS  640

Query  610   RFPEHFSLTTVLLYSPHCLKKIKRFVRGKDAYIVTGNVGPEDKRLAIALQLPLLGMDPDK  669
             RFP HFSL+ V+L SPH +K++ R++RG++AY+V G  G EDKRLA  L++P+LG+DP K
Sbjct  641   RFPSHFSLSNVVLCSPHTMKRLSRYIRGRNAYLVPGFPGTEDKRLAALLRIPILGLDPAK  700

Query  670   ALLYGTRSGGKRIFMAADVNIPMGAHDIYDEDELIQSLSKLIAADIDQTEWLIKIDADQS  729
                  T SG KR F   + N   G+ D+YDE+ELI SL+KLIAA+  Q+  ++K+D D  
Sbjct  701   FFQMTTHSGIKRCFKKTNANTLPGSIDLYDENELIFSLAKLIAANPHQSSMVLKLDYDPF  760

Query  730   NTGIASLNVDKMQSVAKFRAEKREMKHGAAEYFQQPDVRDAVLRSVYSELNESYFAANVT  789
              TG A +++ ++QS+   R   R +     +Y++QP +++ ++R++  E+ +S  ++ V 
Sbjct  761   RTGTALVDISQLQSIQVLRLRTRTL-----DYWRQPPIQNKLIRNIVQEM-QSIISSLVF  814

Query  790   PCFPEMYASWAAMRPIALRVGVVIEAYPSKVLSHVRTNIFIEPSGGVHITSAHDVFMCPV  849
                PE+Y SW +        GVVIE  P     +VR N+FIEPS  V I+S  + F+   
Sbjct  815   MVNPEVYPSWKSFLQAIRMYGVVIEVCPKNRQGYVRANLFIEPSRRVCISSTQE-FLSFE  873

Query  850   NKHLPQ-------------------CAVFPQSSVPYQAIRGASLAIASSMFIKGIIGYAS  890
             N H                         FPQ+ + ++ ++ ASL I  ++   GI GY S
Sbjct  874   NIHENDDRARKVVFDKAFAAKMRTIGFTFPQTLIDHEVLKSASLVIGQALAKDGICGYIS  933

Query  891   IDYISFADPKAMVSGRPRQRLWAMQVVPGLTNTAVSFVMFAFLS-CSQFNPITGKSHLQV  949
             +D++   D +        + L+AM + P LTN+A SF +F FLS    +N  TG  HL  
Sbjct  934   VDFLVILDDQTQ-----NKILYAMALQPFLTNSAASFSLFQFLSRGGGYNSKTGLFHL--  986

Query  950   APAPVATLSTANAPITP-TQQEIATILsppssaaaasVCG-----PERTYMVLDYIYHPN  1003
                P A  S      TP +    AT L    +  +  V       P R+Y++L+Y+ +PN
Sbjct  987   ---PRAITSHGVTSDTPSSSSLSATDLMIREARLSGIVSNELPLTPTRSYVLLEYVCNPN  1043

Query  1004  MATLQFATFFNTCRLHGVSFDLQRAIGAAYILADSLTAGVVGLICIGESDKEAFRIAR  1061
             +ATL + +FF  CR  GV FD++R IG  ++LADSLTAGV+G++CI ++ K A    R
Sbjct  1044  VATLSYGSFFQNCRSRGVYFDIERDIGTVFLLADSLTAGVLGIMCISDTRKNALLSCR  1101

>CCI45122
Length=1105

 Score = 539 bits (1389),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 365/1142 (32%), Positives = 574/1142 (50%), Gaps = 138/1142 (12%)

Query  1     MEKLCQQYHAEDVGRILLQAQDELRSMREK-------------------------VHENN  35
             M+ L Q++H ED+GRILLQ Q ELR +R +                         V  N 
Sbjct  1     MDHLEQKHHTEDIGRILLQTQQELREIRAEISGRKQTTETYIADATPFEDYPAPIVSVNP  60

Query  36    NLDVNQIHAILERAEADLRAKAEIVLNGVVNNSMKM---LPAIDAPGGQRYLSKFSSKLA  92
             + D+  +  IL+RAE +++AK +++  GV +   K    LP + +P  Q   S  +S L 
Sbjct  61    SKDLETLQNILDRAEREIQAKVDLLYKGVAHYGRKTQTGLPFVASPPRQ-IPSSANSSLE  119

Query  93    QK---RDLAATMARENTYEPGSPTYGHDTSYREHPSLSGPIEPMERDRTPGRRPVGRIVK  149
             +K   ++L+  + R+  +          T  ++H  L  P  P +               
Sbjct  120   RKSSFQELSVDLIRKQLHSVKEKYKCLPT--KQHSELISPKRPTQ---------------  162

Query  150   AGSLVKHKTTKPR-----RILPKMNRldptapppalldddaRGGVHNLLTRGFLPPSVDV  204
                L+  K +K R     R LP + R                 G  +  +R  +    + 
Sbjct  163   --GLLTSKPSKKRYNASLRSLPTVQRG--------------EAGDFSSASRDQIG---EA  203

Query  205   TPAFTHGTSVIQNTRVKIYDRASQPVKSMPYTNPSGFNMASLKFDMVtptpptVANVPIN  264
             +   +    V+      +++R  +P+K+ PYT     NM S+KFD +TP     +  P  
Sbjct  204   SNTLSVNDRVLMQRTAHLHNRMEEPIKTTPYTTAISHNMMSVKFDFMTP----TSQSPCG  259

Query  265   QGGdippsktsiptpiditFDGHANNAVPFRP--------EQPKGGNDPSGK-DCASADD  315
             +         +              N +   P         +   G DPS K     A  
Sbjct  260   KMQTQEKIVLTNDLQSKQRNGALLANQISLSPGGGCREDDSRFSPGRDPSKKIGIIKAIT  319

Query  316   GAGGNDSTSIHNLRRNVEKIRGYNELLDTYSLHQFIIRKGKTLADTPEFISFQRTTEDLW  375
                 ND T         + + G  E+  TY    F+I +G      PEF +FQR    +W
Sbjct  320   PIFLNDVT---------KSLVG--EISKTYD---FVIHQGIIDRKRPEFEAFQRIANPIW  365

Query  376   GSVSKSIQELEAMLTNYSVPLAYVDGQKLMKIAAMDGTARGTMELLSCILNMDEVSSLMR  435
              SV   ++ L  +L+ Y +P+AY++GQ+++ +A  D     T +L+SCI N DEV  L+ 
Sbjct  366   SSVDVVLEALARILSLYFIPIAYINGQRILTLAQADNVPLTTKDLISCIRNEDEVKMLLS  425

Query  436   RPGQRFKGKSGPDLAAVLLQSVWRMYITKKR-LKNHHGNEDAAVIQRIYRSYRCFSQLQQ  494
             +PGQRF+G      A + LQS  RM + +KR L   +       IQR +R +      + 
Sbjct  426   KPGQRFQGAERTKRATIALQSFIRMAMHRKRFLVMRYKYWKVTAIQRNWRRFSAHKATKL  485

Query  495   RLKSVREADLRIWDAQMQRFRANWDSIKMQRRVVVHVPSFSSEERTRLKMENFSIQQNLQ  554
             ++++ RE    ++   M+ F +NWD I+MQRR ++H+PS S + R R+K E FSIQQNLQ
Sbjct  486   KIEAKREHQEMVFTDSMRSFCSNWDKIRMQRRTIIHIPSISIDSRQRMKTEQFSIQQNLQ  545

Query  555   MARMCAIADPNVDIIYISPFELSPDIQKYQVRLLQLGGIADPQTRIRMLHPENVDRFPEH  614
             + R+CA+ D NV++IYI PFEL+ DI +Y ++LLQLGGI+D   RI+++ PEN  RFP H
Sbjct  546   LQRLCAVIDENVELIYICPFELTDDIVQYYMKLLQLGGISDAAARIKLICPENASRFPSH  605

Query  615   FSLTTVLLYSPHCLKKIKRFVRGKDAYIVTGNVGPEDKRLAIALQLPLLGMDPDKALLYG  674
             FSL++V+LYSP  L ++ R +RG++AY+V G  G EDKR+A  L +P+LG+D  K+L   
Sbjct  606   FSLSSVVLYSPRTLNRLSRCIRGRNAYMVPGFPGLEDKRVATILGVPILGLDSTKSLQAT  665

Query  675   TRSGGKRIFMAADVNIPMGAHDIYDEDELIQSLSKLIAADIDQTEWLIKIDADQSNTGIA  734
             T SG KR F  A+VN      D+YDE+ELI SL+KL+A+   Q   ++++D D   TGIA
Sbjct  666   TYSGSKRYFRKANVNTLPACIDLYDENELIFSLAKLVASHPHQLSVVLRLDYDPFGTGIA  725

Query  735   SLNVDKMQSVAKFRAEKREMKHGAAEYFQQPDVRDAVLRSVYSELNESYFAANVTPCFPE  794
              +++ ++QSV + R   + +     E + QP ++  ++R++  E+ ++  ++ +    PE
Sbjct  726   LMDISRLQSVKEVRLRTKTL-----ESWLQPPIQAKLIRNLVLEM-QNNISSFIFVVHPE  779

Query  795   MYASWAAMRPIALRV-GVVIEAYPSKVLSHVRTNIFIEPSGGVHITSAHDVFMCPVNKHL  853
             ++ S  +    A+R+ GV+IE  P K   HVR N+FIEPS  V ++S H++     +  +
Sbjct  780   IFPSSKSFLQ-AIRIYGVIIELSPKKRQGHVRANLFIEPSRRVCVSSTHEIHSLETDTKI  838

Query  854   PQ------------------CAVFPQSSVPYQAIRGASLAIASSMFIKGIIGYASIDYIS  895
                                    FPQ+ + ++ ++ ASLAI  ++   GI GY S+D++ 
Sbjct  839   DDRVRKFGLDKASAAKMRTFGVTFPQTLIDHEVLKDASLAIGQALAKDGICGYISVDFVV  898

Query  896   FADPKAMVSGRPRQRLWAMQVVPGLTNTAVSFVMFAFLS-CSQFNPITGKSHLQVAPAPV  954
               D +       ++ L+A  + P LTNTA SF +F  LS    +N +TG  HL   P  V
Sbjct  899   CLDDQTQ-----KKTLYATGLQPFLTNTAASFALFQLLSRGGSYNSMTGSLHL---PQEV  950

Query  955   ATLSTANAPITPTQQEIATILsppssaaaasVC--GPERTYMVLDYIYHPNMATLQFATF  1012
               +   N P +        I     S   ++V    P RTY +++Y+ +P +ATL  ++F
Sbjct  951   PLVGVQNDPPSSLSATDLMIREARLSGIVSNVLPPTPTRTYALIEYVCNPCVATLSCSSF  1010

Query  1013  FNTCRLHGVSFDLQRAIGAAYILADSLTAGVVGLICIGESDKEAFRIARQAVELIGDQVG  1072
             F  CR  GV FD +R  G  ++LADSLTAGV G++CI ++ K A    R A+E I    G
Sbjct  1011  FQHCRSRGVYFDTERDSGTVFLLADSLTAGVFGIMCISDTRKNALSNCRAAMEAIAGVAG  1070

Query  1073  VQ  1074
              +
Sbjct  1071  TK  1072

>PYAR_13581
Length=730

 Score = 267 bits (683),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 146/351 (42%), Positives = 207/351 (59%), Gaps = 40/351 (11%)

Query  297  EQPKGGNDPSGKDCASA----DDGAGGNDSTSIHNLRRNVEKIRGYNELLDTYSLHQFII  352
            ++P+    P   D   A    D  A  +D+ ++ +LR+NVEKIRGYNELLDTYSLHQFII
Sbjct  49   DEPEMDESPPQLDTEHAQHIDDADASESDANAMDDLRKNVEKIRGYNELLDTYSLHQFII  108

Query  353  RKGKTLADTPEFISFQRTTEDLWGSVSKSIQELEAMLTNY---SVPLAYVDGQKLMKIAA  409
             KG+ + +TPEF SF+R  +++WG+V + I+ LEA+LT Y   S P              
Sbjct  109  HKGRAMRETPEFQSFKRVGQEIWGAVDEVIRALEALLTRYFMASFP--------------  154

Query  410  MDGTARGTMELLSCILNMDEVSSLMRRPGQRFKGKSGPDLAAVLLQSVWRM-YITKKRLK  468
                   T  LLSC++N D+V+SL+RRPGQR+KGK     AA  LQ+ +RM +   +  +
Sbjct  155  -------TSVLLSCVVNEDQVASLLRRPGQRYKGKDRKRRAATTLQAFFRMLFHRNRFRR  207

Query  469  NHHGNEDAAVIQRIYRSYRCFSQLQQRLKSVREADLRIWDAQMQRFRANWDSIKMQRRVV  528
                   A  IQ  +R +     L++ L   R   LR+W  QM R R+ W  I  QRRVV
Sbjct  208  VCRRGASATRIQTTWRKFAAQQSLRRELTLRRAEQLRVWQLQMARLRSQWREISTQRRVV  267

Query  529  VHVPSFSSEERTRLKMENFSIQQNLQMARMCAIADPNVD-IIYISPFELSPDIQKYQVRL  587
            VHVPS S +E  R+ +++F++QQNLQ+AR+ A+ D  V+ ++Y+SPFEL  D+       
Sbjct  268  VHVPSLSLDEHARVSLDHFAVQQNLQLARLAAVVDATVEYVVYVSPFELPTDLSH-----  322

Query  588  LQLGGIADPQTRIRMLHPENVDRFPEHFSLTTVLLYSPH-CLKKIKRFVRG  637
                G+A+   R++++ PE+   FP HFSL T LLYSPH  L+K+ R  R 
Sbjct  323  ----GVANAAHRVKIVVPEHAATFPGHFSLATQLLYSPHLTLEKLGRCSRA  369

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 95/355 (27%), Positives = 143/355 (40%), Gaps = 88/355 (25%)

Query  752   REMK--HGAAEYFQQPDVRDAVLRSVYSELNESYFAANVTPCFPEMYASWAAMRPIALRV  809
             RE++  H    Y++QP +RD V R++  EL E        PC  E +  W A      R 
Sbjct  400   REIRRAHKPPAYWKQPGIRDTVARALLQEL-ERAIGTLAKPCHSERFPDWRAFAQAIGRD  458

Query  810   GVVIEAYPSKVLSHVRTNIFIEPSGGVH-----ITSAHDVFMCPVNKHLPQCAVFPQSSV  864
             GVVIEA P++V   VR NIF+ P+   H     + S  +       +  P     PQ+ V
Sbjct  459   GVVIEALPARVRGVVRVNIFVTPASSDHDADVPVVSTQEALRASAGR-APLAFACPQTLV  517

Query  865   PYQAIRGASLAIASSMFIK-GIIGYASIDYISFADPKAMVSGRPRQRLWAMQVVPGLTNT  923
             P+ A+ GA+ AI   +       GYAS+D                     +Q+    T  
Sbjct  518   PHDAVVGAAQAIGRLLREDYAFCGYASVD---------------------LQLCRDET--  554

Query  924   AVSFVMFAFLSCSQFNPITGKSHLQVAPAPVATLSTANAPITPTQQEIATILsppssaaa  983
                                  S L + P+P    S   +P TP   + A +L+  S   A
Sbjct  555   ---------------------SGLYLLPSPAVDTSAPLSPATPLVLQEAHLLARSSRPLA  593

Query  984   asVCGPERTYMVLDYIYHPNMATLQFATFFNTCRLHGVSFDLQRAIGAAYILADSLTAGV  1043
             +    P R ++ +D+  HPN+ T+  A FF  CR  GV FD+ R                
Sbjct  594   SPSASP-RCFVSVDWAVHPNLCTMPTAAFFLACRRRGVCFDVTR----------------  636

Query  1044  VGLICIGESDKEAFRIARQAVELIGDQVGVQALPNSLSGERLGNFPHLLAIVRNK  1098
                         A +  R A E++  +VG  + P+S      GNF  +LA++R++
Sbjct  637   -----------RAMQYLRTAFEVLAREVG-SSTPSS-----DGNFGDVLALLRHR  674

>PHYKE_8394
Length=428

 Score = 199 bits (505),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 112/267 (42%), Positives = 157/267 (59%), Gaps = 42/267 (16%)

Query  505  RIWDAQMQRFRANWDSIKMQRRVVVHVPSFSSEERTRLKMENFSIQQNLQMARMCAIA-D  563
            R  DA+M+   AN D I+               E      ENF++QQNLQ+ R+CA A D
Sbjct  150  RDEDAEMEELGANVDKIR------------GYNELLDAYTENFAVQQNLQLTRICAAALD  197

Query  564  PNVDI-IYISPFELSPDIQKYQVRLLQLGGIADPQTRIRMLHPENVDRFPEHFSLTTVLL  622
             NVD+ +Y+SPFEL+ D+ +Y ++LLQLGG+AD + R++++ PE   RFP          
Sbjct  198  SNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKLVFPEQALRFPT---------  248

Query  623  YSPHCLKKIKRFVRGKDAYIVTGNVGPEDKRLAIALQLPLLGMDPDKALLYGTRSGGKRI  682
                          GKDAY+V G  G ED+RLAIAL LP+LG  P +AL   TRSGGKR+
Sbjct  249  --------------GKDAYLVMGLPGAEDQRLAIALDLPILGAPPAQALPLLTRSGGKRL  294

Query  683  FMAADVNIPMGAHDIYDEDELIQSLSKLIAADIDQTEWLIKIDADQSNTGIASLNVDKMQ  742
             + ADVN+P G +++YD+ EL  +L+KL    +DQ  WL+K+D D    G A +++  MQ
Sbjct  295  LIRADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWLLKLDYDPLGVGEAIIDLSGMQ  354

Query  743  SVAKFRAEKREMKHGAAEYFQQPDVRD  769
            ++ + R EKR     A EY++QP  RD
Sbjct  355  AMRELRREKR-----APEYWRQPGPRD  376

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 49/72 (68%), Gaps = 5/72 (7%)

Query  1   MEKLCQQYHAEDVGRILLQAQDELRSMREKVHENNNLDVNQI----HAILERAEADLRAK  56
           MEK+ QQ+H EDVGR+LLQ Q++LR MRE++               H+ + + E +LRAK
Sbjct  1   MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAEAVEANASPMRHSTV-KTEMELRAK  59

Query  57  AEIVLNGVVNNS  68
           AE+VLNG+VN+S
Sbjct  60  AELVLNGMVNSS  71

 Score = 43.9 bits (102),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 25/41 (61%), Gaps = 3/41 (7%)

Query  309  DCASADDGAGGND---STSIHNLRRNVEKIRGYNELLDTYS  346
            D +  D GA GND      +  L  NV+KIRGYNELLD Y+
Sbjct  137  DLSDEDQGAAGNDRDEDAEMEELGANVDKIRGYNELLDAYT  177

>PYIR_16972
Length=936

 Score = 38.5 bits (88),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 30/109 (28%), Positives = 53/109 (49%), Gaps = 5/109 (5%)

Query  392  YSVPLAYVDGQKLMKIAAMDGTARGTMELLSCILNMDEVSSLMRRPGQRFKGKSGPDLAA  451
            Y+  + Y D  ++  +   DGTAR   EL +C+  ++   +       R+K +    LAA
Sbjct  313  YAAKVTYKDMLRIF-VLLEDGTAR---ELKTCVARLEAHFAFYFESFSRWKDRDAERLAA  368

Query  452  VLLQSVWRMYITKKR-LKNHHGNEDAAVIQRIYRSYRCFSQLQQRLKSV  499
             +L+S   +Y  KKR L     +E   V Q ++++ +  +QL+  L  V
Sbjct  369  EMLRSYHDIYKMKKRYLAKQTAHEGDGVHQLVFQTEKQLNQLKSALAQV  417

>HYAP_04567
Length=1275

 Score = 38.1 bits (87),  Expect = 0.38, Method: Compositional matrix adjust.
 Identities = 36/140 (26%), Positives = 61/140 (44%), Gaps = 15/140 (11%)

Query  451  AVLLQSVWRMYITKKRLKNHHGNEDAAVIQRIYRSYRCFSQLQQRLKSVREADLRIW---  507
             V++QSVWR   +++R+        A +IQ  YR +      +Q+   +R A ++I    
Sbjct  864  CVIVQSVWRGVRSRQRMYLLMKGNSAVLIQSAYRKHLA----EQKYTKLRNATIKIQCML  919

Query  508  --DAQMQRFRANWDSIK----MQRRVVVHVPSFSSEERTRLKM--ENFSIQQNLQMARMC  559
                Q+ ++R      K    M+  V +       E+R RL++  EN S+QQ L+  R  
Sbjct  920  KTRKQVDKYRKLLTERKEHDAMETEVDLLKHRLEDEKRARLEIEAENSSLQQELKEVRGS  979

Query  560  AIADPNVDIIYISPFELSPD  579
            +    N  I    P    P+
Sbjct  980  SALTANSSICEGEPLHTFPN  999

>PHYSO_298246
Length=425

 Score = 37.7 bits (86),  Expect = 0.42, Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 40/75 (53%), Gaps = 1/75 (1%)

Query  435  RRPGQRFKGKSGPDLAAVLLQSVWRMYITKKRLKNHHGNEDAAVIQRIYRSYRCFSQLQQ  494
            R+  Q +   S  +LAAV ++ + + Y ++  L  H   ED A ++ + RS+  F +  +
Sbjct  149  RKQTQCWDSSSNGELAAVSMEDLQKKY-SELSLVAHALEEDQAALREVLRSHEDFHERLR  207

Query  495  RLKSVREADLRIWDA  509
            RL   RE +  +WD+
Sbjct  208  RLAEEREDENSLWDS  222

>PYAP_17482
Length=1354

 Score = 35.8 bits (81),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 58/131 (44%), Gaps = 15/131 (11%)

Query  449   LAAVLLQSVWRMYITKKRLKNHHGNEDAAVIQRIYRSYRCFSQLQQRLKSVREADLRIW-  507
             L  V +QS+WR   ++ + +    N  A  IQ  +R+Y+     +QR K  R+A +++  
Sbjct  915   LQCVKIQSLWRGVHSRMQAQYLLKNRMATRIQTNFRTYKA----RQRYKLFRDAVIKVQA  970

Query  508   --------DAQMQRFRANWDSIKMQRRVVVHVPSFSSEERTR--LKMENFSIQQNLQMAR  557
                     D   Q      +   M+  V +       E+R R  ++  N S+Q  L++ R
Sbjct  971   KLKMRKQVDKYQQLLEEKKEHTIMENEVALLKQRLEEEKRARTEIEAVNTSLQLELRVVR  1030

Query  558   MCAIADPNVDI  568
               +I   +VD+
Sbjct  1031  QSSITRSDVDL  1041

>PYIR_23734
Length=1056

 Score = 35.8 bits (81),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 29/54 (54%), Gaps = 2/54 (4%)

Query  364  FISFQRTTEDLWGSVSKSIQ--ELEAMLTNYSVPLAYVDGQKLMKIAAMDGTAR  415
            F+S   T   LW +    ++  EL A  TN+   L Y+D ++L   AA+DGT +
Sbjct  32   FVSTDDTCLRLWSAAKDELRRVELPARTTNFVQALEYIDSRQLYVAAALDGTLK  85

>PHYCA_7562
Length=1246

 Score = 35.4 bits (80),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 28/118 (24%), Positives = 54/118 (46%), Gaps = 15/118 (13%)

Query  451  AVLLQSVWRMYITKKRLKNHHGNEDAAVIQRIYRSYRCFSQLQQRLKSVREADLRI----  506
            ++++QSVWR   T++R+      + A  +Q  YR YR     +++    R A ++I    
Sbjct  832  SIIVQSVWRGVRTRQRVYLMMKEKSAIKVQTAYRKYRN----EKKYAKFRNAVIKIQSNL  887

Query  507  -WDAQMQRF------RANWDSIKMQRRVVVHVPSFSSEERTRLKMENFSIQQNLQMAR  557
                Q+ ++      R   D+++ +  ++ H        R  ++ EN S+QQ L   R
Sbjct  888  KMKKQVGKYHRLLSERKEQDAMETEVELLKHRLEDEKRARMEIEAENSSLQQELNQVR  945

>PYU1_G007084
Length=2336

 Score = 35.4 bits (80),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 52/120 (43%), Gaps = 15/120 (13%)

Query  368   QRTTEDLWGSVSKSIQELEAMLTNYSVPLAYVDGQKLMKIAAMDGTARGTMELLSCILNM  427
             QR  E L    +  IQ    M   ++  +A+V   +  K   +    RG M  + C L +
Sbjct  1643  QRKEEALQSFAAVCIQR---MFRGHTCRVAFVHKLRAKKAMLLQRVYRGHMGRMQC-LEL  1698

Query  428   DEVSSLMRRPGQRFKGKSGPDLAAVLLQSVWRMYITKKRLKNHHGNEDAAV-IQRIYRSY  486
              E + + RR   R   K         +Q+ W+MYI + R      +  AA+ IQR+YR +
Sbjct  1699  RE-AQVQRRYMDRNAAK---------IQATWKMYIARDRFLTSRFSVLAAIEIQRMYRGH  1748

>PITG_15637
Length=2036

 Score = 35.4 bits (80),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 26/115 (23%), Positives = 55/115 (48%), Gaps = 9/115 (8%)

Query  408   AAMDGTARGTMELLSC-ILNMDEVSSLMRRPGQRFKGKSGPD--LAAVLLQSVWRMYITK  464
             A  D  A+      SC ++  + +  L R   + F+ +   D  +A   +Q  WR Y + 
Sbjct  1180  AVQDKAAQRVRVRASCAVIERNWLRYLSRAAARLFRQQLIADRHVAVAQIQRAWRRYRSL  1239

Query  465   KRLKNHHG------NEDAAVIQRIYRSYRCFSQLQQRLKSVREADLRIWDAQMQR  513
             +  + H        +  A ++QR++ +YRC  +  QR+ +++  +L + + ++QR
Sbjct  1240  QVARKHRQQMWRQMHRSAGILQRVWSAYRCRREETQRVLALQRFELMMKEKELQR  1294

>PYAP_18708
Length=563

 Score = 35.0 bits (79),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 22/77 (29%), Positives = 40/77 (52%), Gaps = 2/77 (3%)

Query  727  DQSNTGIASLNVDKMQSVAKFRAEKREMKHGAAEY-FQQPDVRDAVL-RSVYSELNESYF  784
            +Q + G+    +D ++  A+    +R+MKH A  + +  P  ++A L RS++++  E   
Sbjct  458  EQFSDGVGYGWIDSLKDWAEREVTERQMKHAARLFPYNTPQTKEAYLYRSIFTKHFEKEV  517

Query  785  AANVTPCFPEMYASWAA  801
            AA   P  P +  S AA
Sbjct  518  AAQTVPGGPSIACSTAA  534

>PPTG_10805
Length=822

 Score = 35.0 bits (79),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 23/42 (55%), Gaps = 4/42 (10%)

Query  450  AAVLLQSVWRMYITKKRL----KNHHGNEDAAVIQRIYRSYR  487
            AA+ +Q+ WRMY  KK +         N  A +IQR+YR  R
Sbjct  244  AALEIQATWRMYTAKKLICLLTSRRQENASAILIQRVYRGLR  285

>PITG_03739
Length=1743

 Score = 33.9 bits (76),  Expect = 7.8, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 24/40 (60%), Gaps = 1/40 (3%)

Query  448   DLAAVLLQSVWRMYITKKRLKNHHGNEDAAV-IQRIYRSY  486
             D  A  LQS WRMY+ + +      +E AA+ IQR+YR +
Sbjct  1195  DRNAAKLQSTWRMYVARGQFLTARFSELAALEIQRMYRGF  1234

>PPTG_17651
Length=1871

 Score = 33.9 bits (76),  Expect = 8.7, Method: Compositional matrix adjust.
 Identities = 29/105 (28%), Positives = 49/105 (47%), Gaps = 3/105 (3%)

Query  423   CILNMDEVSSLMRRPGQRFKGKSGPDLAAVLLQSVWRMYITKKRLKNHHGNEDAAV-IQR  481
             C +N+  +    R   +R+KG    D AA LLQ  WR  + +   K       AA+ IQR
Sbjct  1131  CAVNLQRLWR-ARVARKRYKGLKREDWAARLLQRHWRGKMGRTSYKQRMLEYLAALDIQR  1189

Query  482   IYRSYRCFSQLQQRLKSVREADLRIWDAQMQRFRANWDSIKMQRR  526
             I R +     + +R + +  + +R+    M+R+ A     + +RR
Sbjct  1190  IARGWLARRSVLRRQQQIHRSIVRVQQL-MRRYVARMKMFRQRRR  1233

>PHYSO_489296
Length=1098

 Score = 33.5 bits (75),  Expect = 8.8, Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 38/61 (62%), Gaps = 4/61 (7%)

Query  450  AAVLLQSVWRMYITKKRLKNHHGNEDAAV-IQRIYRSYRCFSQLQQRLKSVREADLRIWD  508
            +A  +Q V+R YI +KRL++     +AA+ +Q+++RS      ++++L+  R   L +W+
Sbjct  650  SAARIQRVFRGYIVRKRLEDTRDQIEAAITLQQMWRSRSTVKTIKEKLRGFR---LMLWE  706

Query  509  A  509
            A
Sbjct  707  A  707

>CCA16376
Length=638

 Score = 33.5 bits (75),  Expect = 8.9, Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 69/175 (39%), Gaps = 37/175 (21%)

Query  677  SGGKRIFMAADVNIPMGAHDIYDEDELIQSLSKLIAADIDQTEWLIKIDADQSNTGIASL  736
            SGG +I    DV       D  D DE ++ + KL+   +++ E          NT +  L
Sbjct  185  SGGHQIASKQDVTRGSRLVDSEDVDEQLEKI-KLLKERLNEKEM--------RNTRLQQL  235

Query  737  NVDKMQSVAKFRAEKREMKHGA--------------AEYFQQPDVRDAVLRSVYSELNES  782
            NV K Q++ K ++E R+M+                  ++++Q  V D  + S   E +  
Sbjct  236  NVQKDQTIEKLQSELRKMQSEVYIKPSKEATEDRMIDDFYEQVQVHDTFVESAIGERDND  295

Query  783  YFAANVTPCF-----PEMYASWAAMRP-----IALRVGVVIEAYPSKVL--SHVR  825
               ++VT  F     P  Y     +R      I   V V+      KVL  S VR
Sbjct  296  R--SSVTDLFIDARDPNGYEELHDLRESTQQIIQEHVAVITSLEKDKVLLRSRVR  348

Lambda      K        H        a         alpha
   0.320    0.134    0.394    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 93655006884

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40