Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
H310_085901475364064033720.0
H257_084361475364260629590.0
SPRG_141031475362861425100.0
SDRG_167201475362861425000.0
PYIR_134521475364561221050.0
PYAP_177619907562260920100.0
PHYCA_5561601475364963619960.0
PHYKE_83911475377863919910.0
PYIW_199721475360963219780.0
PITG_184521475385663219460.0
HYAP_070951475361361718350.0
PYAR_135699907549448918270.0
PHALS_064811475364462117850.0
PHYSO_3489011475352649517770.0
PHYRA_508551475348949017350.0
PYVX_181701475351054316990.0
SDRG_1440812408752850410931e-141
SPRG_0407412408750949910911e-141
PYAR_17512109045335186663e-78
SDRG_12187109044624766561e-77
SDRG_038221356704944766521e-76
PYAP_21882109045024936469e-76
SDRG_111311368074944766451e-75
SDRG_150451241574944766381e-74
SDRG_03823114284974806337e-74
PHALS_08068109044974926329e-74
SPRG_11769109044534776291e-73
PYIR_17506109045094836303e-73
SPRG_05609114284964776276e-73
PHYSO_254571109044894896222e-72
H310_144471462305014606223e-72
PPTG_09787114284934836198e-72
PHYKE_103271090612004986445e-71
PPTG_18033109045004926075e-70
PITG_14083114284934796057e-70
HYAP_08763114284734626012e-69
PYIW_25301109045124836014e-69
PHYSO_550665114284914835996e-69
PHYRA_72037114284934795952e-68
PHALS_09136114284934805943e-68
PHYRA_71927109044854965925e-68
PHYCA_504517114284934825901e-67
PYAP_234351008029514896141e-67
CCI11048114284964655892e-67
H257_09722114285184825851e-66
H257_170371462304984605788e-66
PITG_13427109044634705652e-64
CCA23647114284964655673e-64
H310_11259114285194815613e-63
PHYKE_6836114284934825532e-62
PHYCA_7619109044624665363e-60
PYVX_21517109044825105051e-55
HYAP_04843109044303924881e-53
PYIR_23431114284684604724e-51
PYAR_177141008024444834634e-50
PYVX_16175114284464604433e-47
CCA22989124014944713602e-35
CCI10477124014944713574e-35
PYU1_G014259109042442303353e-34
PYAP_226451707615654953522e-33
PYIR_20273124015055043391e-32
SPRG_199431356703432523282e-32
HYAP_12621124015014763194e-30
SDRG_14446151564954993081e-28
PPTG_0093815665505423045e-28
H257_01186151564964903026e-28
CCI50816151568074832996e-27
PYVX_21248124015024452947e-27
PHYRA_7388315665515162912e-26
H310_00561151564974952893e-26
CCA16670151565204842903e-26
PYIW_251901648732061852628e-25
PYU1_G00569915665505442789e-25
PYVX_20512151565284932789e-25
PYU1_G011605151565244902761e-24
PHYRA_47253151564814922733e-24
PHALS_1202815665795342753e-24
PYIR_1413215665134992707e-24
PHYRA_72215124014995052681e-23
PYIW_19795151565194832681e-23
PYAR_16840151565365132682e-23
PHYCA_50444515665485282654e-23
PPTG_09121151565205382644e-23
PHALS_10055151565164882645e-23
PYAR_20075170764694402619e-23
PHYCA_123621124014954572582e-22
PHYKE_9680124014984422573e-22
PYVX_2349915665195302583e-22
PHYSO_556052124015004442564e-22
SPRG_1205415665585512575e-22
PITG_15359124014964872521e-21
SDRG_0506015665595112512e-21
SPRG_09825124014924912483e-21
PYIW_2025715665035042494e-21
PHYCA_555180151565214952494e-21
PYAP_19280151565124892484e-21
SDRG_06945124014924922467e-21
H310_0764115665485402469e-21
PYAP_1914815665355182441e-20
PYIW_24688114282592532296e-20
HYAP_0414915665645532406e-20
PHYSO_48941815664714562351e-19
PHYKE_2864151564864922352e-19
PHALS_09942124014964572315e-19
PITG_0177815664704602299e-19
PYU1_G00173714753133992119e-19
SPRG_04114151563763702214e-18
H257_0745015665675322211e-17
PHYKE_980715665575402211e-17
CCI3999315665505302157e-17
CCA1403015665605322122e-16
PYAR_1666415665773812103e-16
H310_02523124014944492084e-16
PITG_19065151564164122002e-15
H257_16541124014944442004e-15
HYAP_08069650262552141872e-14
PYIR_21896151565185061942e-14
PPTG_13000124013873381805e-13
PHYSO_562795151564154091781e-12
HYAP_13613151564232341513e-09
PPTG_247122910367621151e-06
SPRG_0423112415790521118e-06
PITG_19802156311851571151e-05
PITG_18935150674801711093e-04
SPRG_186431333348570870.015
PHYCA_524942105671028245960.018
PHALS_10960634702239950.020
PITG_00703634703221900.087
H310_04551634723238870.17
PHYCA_46557970235788860.18
PPTG_08060634725205870.18
PYIW_275681240112856800.29
PITG_13013105671046224850.34
HYAP_03065634701124840.45
PHYSO_507629634703105840.47
PYAP_15943241513933780.55
CCI40989241655275830.56
SPRG_17626132408148121771.0
PYAR_15823634705298801.2
SPRG_14085129749340102791.3
HYAP_080686502510056731.4
PHYSO_317690105671057147801.5
H310_0629614909759057791.5
PYVX_21196634604144781.9
PYU1_G004385241656234772.6
H257_05020634713209772.7
H257_05019140360713209772.7
PITG_02760241516530733.3
SDRG_0650112817662335763.3
SPRG_1164112817662335763.4
PHYKE_6590105671054131763.9
SDRG_0252112974950392754.3
H257_040361250061049126764.3
PYAR_16461469752643745.4
H310_1084212382687978755.6
PYVX_18330241655830746.2
PHYKE_5677241621130726.3
H310_07705241654668746.5
SPRG_08354241655068746.6
SDRG_05159241655168737.4
PYU1_G014369634703148737.8
SDRG_116106131131796748.1
PYAR_1882312029545222738.9
PYIR_174418263318749709.5
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= H310_08590

Length=640
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

H310_08590                                                            1303       0.0   
H257_08436                                                            1144       0.0   
SPRG_14103                                                            971        0.0   
SDRG_16720                                                            967        0.0   
PYIR_13452                                                            815        0.0   
PYAP_17761                                                            778        0.0   
PHYCA_556160                                                          773        0.0   
PHYKE_8391                                                            771        0.0   
PYIW_19972                                                            766        0.0   
PITG_18452                                                            754        0.0   
HYAP_07095                                                            711        0.0   
PYAR_13569                                                            708        0.0   
PHALS_06481                                                           692        0.0   
PHYSO_348901                                                          689        0.0   
PHYRA_50855                                                           672        0.0   
PYVX_18170                                                            659        0.0   
SDRG_14408                                                            425        1e-141
SPRG_04074                                                            424        1e-141
PYAR_17512                                                            261        3e-78 
SDRG_12187                                                            257        1e-77 
SDRG_03822                                                            255        1e-76 
PYAP_21882                                                            253        9e-76 
SDRG_11131                                                            253        1e-75 
SDRG_15045                                                            250        1e-74 
SDRG_03823                                                            248        7e-74 
PHALS_08068                                                           248        9e-74 
SPRG_11769                                                            246        1e-73 
PYIR_17506                                                            247        3e-73 
SPRG_05609                                                            246        6e-73 
PHYSO_254571                                                          244        2e-72 
H310_14447                                                            244        3e-72 
PPTG_09787                                                            243        8e-72 
PHYKE_10327                                                           252        5e-71 
PPTG_18033                                                            238        5e-70 
PITG_14083                                                            237        7e-70 
HYAP_08763                                                            236        2e-69 
PYIW_25301                                                            236        4e-69 
PHYSO_550665                                                          235        6e-69 
PHYRA_72037                                                           233        2e-68 
PHALS_09136                                                           233        3e-68 
PHYRA_71927                                                           232        5e-68 
PHYCA_504517                                                          231        1e-67 
PYAP_23435                                                            241        1e-67 
CCI11048                                                              231        2e-67 
H257_09722                                                            229        1e-66 
H257_17037                                                            227        8e-66 
PITG_13427                                                            222        2e-64 
CCA23647                                                              223        3e-64 
H310_11259                                                            220        3e-63 
PHYKE_6836                                                            217        2e-62 
PHYCA_7619                                                            211        3e-60 
PYVX_21517                                                            199        1e-55 
HYAP_04843                                                            192        1e-53 
PYIR_23431                                                            186        4e-51 
PYAR_17714                                                            182        4e-50 
PYVX_16175                                                            175        3e-47 
CCA22989                                                              143        2e-35 
CCI10477                                                              142        4e-35 
PYU1_G014259                                                          133        3e-34 
PYAP_22645                                                            140        2e-33 
PYIR_20273                                                            135        1e-32 
SPRG_19943                                                            130        2e-32 
HYAP_12621                                                            127        4e-30 
SDRG_14446                                                            123        1e-28 
PPTG_00938                                                            121        5e-28 
H257_01186                                                            120        6e-28 
CCI50816                                                              119        6e-27 
PYVX_21248                                                            117        7e-27 
PHYRA_73883                                                           116        2e-26 
H310_00561                                                            115        3e-26 
CCA16670                                                              116        3e-26 
PYIW_25190                                                            105        8e-25 
PYU1_G005699                                                          111        9e-25 
PYVX_20512                                                            111        9e-25 
PYU1_G011605                                                          110        1e-24 
PHYRA_47253                                                           109        3e-24 
PHALS_12028                                                           110        3e-24 
PYIR_14132                                                            108        7e-24 
PHYRA_72215                                                           107        1e-23 
PYIW_19795                                                            107        1e-23 
PYAR_16840                                                            107        2e-23 
PHYCA_504445                                                          106        4e-23 
PPTG_09121                                                            106        4e-23 
PHALS_10055                                                           106        5e-23 
PYAR_20075                                                            105        9e-23 
PHYCA_123621                                                          103        2e-22 
PHYKE_9680                                                            103        3e-22 
PYVX_23499                                                            103        3e-22 
PHYSO_556052                                                          103        4e-22 
SPRG_12054                                                            103        5e-22 
PITG_15359                                                            101        1e-21 
SDRG_05060                                                            101        2e-21 
SPRG_09825                                                            100        3e-21 
PYIW_20257                                                            100        4e-21 
PHYCA_555180                                                          100        4e-21 
PYAP_19280                                                            100        4e-21 
SDRG_06945                                                            99.4       7e-21 
H310_07641                                                            99.4       9e-21 
PYAP_19148                                                            98.6       1e-20 
PYIW_24688                                                            92.8       6e-20 
HYAP_04149                                                            97.1       6e-20 
PHYSO_489418                                                          95.1       1e-19 
PHYKE_2864                                                            95.1       2e-19 
PHALS_09942                                                           93.6       5e-19 
PITG_01778                                                            92.8       9e-19 
PYU1_G001737                                                          85.9       9e-19 
SPRG_04114                                                            89.7       4e-18 
H257_07450                                                            89.7       1e-17 
PHYKE_9807                                                            89.7       1e-17 
CCI39993                                                              87.4       7e-17 
CCA14030                                                              86.3       2e-16 
PYAR_16664                                                            85.5       3e-16 
H310_02523                                                            84.7       4e-16 
PITG_19065                                                            81.6       2e-15 
H257_16541                                                            81.6       4e-15 
HYAP_08069                                                            76.6       2e-14 
PYIR_21896                                                            79.3       2e-14 
PPTG_13000                                                            73.9       5e-13 
PHYSO_562795                                                          73.2       1e-12 
HYAP_13613                                                            62.8       3e-09 
PPTG_24712                                                            48.9       1e-06 
SPRG_04231                                                            47.4       8e-06 
PITG_19802                                                            48.9       1e-05 
PITG_18935                                                            46.6       3e-04 
SPRG_18643                                                            38.1       0.015 
PHYCA_524942                                                          41.6       0.018 
PHALS_10960                                                           41.2       0.020 
PITG_00703                                                            39.3       0.087 
H310_04551                                                            38.1       0.17  
PHYCA_46557                                                           37.7       0.18  
PPTG_08060                                                            38.1       0.18  
PYIW_27568                                                            35.4       0.29  
PITG_13013                                                            37.4       0.34  
HYAP_03065                                                            37.0       0.45  
PHYSO_507629                                                          37.0       0.47  
PYAP_15943                                                            34.7       0.55  
CCI40989                                                              36.6       0.56  
SPRG_17626                                                            34.3       1.0   
PYAR_15823                                                            35.4       1.2   
SPRG_14085                                                            35.0       1.3   
HYAP_08068                                                            32.7       1.4   
PHYSO_317690                                                          35.4       1.5   
H310_06296                                                            35.0       1.5   
PYVX_21196                                                            34.7       1.9   
PYU1_G004385                                                          34.3       2.6   
H257_05020                                                            34.3       2.7   
H257_05019                                                            34.3       2.7   
PITG_02760                                                            32.7       3.3   
SDRG_06501                                                            33.9       3.3   
SPRG_11641                                                            33.9       3.4   
PHYKE_6590                                                            33.9       3.9   
SDRG_02521                                                            33.5       4.3   
H257_04036                                                            33.9       4.3   
PYAR_16461                                                            33.1       5.4   
H310_10842                                                            33.5       5.6   
PYVX_18330                                                            33.1       6.2   
PHYKE_5677                                                            32.3       6.3   
H310_07705                                                            33.1       6.5   
SPRG_08354                                                            33.1       6.6   
SDRG_05159                                                            32.7       7.4   
PYU1_G014369                                                          32.7       7.8   
SDRG_11610                                                            33.1       8.1   
PYAR_18823                                                            32.7       8.9   
PYIR_17441                                                            31.6       9.5   

>H310_08590
Length=640

 Score = 1303 bits (3372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 640/640 (100%), Positives = 640/640 (100%), Gaps = 0/640 (0%)

Query  1    MHRHASFristrrrvtssvwtsPPLRRQSSKMSTINYHVVGWKQCPYYVKAASVVSSMQH  60
            MHRHASFRISTRRRVTSSVWTSPPLRRQSSKMSTINYHVVGWKQCPYYVKAASVVSSMQH
Sbjct  1    MHRHASFRISTRRRVTSSVWTSPPLRRQSSKMSTINYHVVGWKQCPYYVKAASVVSSMQH  60

Query  61   LFPSQVKATIHEHPNKESFANWLNESQTEFARQFDNDARPLKHKSSPFCYLEQDDTPKFV  120
            LFPSQVKATIHEHPNKESFANWLNESQTEFARQFDNDARPLKHKSSPFCYLEQDDTPKFV
Sbjct  61   LFPSQVKATIHEHPNKESFANWLNESQTEFARQFDNDARPLKHKSSPFCYLEQDDTPKFV  120

Query  121  GGCDDTLAFFRARTQSAPSTGAPSAANAHVSDTSSSDETQYDWDLVVIGGGSGGLACSKE  180
            GGCDDTLAFFRARTQSAPSTGAPSAANAHVSDTSSSDETQYDWDLVVIGGGSGGLACSKE
Sbjct  121  GGCDDTLAFFRARTQSAPSTGAPSAANAHVSDTSSSDETQYDWDLVVIGGGSGGLACSKE  180

Query  181  ASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGELLHKDAEQFGWT  240
            ASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGELLHKDAEQFGWT
Sbjct  181  ASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGELLHKDAEQFGWT  240

Query  241  VSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYENMLGTFKDAHTLTLTNEAKKKG  300
            VSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYENMLGTFKDAHTLTLTNEAKKKG
Sbjct  241  VSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYENMLGTFKDAHTLTLTNEAKKKG  300

Query  301  PTDVTFRRAVIAVGGRPKPLSCPGWEHAISSDDIFSKAEAPGKTLVVGASYVALECAGFL  360
            PTDVTFRRAVIAVGGRPKPLSCPGWEHAISSDDIFSKAEAPGKTLVVGASYVALECAGFL
Sbjct  301  PTDVTFRRAVIAVGGRPKPLSCPGWEHAISSDDIFSKAEAPGKTLVVGASYVALECAGFL  360

Query  361  KGQGFDVTIMVRSILLRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTH  420
            KGQGFDVTIMVRSILLRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTH
Sbjct  361  KGQGFDVTIMVRSILLRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTH  420

Query  421  THGEGIYDTVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDVTNEQTSTPHIYAIGDVIDA  480
            THGEGIYDTVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDVTNEQTSTPHIYAIGDVIDA
Sbjct  421  THGEGIYDTVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDVTNEQTSTPHIYAIGDVIDA  480

Query  481  PELTPVAIQAGKLLARRLFGNGTALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNI  540
            PELTPVAIQAGKLLARRLFGNGTALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNI
Sbjct  481  PELTPVAIQAGKLLARRLFGNGTALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNI  540

Query  541  QVYHQNFTPLEWSLSHERPLAKECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMK  600
            QVYHQNFTPLEWSLSHERPLAKECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMK
Sbjct  541  QVYHQNFTPLEWSLSHERPLAKECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMK  600

Query  601  LHATYDDFVNTVGIHPTTAEIFTTLEITKESGEDASASGC  640
            LHATYDDFVNTVGIHPTTAEIFTTLEITKESGEDASASGC
Sbjct  601  LHATYDDFVNTVGIHPTTAEIFTTLEITKESGEDASASGC  640

>H257_08436
Length=642

 Score = 1144 bits (2959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 550/606 (91%), Positives = 582/606 (96%), Gaps = 2/606 (0%)

Query  35   INYHVVGWKQCPYYVKAASVVSSMQHLFPSQVKATIHEHPNKESFANWLNESQTEFARQF  94
            +NYHVVGWKQCPYYVKAASV SSMQHLFPSQVKATIHEHPNKESF NWLNESQTEFA QF
Sbjct  39   VNYHVVGWKQCPYYVKAASVASSMQHLFPSQVKATIHEHPNKESFVNWLNESQTEFAHQF  98

Query  95   DNDARPLKHKSSPFCYLEQDDTPKFVGGCDDTLAFFRARTQSAPSTGAPSAANAHVSDTS  154
            DNDARPLKHKSSPFCYLEQDDTPKFVGGCDDTLAFFRARTQSAPS  A S+A+ H +DTS
Sbjct  99   DNDARPLKHKSSPFCYLEQDDTPKFVGGCDDTLAFFRARTQSAPSAPA-SSASIHANDTS  157

Query  155  SSDETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGC  214
             +D  +YDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGC
Sbjct  158  DAD-VKYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGC  216

Query  215  IPKKLMHQSSIIGELLHKDAEQFGWTVSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKK  274
            IPKKLMHQSSIIGE+LHKDA+QFGW+VSNA+FDW+KLVSSVQDYIHGLNFKYR+DLRDKK
Sbjct  217  IPKKLMHQSSIIGEILHKDADQFGWSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKK  276

Query  275  VKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAISSDDI  334
            VKYENMLGTFKDAHTLTLTN+AKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHA+SSDDI
Sbjct  277  VKYENMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDDI  336

Query  335  FSKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGEYMENE  394
            FSK +APGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGEYME+E
Sbjct  337  FSKPDAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGEYMESE  396

Query  395  SGIAFIKESVPTSIEKLPNGQLKVTHTHGEGIYDTVLNATGRSPDVQMLNLPAAGVTLNP  454
            SGIAFIKESVPTSI KL NGQ +VTHT G+ +YDT+LNATGRSPDVQ LNL AAGV LNP
Sbjct  397  SGIAFIKESVPTSIVKLENGQFQVTHTTGQDVYDTILNATGRSPDVQKLNLDAAGVALNP  456

Query  455  KSGRIDVTNEQTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLFGNGTALMDYTKICTA  514
            KSGRI V NEQTSTP+IYA+GDVIDAPELTPVAIQAGKLL+RRLFGNGT LMDYTKICTA
Sbjct  457  KSGRIHVVNEQTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLFGNGTTLMDYTKICTA  516

Query  515  VFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAKECYAKLIVDTTQ  574
            VFTPVEYGCCGLSEEDAIASAGR+N++VYHQNFTPLEWSLSH+RPLAKECYAKLIVDTTQ
Sbjct  517  VFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAKECYAKLIVDTTQ  576

Query  575  QKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIFTTLEITKESGED  634
            QKRV+GFHYLGPNAGEVTQAIG+A+KL+ATYDDF+NTVGIHPTTAEIFTTLEITKESG D
Sbjct  577  QKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIFTTLEITKESGVD  636

Query  635  ASASGC  640
            ASASGC
Sbjct  637  ASASGC  642

>SPRG_14103
Length=628

 Score = 971 bits (2510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/614 (78%), Positives = 522/614 (85%), Gaps = 3/614 (0%)

Query  27   RQSSKMSTINYHVVGWKQCPYYVKAASVVSSMQHLFPSQVKATIHEHPNKESFANWLNES  86
            R SS MS++NYHVVGWK CPYY +AA+V SSMQ LFP QVKATIHEH  K+SF +WL  S
Sbjct  18   RSSSTMSSVNYHVVGWKSCPYYERAANVASSMQTLFPGQVKATIHEHATKQSFNDWLEAS  77

Query  87   QTEFARQFDNDARPLKHKSSPFCYLEQDDTPKFVGGCDDTLAFFRARTQSAPSTGAPSAA  146
            Q  FA QF  DAR   H +SPFCYLE     KFVGGCDDTLAFFR+RTQSA +  +  A 
Sbjct  78   QATFATQFVGDARATNHYTSPFCYLEDGAGTKFVGGCDDTLAFFRSRTQSAAAP-SAPAR  136

Query  147  NAHVSDTSSSDETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLG  206
            N H +D    D   YDWDLVVIGGGSGGLA SKEA+K GQKVLVLDYVKPSP GSTWGLG
Sbjct  137  NVHANDVD--DGATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLG  194

Query  207  GTCVNVGCIPKKLMHQSSIIGELLHKDAEQFGWTVSNASFDWTKLVSSVQDYIHGLNFKY  266
            GTCVNVGCIPKKLMHQS+I+GELLHKDAE FGW V NA+FDWTKLV+SVQDYIHGLNFKY
Sbjct  195  GTCVNVGCIPKKLMHQSAIMGELLHKDAEAFGWAVPNATFDWTKLVTSVQDYIHGLNFKY  254

Query  267  RIDLRDKKVKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWE  326
            R+DLRDKKVKYEN LGTFKDAHTLTLTN AK K P DVTFRRA+IAVGGRPK L CPG +
Sbjct  255  RVDLRDKKVKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGAD  314

Query  327  HAISSDDIFSKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARR  386
             AISSDDIFS+   PGKTLVVGASYVALECAGFLK QGFDVT+MVRSILLRGFD D+A R
Sbjct  315  LAISSDDIFSRPTPPGKTLVVGASYVALECAGFLKAQGFDVTVMVRSILLRGFDTDMAAR  374

Query  387  IGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHTHGEGIYDTVLNATGRSPDVQMLNLP  446
            IG YME E+ I FIK +VPTSIE+L NGQLKVTHT GEGIYDTVLNATGR+PDV  LNLP
Sbjct  375  IGTYMEEEAKIDFIKGAVPTSIEQLANGQLKVTHTFGEGIYDTVLNATGRNPDVSGLNLP  434

Query  447  AAGVTLNPKSGRIDVTNEQTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLFGNGTALM  506
            AAGV LNPK+GRI VT+EQTS PHIYA+GDVID PELTPVAIQAG+LLA+RLF N   LM
Sbjct  435  AAGVGLNPKTGRIAVTHEQTSAPHIYAVGDVIDGPELTPVAIQAGRLLAKRLFDNSATLM  494

Query  507  DYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAKECYA  566
             Y K+CTAVFTP+EYGCCGLSE+ AI + G DN+ VYHQ+FTPLEWSLSH+R LAKECY 
Sbjct  495  AYDKVCTAVFTPIEYGCCGLSEDAAIETIGADNLGVYHQSFTPLEWSLSHDRALAKECYC  554

Query  567  KLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIFTTLE  626
            KLIVD TQ  RVVGFHYLGPNAGEVTQA+G+AMKL+A+YDDFV+TVGIHPTTAEIFTTLE
Sbjct  555  KLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAMKLNASYDDFVSTVGIHPTTAEIFTTLE  614

Query  627  ITKESGEDASASGC  640
            ITKESG DASA+GC
Sbjct  615  ITKESGLDASAAGC  628

>SDRG_16720
Length=628

 Score = 967 bits (2500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 474/614 (77%), Positives = 523/614 (85%), Gaps = 3/614 (0%)

Query  27   RQSSKMSTINYHVVGWKQCPYYVKAASVVSSMQHLFPSQVKATIHEHPNKESFANWLNES  86
            R SS MS++NYHVVGWK CPYY +AA+V  SMQ LFP QVKATIHEH  K+SF +WL  S
Sbjct  18   RSSSTMSSVNYHVVGWKSCPYYERAANVAVSMQTLFPGQVKATIHEHATKQSFNDWLETS  77

Query  87   QTEFARQFDNDARPLKHKSSPFCYLEQDDTPKFVGGCDDTLAFFRARTQSAPSTGAPSAA  146
            Q+ FA QF  DAR   H +SPFCYLE     KFVGGCDDTLAFFR+RTQSA +  +  A 
Sbjct  78   QSTFATQFVGDARATNHYTSPFCYLEDGAGTKFVGGCDDTLAFFRSRTQSAAAP-SAPAR  136

Query  147  NAHVSDTSSSDETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLG  206
            N H +D    D   YDWDLVVIGGGSGGLA SKEA+K GQKVLVLDYVKPSP GSTWGLG
Sbjct  137  NVHANDVD--DGATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLG  194

Query  207  GTCVNVGCIPKKLMHQSSIIGELLHKDAEQFGWTVSNASFDWTKLVSSVQDYIHGLNFKY  266
            GTCVNVGCIPKKLMHQS+I+GELLHKDAE FGW V NA+FDWTKL++SVQDYIHGLNFKY
Sbjct  195  GTCVNVGCIPKKLMHQSAIMGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKY  254

Query  267  RIDLRDKKVKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWE  326
            R+DLRDKKVKYEN LGTFKDAHTLTLTN AK K P DVTFRRA+IAVGGRPK L CPG +
Sbjct  255  RVDLRDKKVKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGAD  314

Query  327  HAISSDDIFSKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARR  386
             AISSDDIFS+   PGKTLVVGASYVALECAGFLKGQGFDVT+MVRSILLRGFD D+A R
Sbjct  315  LAISSDDIFSRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVRSILLRGFDTDMAAR  374

Query  387  IGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHTHGEGIYDTVLNATGRSPDVQMLNLP  446
            IG YME E+ I FIK +VPTSIE+LPNGQLKVTHT GEGIYDTVLNATGR PDV  LNL 
Sbjct  375  IGTYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEGIYDTVLNATGRYPDVSGLNLS  434

Query  447  AAGVTLNPKSGRIDVTNEQTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLFGNGTALM  506
            AAGV LNPK+GRI VT+EQTSTPHIYA+GDVID PELTPVAIQAG+LL++RLF N   LM
Sbjct  435  AAGVGLNPKTGRIAVTHEQTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNSATLM  494

Query  507  DYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAKECYA  566
             Y K+CTAVFTP+EYGCCGLSE+ A+ + G DN+ VYHQ+FTPLEWSLSH+R LAKECY 
Sbjct  495  AYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAKECYC  554

Query  567  KLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIFTTLE  626
            KLIVD TQ  RVVGFHYLGPNAGEVTQA+G+A+KL+A+Y+DFV+TVGIHPTTAEIFTTLE
Sbjct  555  KLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIFTTLE  614

Query  627  ITKESGEDASASGC  640
            ITKESG DASA+GC
Sbjct  615  ITKESGLDASAAGC  628

>PYIR_13452
Length=645

 Score = 815 bits (2105),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/612 (65%), Positives = 473/612 (77%), Gaps = 14/612 (2%)

Query  36   NYHVVGWKQCPYYVKAASVVSSMQHLFPSQVKATIHEHPNKESFANWLNESQT--EFARQ  93
             YHV GW+ C +Y KA+ VV++M+ L+P  V   +HE P++E+F  WL  S T  E    
Sbjct  41   KYHVAGWRGCGFYKKASDVVTAMRVLYPDVVDFELHEFPDREAFREWLAASSTIEELTEC  100

Query  94   FDNDARPLKHKSSPFCYLEQDDTPKFVGGCDDTLAFFRARTQSAPSTGAPSAANAHVSDT  153
            F  D++ L HKSSPF +    +T  F+GGCDDTLA FR+   SAP+T A +      +  
Sbjct  101  FGADSKALTHKSSPFVWA---NTRGFIGGCDDTLALFRSGV-SAPATLAATPTMVAAAPA  156

Query  154  SSSDETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVG  213
             +  + +YD+DL+VIGGGSGGLACSKEASK G+KV VLDYVKPSPVG++WGLGGTCVNVG
Sbjct  157  PAD-DAKYDYDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVG  215

Query  214  CIPKKLMHQSSIIGELLHKDAEQFGWTVSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDK  273
            CIPKKLMHQSS+IGE +HKDA+ FGWTV   +FDW++++ SV  YI  +NFKY+++LRDK
Sbjct  216  CIPKKLMHQSSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDK  275

Query  274  KVKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAISSDD  333
            KVKYEN+LG+F DAHTL L +   KKG   VT R  VIAVGGRPKPLSC G + AISSDD
Sbjct  276  KVKYENLLGSFVDAHTLELWH--PKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDD  333

Query  334  IFSKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGEYMEN  393
            IF + EAPGKTLVVGASYVALECAGF+KG G+DV IMVRSILLRGFDQD+A +IGE+ME 
Sbjct  334  IFWRKEAPGKTLVVGASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMANKIGEFMET  393

Query  394  ESGIAFIKESVPTSIEKLPNGQLKVTHTHGEG-----IYDTVLNATGRSPDVQMLNLPAA  448
            ES I FI+ +VP SI KL +GQL V     +G      +DTVLNATGR PDV  L L   
Sbjct  394  ESKIEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLDKV  453

Query  449  GVTLNPKSGRIDVTNEQTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLFGNGTALMDY  508
            GV LNPK+GRI VTNEQTSTP+IYAIGDVIDAPELTPVAIQAG+LLARRL+ N TALMDY
Sbjct  454  GVKLNPKTGRIAVTNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRLYNNETALMDY  513

Query  509  TKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAKECYAKL  568
             K+CTAVFTP+EYGCCGLSEE +I   G +N+++YHQNFTPLEWSLS +R  A  CY K+
Sbjct  514  DKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSCYVKV  573

Query  569  IVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIFTTLEIT  628
            I DT + K VVGFHYLGPNAGEVTQAIG+AMKL  TYD  VN VGIHPTTAEIFTTLE+T
Sbjct  574  ICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTLEVT  633

Query  629  KESGEDASASGC  640
            K SGE A++ GC
Sbjct  634  KSSGESAASGGC  645

>PYAP_17761
Length=622

 Score = 778 bits (2010),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/609 (63%), Positives = 461/609 (76%), Gaps = 12/609 (2%)

Query  37   YHVVGWKQCPYYVKAASVVSSMQHLFPSQVKATIHEHPNKESFANWLNESQTEFARQFDN  96
            Y+V GW  CP+Y KA  V  +MQ L+   V     E  ++++F  WL ES   FA+ F  
Sbjct  21   YYVAGWATCPWYRKARDVAQAMQLLYSDAVAVEAVEFESRDAFKAWLAESNAAFAQAFGT  80

Query  97   DARPLKHKSSPFCYLEQDDTPKFVGGCDDTLAFFRARTQSAPSTGAPSAANAHVSDTSSS  156
            D+  L H SSPF +    +   F+GGCD TLA FR+   + P  G PSA+   ++  +  
Sbjct  81   DSPALTHTSSPFVW---SNARGFIGGCDATLAHFRSGVAARPLAG-PSASPT-MTPVAVD  135

Query  157  DETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIP  216
            +   YD+DLVVIGGGSGGLACSKEA+K G+KV VLDYVKPSP+G+TWGLGGTCVNVGCIP
Sbjct  136  ESKTYDYDLVVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPLGTTWGLGGTCVNVGCIP  195

Query  217  KKLMHQSSIIGELLHKDAEQFGWTVSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVK  276
            KKLMHQS++IGEL+HKDA  FGW +    F WT+LV SV +YI G+NFKY+++LRDKKVK
Sbjct  196  KKLMHQSALIGELMHKDAGAFGWNMGEQKFTWTQLVESVNNYIKGINFKYKVELRDKKVK  255

Query  277  YENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAISSDDIFS  336
            YEN LG+F D HT+ L +   KKG   +T R  V+AVGGRP+ LSCPG EHAISSDDIF 
Sbjct  256  YENFLGSFVDPHTIELWHH--KKGTKTITTRHVVVAVGGRPRQLSCPGGEHAISSDDIFW  313

Query  337  KAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGEYMENESG  396
            +   PGKTLVVGASYVALECAGFLKG G++V +MVRSILLRGFD+D+A RIG++M++ES 
Sbjct  314  RKTEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFDEDMANRIGDFMQDESK  373

Query  397  IAFIKESVPTSIEKLPNGQLKVTHTHGEG-----IYDTVLNATGRSPDVQMLNLPAAGVT  451
            I FI+ +VP SIEKL NGQL V     +G     ++D+VLNATGR PDV  LNL  AGV 
Sbjct  374  IEFIRGAVPKSIEKLENGQLLVKWNSADGETVEEVFDSVLNATGRDPDVSKLNLDKAGVQ  433

Query  452  LNPKSGRIDVTNEQTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLFGNGTALMDYTKI  511
            LNPK+GRI VTNEQTSTP+++AIGDVIDAPELTPVAIQAG+LLARRL+ N T LMDY K+
Sbjct  434  LNPKTGRIAVTNEQTSTPNVFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYDKV  493

Query  512  CTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAKECYAKLIVD  571
            CTAVFTP+EYGCCGLSEE A    G DN+++YHQ+F PLEWSLS +R  A  CY K+I D
Sbjct  494  CTAVFTPIEYGCCGLSEEAAKDKYGEDNLEIYHQSFMPLEWSLSQDRVAANTCYVKVICD  553

Query  572  TTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIFTTLEITKES  631
             T+ K VVGFHYLGPNAGEVTQA+G+AMK+  TYD  VN VGIHPTTAE+FTTLE+TK S
Sbjct  554  KTRDKYVVGFHYLGPNAGEVTQAMGLAMKIGFTYDQMVNVVGIHPTTAEVFTTLEVTKSS  613

Query  632  GEDASASGC  640
            G  A+A GC
Sbjct  614  GASAAAGGC  622

>PHYCA_556160
Length=649

 Score = 773 bits (1996),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/636 (62%), Positives = 469/636 (74%), Gaps = 32/636 (5%)

Query  33   STINYHVVGWKQCPYYVKAASVVSSMQHLFPSQVKATIHEHPNKESFANWLNESQTEFAR  92
            S   +H+ GWK CP +VKA  V ++MQ L+P +V   +H   ++E+F +WL+ESQ EFA 
Sbjct  18   SVATFHIAGWKTCPSFVKAGEVATAMQMLYPDRVTFELHPFEDREAFKHWLSESQDEFAT  77

Query  93   QFDNDARPLKHKSSPFCYLEQDDTPKFVGGCDDTLAFFRA-----RTQSAPSTGAPSAAN  147
             F  D++  KH +SPF +    +   FVGGCDD L +FR+       Q A   G+P+   
Sbjct  78   SFGVDSKATKHVTSPFVW--SSNPTAFVGGCDDLLTYFRSGVGVGNPQGATPNGSPTEKT  135

Query  148  AH---------VSDTSSSD--ETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKP  196
            A          V +TS++D  ET YD+DLVVIGGGSGGLACSKEA+  GQKV VLDYVKP
Sbjct  136  AEADVPMSETSVEETSTADAEETNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKP  195

Query  197  SPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGELLHKDAEQFGWTVSNA-----SFDWTKL  251
            SP G++WGLGGTCVNVGCIPKKLMHQSS+IGE++H D   FGW +S+      +F+W +L
Sbjct  196  SPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQL  255

Query  252  VSSVQDYIHGLNFKYRIDLRDKKVKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVI  311
            VS+V  YI  +NFKY+++LR K VKYEN LG+F + HTL L +   +KG   +T R  VI
Sbjct  256  VSNVDGYIKSINFKYKVELRSKYVKYENFLGSFVNPHTLELWH--PRKGTKQITTRDVVI  313

Query  312  AVGGRPKPLSCPGWEHAISSDDIF-SKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIM  370
            AVGGRPK L+CPG EHAISSDDIF  K + PGKTLVVGASYVALECAGFLKG G+DV +M
Sbjct  314  AVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVM  373

Query  371  VRSILLRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHTHGEG-----  425
            VRSILLRGFDQD+A +IGEYME +SGI FI+++VP SI KL NGQL V  T  +G     
Sbjct  374  VRSILLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEE  433

Query  426  IYDTVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDVTNEQTSTPHIYAIGDVIDAPELTP  485
             +DTVLNATGR PDV  LNL  AGV LN KSGRI V NEQTSTP+IYAIGDVIDAPELTP
Sbjct  434  AFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNEQTSTPNIYAIGDVIDAPELTP  493

Query  486  VAIQAGKLLARRLFGNGTALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQ  545
            VAIQAG+LL+RRL+ N T  MDY K+CTAVFTP+EYGCCG+SEED+    G DNI+VYH 
Sbjct  494  VAIQAGRLLSRRLYNNSTVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHT  553

Query  546  NFTPLEWSLSHE-RPLAKECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHAT  604
            NF PLEWSLS + R  A+ CY K+I D T+ K VVGFHYLGPNAGEVTQA+G+AMKL  T
Sbjct  554  NFVPLEWSLSTDTRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFT  613

Query  605  YDDFVNTVGIHPTTAEIFTTLEITKESGEDASASGC  640
            YD  V+TVGIHPTTAE FTTLE+TK SG   +  GC
Sbjct  614  YDQMVDTVGIHPTTAESFTTLEVTKSSGGATTGGGC  649

>PHYKE_8391
Length=778

 Score = 771 bits (1991),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/639 (60%), Positives = 466/639 (73%), Gaps = 31/639 (5%)

Query  29   SSKMSTINYHVVGWKQCPYYVKAASVVSSMQHLFPSQVKATIHEHPNKESFANWLNESQT  88
            +S  S   +H+ GW+ CP + KA  V ++MQ L+P +V    H   ++++F  WL+ S+ 
Sbjct  144  ASNSSVTTFHISGWRTCPSFTKAGEVAAAMQMLYPDKVSFETHAFEDRDAFKQWLSTSKD  203

Query  89   EFARQFDNDARPLKHKSSPFCYLEQDDTPKFVGGCDDTLAFFRARTQ------SAPSTGA  142
             F   F  D++ + H +SPF +    +  KFVGGCDD LAFFR+         + P+  A
Sbjct  204  HFVMHFGADSKAVTHVTSPFVW--SSNPIKFVGGCDDLLAFFRSGVAVGSPQGADPAEKA  261

Query  143  PSAANAHVSDTSSS----------DETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLD  192
             +AA+  V+++S +          +ET YD+DLVVIGGGSGGLACSKEA+  GQKV VLD
Sbjct  262  EAAASIEVAESSMTVTETPAVPMEEETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLD  321

Query  193  YVKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGELLHKDAEQFGWTVSN-----ASFD  247
            YVKPSP G++WGLGGTCVNVGCIPKKLMHQSS+IGE +H D+  FGW V++     A+FD
Sbjct  322  YVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGETMHHDSANFGWNVASGEGKGATFD  381

Query  248  WTKLVSSVQDYIHGLNFKYRIDLRDKKVKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFR  307
            W +LVS+V  YI  +NFKY+++LR K VKYEN LG+F D HTL L +   +KG   +T R
Sbjct  382  WKQLVSNVDSYIKSINFKYKVELRSKYVKYENFLGSFLDPHTLELWH--PRKGTKQITTR  439

Query  308  RAVIAVGGRPKPLSCPGWEHAISSDDIF-SKAEAPGKTLVVGASYVALECAGFLKGQGFD  366
              V+AVGGRPK L+CPG E+AISSDDIF  K  APGKTLVVGASYVALECAGFLKG G+D
Sbjct  440  HVVVAVGGRPKQLTCPGAEYAISSDDIFWMKKTAPGKTLVVGASYVALECAGFLKGMGYD  499

Query  367  VTIMVRSILLRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHT-----  421
            V +MVRSILLRGFDQD+A +IGEYME ++GI FI+++VP SI KL NGQL V  T     
Sbjct  500  VKVMVRSILLRGFDQDMANKIGEYMEVQAGIEFIRKTVPESITKLENGQLLVKWTTEDDE  559

Query  422  HGEGIYDTVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDVTNEQTSTPHIYAIGDVIDAP  481
              E  +DTVLNATGR PDV  L L  AGV LN K+GRI   NEQTSTP+I+AIGDVIDAP
Sbjct  560  SCEETFDTVLNATGRDPDVAKLGLDKAGVKLNEKTGRIWTKNEQTSTPNIFAIGDVIDAP  619

Query  482  ELTPVAIQAGKLLARRLFGNGTALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQ  541
            ELTPVAIQAG+ L+RRL+ N T  MDY K+CTAVFTP+EYGCCGLSEED+    G DN++
Sbjct  620  ELTPVAIQAGRFLSRRLYNNSTVQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVE  679

Query  542  VYHQNFTPLEWSLSHERPLAKECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKL  601
            VYH+NF PLEWSLS  R  ++ CY K+I DTT+ K VVGFHYLGPNAGEVTQA+G+AMKL
Sbjct  680  VYHKNFVPLEWSLSESRTSSESCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKL  739

Query  602  HATYDDFVNTVGIHPTTAEIFTTLEITKESGEDASASGC  640
              TYD  V+TVGIHPTTAE FTTLE+TK SG   +  GC
Sbjct  740  GFTYDQMVDTVGIHPTTAEAFTTLEVTKSSGATTTGGGC  778

>PYIW_19972
Length=609

 Score = 766 bits (1978),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/632 (62%), Positives = 462/632 (73%), Gaps = 50/632 (8%)

Query  27   RQSSKMSTIN-------------YHVVGWKQCPYYVKAASVVSSMQHLFPSQVKATIHEH  73
            ++ + M+T+N             YH+ GW+ C +Y KA+ V+ +M+ L+P  V   IHE 
Sbjct  10   KREATMATVNIKETLVRGGGPPTYHIAGWRGCGFYKKASDVMQAMRVLYPDAVDCEIHEF  69

Query  74   PNKESFANWLNESQTEFARQFDNDARPLKHKSSPFCYLEQDDTPKFVGGCDDTLAFFRAR  133
            P++E+F  WL+ S  +FA  F  D++   H SSPF    +D++P                
Sbjct  70   PDREAFRAWLSASAADFAANFGADSKAATHTSSPF--FGKDESP----------------  111

Query  134  TQSAPSTGAPSAANAHVSDTSSSDETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDY  193
                     P+   A V D    D   YD+DL+VIGGGSGGLACSKEA+K G+KV VLDY
Sbjct  112  --------TPTMVAAPVVD----DNVTYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLDY  159

Query  194  VKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGELLHKDAEQFGWTVSNASFDWTKLVS  253
            VKPSP G+TWGLGGTCVNVGCIPKKLMHQSS+IGE +HKDA  FGW+V    FDW +++ 
Sbjct  160  VKPSPGGTTWGLGGTCVNVGCIPKKLMHQSSLIGETIHKDAAAFGWSVGEQKFDWAQMLK  219

Query  254  SVQDYIHGLNFKYRIDLRDKKVKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAV  313
            SV  YI  +NFKY+++LRDKKVKYEN+LG+F DAHTL L +   KKG   VT R  VIAV
Sbjct  220  SVNSYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLELWH--PKKGTKTVTTRDVVIAV  277

Query  314  GGRPKPLSCPGWEHAISSDDIFSKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRS  373
            GGRPKPLSC G E AISSDDIF + EAPGKTLV+GASYVALECAGF+KG G+DV IMVRS
Sbjct  278  GGRPKPLSCEGGELAISSDDIFWRKEAPGKTLVIGASYVALECAGFMKGMGYDVKIMVRS  337

Query  374  ILLRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHTHGEG-----IYD  428
            ILLRGFDQD+A +IGE+ME ES I FI+ +VP SI KL +GQL V     +G      +D
Sbjct  338  ILLRGFDQDMASKIGEFMEVESKIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFD  397

Query  429  TVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDVTNEQTSTPHIYAIGDVIDAPELTPVAI  488
            TVLNATGR PDV  LNL + GV LNPK+GRI VTNEQTS P+I+AIGDVIDAPELTPVAI
Sbjct  398  TVLNATGRDPDVAKLNLDSVGVQLNPKTGRIAVTNEQTSVPNIFAIGDVIDAPELTPVAI  457

Query  489  QAGKLLARRLFGNGTALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFT  548
            QAG++LARRL+ N TALMDY K+CTAVFTP+EYGCCGLSEE +I   G D +++YHQNFT
Sbjct  458  QAGRMLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFT  517

Query  549  PLEWSLSHERPLAKECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDF  608
            PLEWSLS +R  A  CY K+I DTT+ K VVGFHYLGPNAGEVTQAIG+AMKL  TYDD 
Sbjct  518  PLEWSLSSDRQAAGSCYVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDM  577

Query  609  VNTVGIHPTTAEIFTTLEITKESGEDASASGC  640
            VN VGIHPTTAEIFTTLE+TK SGE A+A GC
Sbjct  578  VNVVGIHPTTAEIFTTLEVTKSSGESAAAGGC  609

>PITG_18452
Length=856

 Score = 754 bits (1946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/632 (60%), Positives = 457/632 (72%), Gaps = 38/632 (6%)

Query  33   STINYHVVGWKQCPYYVKAASVVSSMQHLFPSQVKATIHEHPNKESFANWLNESQTEFAR  92
            S   +++ GWK C  +VKA  V ++MQ L+P +V    H   ++ +F  WL+ SQ +   
Sbjct  18   SVATFYIAGWKSCTSFVKAREVAAAMQMLYPDRVAFETHPFEDRNAFKQWLSASQDDITA  77

Query  93   QFDNDARPLKHKSSPFCYLEQDDTPKFVGGCDDTLAFFRA-------------RTQSAPS  139
             F  D+R  KH +SPF +     +  FVGGCD+ LAFFR+               Q  PS
Sbjct  78   HFGADSRATKHVTSPFVW----SSTIFVGGCDELLAFFRSGIAVGKPQGVMPSEKQPTPS  133

Query  140  T-------GAPSAANAHVSDTSSSDETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLD  192
            +       G+     A  S T++ +E  YD+DLVVIGGGSGGLACSKEA+  GQKV VLD
Sbjct  134  SALAPETDGSMPDVAAETSSTAAKEEASYDYDLVVIGGGSGGLACSKEAASFGQKVCVLD  193

Query  193  YVKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGELLHKDAEQFGWTVSNAS-----FD  247
            YVKPSP G++WGLGGTCVNVGCIPKKLMHQSS+IGE+LH D+  FGW VS+       FD
Sbjct  194  YVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVLHHDSASFGWNVSSGQGSAPIFD  253

Query  248  WTKLVSSVQDYIHGLNFKYRIDLRDKKVKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFR  307
            W +LV++V  YI G+NFKY+++LR K VKYEN LG+F D HTL L +   +KG   +T R
Sbjct  254  WKQLVTNVDGYIRGINFKYKVELRSKYVKYENFLGSFIDPHTLELWH--PRKGSKQITTR  311

Query  308  RAVIAVGGRPKPLSCPGWEHAISSDDIF-SKAEAPGKTLVVGASYVALECAGFLKGQGFD  366
              VIAVGGRP+ L+ PG EHAISSDDIF  K + PGKTLVVGASYVALECAGFLKG G+D
Sbjct  312  DVVIAVGGRPRELTIPGGEHAISSDDIFWMKTKEPGKTLVVGASYVALECAGFLKGMGYD  371

Query  367  VTIMVRSILLRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHTHGEG-  425
            V +MVRSILLRGFDQD+A +IGEYME +SGI FI+++VP SI KL NGQL V  T  +G 
Sbjct  372  VKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGE  431

Query  426  ----IYDTVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDVTNEQTSTPHIYAIGDVIDAP  481
                 +D+VLNATGR PD+  L+L  AGV LN K+GRI V +EQTSTP+IYAIGDVIDAP
Sbjct  432  SCEEAFDSVLNATGRDPDIAKLDLDKAGVKLNEKTGRIWVKHEQTSTPNIYAIGDVIDAP  491

Query  482  ELTPVAIQAGKLLARRLFGNGTALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQ  541
            ELTPVAIQAG+LL+RRL+ N T  MDY K+CTAVFTP+EYGCCGLSEED+I   G+D I+
Sbjct  492  ELTPVAIQAGRLLSRRLYNNATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIE  551

Query  542  VYHQNFTPLEWSLSHE-RPLAKECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMK  600
            VYH NF PLEWSLS E R  A+ CY K+I D  + K VVGFHYLGPNAGEVTQA+G+AMK
Sbjct  552  VYHTNFVPLEWSLSTETRAAAESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMK  611

Query  601  LHATYDDFVNTVGIHPTTAEIFTTLEITKESG  632
            L  TYD  V+TVGIHPTTAE FTTLE+TK SG
Sbjct  612  LGFTYDQMVDTVGIHPTTAESFTTLEVTKSSG  643

>HYAP_07095
Length=613

 Score = 711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/617 (59%), Positives = 442/617 (72%), Gaps = 38/617 (6%)

Query  58   MQHLFPSQVKATIHEHPNKESFANWLNESQTEFARQFDNDARPLKHKSSPFCYLEQDDTP  117
            M  ++P +V    H   ++++F  WL+ S  +F  QF  D++   H +SPF ++    T 
Sbjct  1    MHVMYPGRVAFETHAFEDRDAFKQWLSTSYEDFVTQFGLDSKATTHVTSPFVWISNPTT-  59

Query  118  KFVGGCDDTLAFFRA-----RTQSAPST---GAPSAANAHVSDTSSS-------------  156
             FVGGCDD LA FR+       Q   ST   G      A + DT+S+             
Sbjct  60   -FVGGCDDLLAVFRSGIAVGNIQDVASTREDGETLDGTAPMDDTASASELNESRTPPIVV  118

Query  157  -DETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCI  215
             D+  YD+DLVVIGGGSGGLACSKEA+  G+KV VLDYVKPSP G++WGLGGTCVNVGCI
Sbjct  119  EDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCI  178

Query  216  PKKLMHQSSIIGELLHKDAEQFGWTVSNA-----SFDWTKLVSSVQDYIHGLNFKYRIDL  270
            PKKLMHQSS+IGE+LH D   FGW V +      +FDW +LVS+V  YI  ++FKY+++L
Sbjct  179  PKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVSSYIKSISFKYKVEL  238

Query  271  RDKKVKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAIS  330
            R K+VKYEN+LG+F D HTL L +   KKG  ++T R  VIAVGGRP+ L+C G E A+S
Sbjct  239  RSKQVKYENVLGSFVDPHTLKLWH--PKKGTKEITTRHVVIAVGGRPRQLACLGGELAVS  296

Query  331  SDDIF-SKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGE  389
            SDDIF  K + PGKTLVVGASYVALECAGFLKG G+ V +MVRSILLRGFDQD+A +IGE
Sbjct  297  SDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGE  356

Query  390  YMENESGIAFIKESVPTSIEKLPNGQLKVTHTHGEG-----IYDTVLNATGRSPDVQMLN  444
            YME +SGI FI+++VP SI KL +GQL V     +G      +DTVLNATGR PDV  L 
Sbjct  357  YMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLG  416

Query  445  LPAAGVTLNPKSGRIDVTNEQTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLFGNGTA  504
            L  AGV LN K+GRI V NEQT+TP++YAIGDVIDAPELTPVAIQAG+LL+RRL+  GT 
Sbjct  417  LDEAGVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTV  476

Query  505  LMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAKE-  563
             MDY KICTAVFTP+EYGCCGLSEED+    G D+++VYH+NF PLEWSL+ +  +A E 
Sbjct  477  QMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAES  536

Query  564  CYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIFT  623
            CY K++ D T+   V+GFHYLGPNAGEVTQA+G+AMKL  TYD  V+TVGIHPTTAE FT
Sbjct  537  CYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHPTTAEAFT  596

Query  624  TLEITKESGEDASASGC  640
            TLE TK SG+  +  GC
Sbjct  597  TLETTKSSGDSTTGGGC  613

>PYAR_13569
Length=494

 Score = 708 bits (1827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/489 (71%), Positives = 400/489 (82%), Gaps = 7/489 (1%)

Query  157  DETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIP  216
            DE  YD+DLVVIGGGSGGLACSKEA+K G+KV+VLDYVKPSP+G+TWGLGGTCVNVGCIP
Sbjct  8    DEATYDYDLVVIGGGSGGLACSKEAAKHGKKVMVLDYVKPSPLGTTWGLGGTCVNVGCIP  67

Query  217  KKLMHQSSIIGELLHKDAEQFGWTVSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVK  276
            KKLMHQS+++GEL+HKDA  FGWT    SF WT+LV+SV +YI G+NFKY+++LRDKKVK
Sbjct  68   KKLMHQSALLGELMHKDAPAFGWTTGAQSFTWTQLVASVNNYIKGINFKYKVELRDKKVK  127

Query  277  YENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAISSDDIFS  336
            YEN LG+F DAHT+ L +   KK    VT R  VIAVGGRP+ L+CPG EHAISSDDIF 
Sbjct  128  YENFLGSFVDAHTIELWHH--KKPAKTVTTRHVVIAVGGRPRALTCPGGEHAISSDDIFW  185

Query  337  KAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGEYMENESG  396
            +   PGKTLVVGASYVALECAGFLKG G+DV IMVRSILLRGFDQD+A RIG++M++ES 
Sbjct  186  RKTEPGKTLVVGASYVALECAGFLKGMGYDVKIMVRSILLRGFDQDMANRIGDFMQDESR  245

Query  397  IAFIKESVPTSIEKLPNGQLKVTHTHGEG-----IYDTVLNATGRSPDVQMLNLPAAGVT  451
            I FI+  VP SIEK  NG+L V     +G     ++DTVLNATGR PDV  LNL  AGV 
Sbjct  246  IEFIRGVVPKSIEKQENGKLLVKWNSPDGDEVEELFDTVLNATGRDPDVTKLNLDKAGVE  305

Query  452  LNPKSGRIDVTNEQTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLFGNGTALMDYTKI  511
            LNPKSGRI  TNEQTSTP+I+AIGDVIDAPELTPVAIQAG+LLARRL+ N T LMDY KI
Sbjct  306  LNPKSGRIAQTNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYDKI  365

Query  512  CTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAKECYAKLIVD  571
            CTAVFTP+EYGCCGLSEEDA A  G +N+++YHQ+F PLEWSLS ER  A  CY K+I D
Sbjct  366  CTAVFTPIEYGCCGLSEEDAKAKYGEENLEIYHQSFMPLEWSLSEERVAAATCYVKVICD  425

Query  572  TTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIFTTLEITKES  631
             T+ K VVGFHYLGPNAGEVTQA+G+AMK+  TYD  VN VGIHPTTAE+FTTLEITK S
Sbjct  426  KTRDKHVVGFHYLGPNAGEVTQAMGLAMKVGFTYDQMVNVVGIHPTTAEVFTTLEITKSS  485

Query  632  GEDASASGC  640
            G  A+A GC
Sbjct  486  GASAAAGGC  494

>PHALS_06481
Length=644

 Score = 692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/621 (56%), Positives = 442/621 (71%), Gaps = 25/621 (4%)

Query  37   YHVVGWKQCPYYVKAASVVSSMQHLFPSQVKATIHEHPNKESFANWLNESQTEFARQFDN  96
            +++ GWK CP ++KA  +V++MQ L+P ++   I    ++E F  WL  SQ +FA  F  
Sbjct  32   FYLAGWKTCPSFIKAREIVAAMQMLYPDRLAFKILLFEDREKFRVWLKASQGDFAVSFGA  91

Query  97   DARPLKHKSSPFCYLEQDDTPKFVGGCDDTLAFFRARTQSAPSTGAPSAAN-----AHVS  151
             ++ +KH +SPF +     T  FVGGCDD L FFR    S  + G P   +     A +S
Sbjct  92   KSKAMKHVTSPFVWSSNPTT--FVGGCDDLLLFFR----SGIAVGRPQGMHTSDEVAEIS  145

Query  152  DTSSSDETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVN  211
             T+  ++  +D+DLVVIGGG GGLACSKEA+  GQKV VLDYVKPSP G+ WGLGGTCVN
Sbjct  146  STAVQEKPIFDYDLVVIGGGLGGLACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVN  205

Query  212  VGCIPKKLMHQSSIIGELLHKDAEQFGWTVSNAS-----FDWTKLVSSVQDYIHGLNFKY  266
            VGCIPKKL+HQSS+IGE++  D+ +FGW   N       FDW +LV++V  YI  +NFKY
Sbjct  206  VGCIPKKLIHQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKY  265

Query  267  RIDLRDKKVKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWE  326
            ++ LR K VKYEN LG+F D HT+ L++   +KG   +T R  VIAVG RP+ L+CPG E
Sbjct  266  KVKLRSKNVKYENFLGSFVDPHTVKLSHP--RKGTKQITTRNVVIAVGSRPRELTCPGGE  323

Query  327  HAISSDDIF-SKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIAR  385
            +A+SSDDIF  K + PGKTLV+GASYVALECAGFLKG G++V +MVRSILLR FDQ++A 
Sbjct  324  YAVSSDDIFWMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVRSILLRSFDQEMAD  383

Query  386  RIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHTHGEG-----IYDTVLNATGRSPDV  440
            +IGEYME +SGI FI+++VP SI +L N QL V     +G      ++TVLNATGR P+V
Sbjct  384  KIGEYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEV  443

Query  441  QMLNLPAAGVTLNPKSGRIDVTNEQTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLFG  500
              L L  AGV LN K+GRI V NEQTST +IYAIGDV+DAPELTPVAIQ+G+LL++RL+ 
Sbjct  444  AHLGLDKAGVKLNEKTGRIMVKNEQTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYN  503

Query  501  NGTALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHE-RP  559
            N +  MDY K+CT VFTP+EYGCCGLSEE +    G DNI++YH NF PLEWSLS E R 
Sbjct  504  NSSVQMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRT  563

Query  560  LAKECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTA  619
             +  CY K++ D ++ K V+GFHYLGPNAGEV QA+G+AM+L  TYD  VNTVGIHP TA
Sbjct  564  ASNSCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTA  623

Query  620  EIFTTLEITKESGEDASASGC  640
            E  T LE+TK SG   +  GC
Sbjct  624  ESLTILEVTKSSGGATTGGGC  644

>PHYSO_348901
Length=526

 Score = 689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/495 (69%), Positives = 394/495 (80%), Gaps = 14/495 (3%)

Query  158  ETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPK  217
            ET YD+DLVVIGGGSGGLACSKEA+  GQKV VLDYVKPSP G++WGLGGTCVNVGCIPK
Sbjct  34   ETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPK  93

Query  218  KLMHQSSIIGELLHKDAEQFGWTVSNA-----SFDWTKLVSSVQDYIHGLNFKYRIDLRD  272
            KLMHQSS+IGEL+H D+  FGW +++A     +F W +LV++V  YI G+NFKY+++LR 
Sbjct  94   KLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRS  153

Query  273  KKVKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAISSD  332
            K VKYEN LG+F DAHTL L +   +KG   +T R  VIAVGGRPK L+CPG EHAISSD
Sbjct  154  KYVKYENFLGSFVDAHTLELWH--PRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSD  211

Query  333  DIF-SKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGEYM  391
            DIF  K + PGKTLVVGASYVALECAGFLKG G+DV +MVRSILLRGFDQD+A +IGEYM
Sbjct  212  DIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYM  271

Query  392  ENESGIAFIKESVPTSIEKLPNGQLKVTHTHGEG-----IYDTVLNATGRSPDVQMLNLP  446
            E +SGI FI+++VP SI KL NGQL V  T  +G      +DTVLNATGR PDV  L L 
Sbjct  272  EVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLD  331

Query  447  AAGVTLNPKSGRIDVTNEQTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLFGNGTALM  506
             A V LN K+GRI V NEQTSTP+IYAIGDVIDAPELTPVAIQAG+LL+RRL+ N TA M
Sbjct  332  KARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQM  391

Query  507  DYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHE-RPLAKECY  565
            DY KICTAVFTP+EYGCCGLSEED+    G DNI+VYH+NF PLEWSLS E R  A+ CY
Sbjct  392  DYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESCY  451

Query  566  AKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIFTTL  625
             K+I D T+ K VVGFHYLGPNAGEVTQA+G+AMKL  TYD  V+TVGIHPTTAE FTTL
Sbjct  452  LKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAETFTTL  511

Query  626  EITKESGEDASASGC  640
            EITK SG   +  GC
Sbjct  512  EITKSSGGTTTGGGC  526

>PHYRA_50855
Length=489

 Score = 672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/490 (68%), Positives = 387/490 (79%), Gaps = 12/490 (2%)

Query  161  YDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLM  220
            YD+DLVVIGGGSGGLACSKEA+  G+KV VLDYVKPSP G++WGLGGTCVNVGCIPKKLM
Sbjct  2    YDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  61

Query  221  HQSSIIGELLHKDAEQFGWTV----SNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVK  276
            HQSS+IGE++H D+  FGW V    S  +F+W +LVS+V  YI  +NFKY+++LR K VK
Sbjct  62   HQSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVK  121

Query  277  YENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAISSDDIF-  335
            YEN LG+F D HTL L +   +KG   +T R  VIAVGGRPK LSCPG EHAISSDDIF 
Sbjct  122  YENFLGSFVDPHTLELWHH--RKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFW  179

Query  336  SKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGEYMENES  395
             K + PGKTLVVGASYVALECAGFLKG G++V +MVRSILLRGFDQD+A +IGEYME +S
Sbjct  180  MKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFDQDMANKIGEYMEVQS  239

Query  396  GIAFIKESVPTSIEKLPNGQLKVTHTHGEG-----IYDTVLNATGRSPDVQMLNLPAAGV  450
            GI FI+++VP SI  L NGQL V  T+ +G      +DTVLNATGR PDV  L L  AGV
Sbjct  240  GIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGV  299

Query  451  TLNPKSGRIDVTNEQTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLFGNGTALMDYTK  510
             LN KSGRI V NEQTST +IYA+GDVIDAPELTPVAIQAG+LL+RRL+ N TA MDY K
Sbjct  300  KLNEKSGRIWVKNEQTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYEK  359

Query  511  ICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAKECYAKLIV  570
            +CTAVFTP+EYGCCGLSEED+    G DN++VYH NF PLEWSLS  R  A+ CY K+I 
Sbjct  360  VCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVIC  419

Query  571  DTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIFTTLEITKE  630
            D T+ K VVGFHYLGPNAGEVTQA+G+AMKL  TYD  V+TVGIHPTTAE FTTLE+TK 
Sbjct  420  DKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTKS  479

Query  631  SGEDASASGC  640
            SG   +  GC
Sbjct  480  SGGATTGGGC  489

>PYVX_18170
Length=510

 Score = 659 bits (1699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/543 (64%), Positives = 399/543 (73%), Gaps = 41/543 (8%)

Query  105  SSPFCYLEQDDTPKFVGGCDDTLAFFRARTQSAPSTGAPSAANAHVSDTSSSDETQYDWD  164
            SSPF +    +   FVGGCD  L  FR++    P+  +   AN  V              
Sbjct  2    SSPFVW--TSNPTAFVGGCDALLDRFRSQVPR-PNAASKPQANGEV--------------  44

Query  165  LVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQSS  224
                           EASK GQKVLVLDYVKPSP G+ WGLGGTCVNVGCIPKKLMHQS+
Sbjct  45   ---------------EASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSA  89

Query  225  IIGELLHKDAEQFGWTVSNA-SFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYENMLGT  283
            +IGE++HKDA  FGW   NA  FDW++L SSV  YI  LNFKY++DLRDKKVKYEN LG 
Sbjct  90   LIGEVMHKDAALFGWQFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGA  149

Query  284  FKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAISSDDIFSKAEAPGK  343
            F D HT+ L+N   +K    VT RR V+AVGGRP+ L CPG E +I+SDDIF +  APGK
Sbjct  150  FVDPHTIELSN--PRKPSKTVTTRRVVVAVGGRPRLLPCPGGELSITSDDIFWRKTAPGK  207

Query  344  TLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGEYMENESGIAFIKES  403
            TLVVGASYVALECAGFLKGQG+DV +MVRSILLRGFDQD+A RIGEYME E+GI FI+E+
Sbjct  208  TLVVGASYVALECAGFLKGQGYDVKVMVRSILLRGFDQDMANRIGEYMEVEAGIEFIRET  267

Query  404  VPTSIEKLPNGQLKVTHTHGEG-----IYDTVLNATGRSPDVQMLNLPAAGVTLNPKSGR  458
            VP+SI KL +G+L V  T  +G      +DTVLNATGR+PDV  L L  AGV LNPK+GR
Sbjct  268  VPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGR  327

Query  459  IDVTNEQTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLFGNGTALMDYTKICTAVFTP  518
            I VTNEQTSTP+I+AIGDVIDAPELTPVAIQAG+LLARRL+ N T LMDY K+CTAVFTP
Sbjct  328  ILVTNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYEKVCTAVFTP  387

Query  519  VEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHE-RPLAKECYAKLIVDTTQQKR  577
            +EYGCCGLSEE++I   G DNI+VYHQNFTPLEW+LS + RP    CY K+I D T+   
Sbjct  388  IEYGCCGLSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLF  447

Query  578  VVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIFTTLEITKESGEDASA  637
            VVGFHYLGPNAGEVTQAIG+AMKL  TY+  V+ VGIHPTTAE FTTLE+TK SG  A+ 
Sbjct  448  VVGFHYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHPTTAETFTTLEVTKSSGASAAG  507

Query  638  SGC  640
              C
Sbjct  508  GNC  510

>SDRG_14408
Length=528

 Score = 425 bits (1093),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 246/504 (49%), Positives = 321/504 (64%), Gaps = 31/504 (6%)

Query  154  SSSDETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVG  213
            ++S  + +D+D VVIGGGSGG+A +KEA++LG KV + D+VKP+  G+ WGLGGTCVNVG
Sbjct  16   TTSTMSNFDYDFVVIGGGSGGMAAAKEAARLGAKVALFDFVKPTVHGTKWGLGGTCVNVG  75

Query  214  CIPKKLMHQSSIIGELLHKDAEQFGWTV-SNASFDWTKLVSSVQDYIHGLNFKYRIDLRD  272
            C+PKK+MH S I+G  LH DA   GW +      +W  LV +VQ ++  LNF YR+ LR 
Sbjct  76   CVPKKIMHYSGILGAGLH-DAAHLGWQLPEKVEHNWETLVETVQAHVKKLNFSYRVGLRS  134

Query  273  KKVKYENMLGTFKDAHTLTLTNEAKKKGPTD-VTFRRAVIAVGGRPK-PLSCPG-WEHAI  329
             KV+Y N L  F+D HTL+      K GPT  +T    +IA GGRP  P   PG  E+AI
Sbjct  135  NKVQYINALARFEDPHTLSY---QIKNGPTQTLTAAHILIATGGRPTVPKEIPGVGEYAI  191

Query  330  SSDDIFSKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGE  389
            +SDD+FS   APGKTLVVG SY+ALECAGFL    +  T+ VRSILLRGFD+ +A +I +
Sbjct  192  TSDDLFSLTTAPGKTLVVGGSYIALECAGFLNELHYPTTVAVRSILLRGFDRQVAAKIQD  251

Query  390  YMENESGIAFIKESVPTSIEK-LPNGQLKVTHTHGEG------IYDTVLNATGRSPDVQM  442
             M  + G+ F   ++PTSI K    GQL V+  + E       ++DTVL A GR+ D   
Sbjct  252  IMVAQ-GMDFRFNTLPTSIVKDDATGQLHVSFANSETNETFTEVFDTVLYAVGRTADTFN  310

Query  443  LNLPAAGVTLNPKSGRIDVTNEQTSTPHIYAIGDVIDA-PELTPVAIQAGKLLARRLFG-  500
            + L   GV   P +G+ +  NE T+ PHI+A+GDV+   PELTPVAI+AG+ L RRLF  
Sbjct  311  IGLEKVGVKALP-NGKFETVNEATNVPHIHAVGDVLQGKPELTPVAIRAGEHLVRRLFKP  369

Query  501  NGTALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERP-  559
            N T  M+Y  I T VFTPVEYG  GLSEE+AIA  G+D++ VY   F  LEW   H +  
Sbjct  370  NYTKTMNYDLIPTTVFTPVEYGTIGLSEEEAIARYGKDDVVVYPWEFQTLEWGAVHRQKA  429

Query  560  -----------LAKECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDF  608
                           C +KL+   +  ++V+GFH++GPNAGEVTQ   VA+ + AT +DF
Sbjct  430  ESAQEGDYDTEFPANCLSKLVCQKSANEKVLGFHFVGPNAGEVTQGFAVAVTMGATKEDF  489

Query  609  VNTVGIHPTTAEIFTTLEITKESG  632
             N +GIHPT AE F  L +TKESG
Sbjct  490  DNVIGIHPTDAESFMALTVTKESG  513

>SPRG_04074
Length=509

 Score = 424 bits (1091),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 247/499 (49%), Positives = 318/499 (64%), Gaps = 31/499 (6%)

Query  159  TQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKK  218
            + +D+D VVIGGGSGG+A +KEA++LG KV + D+VKP+  G+ WGLGGTCVNVGC+PKK
Sbjct  2    SNFDYDFVVIGGGSGGMAAAKEAARLGAKVALFDFVKPTVHGTKWGLGGTCVNVGCVPKK  61

Query  219  LMHQSSIIGELLHKDAEQFGWTV-SNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKY  277
            +MH S I+G  LH DA   GW V      +W  LV +VQ ++  LNF YR+ LR  KV+Y
Sbjct  62   IMHYSGILGAGLH-DAAHLGWQVPEKVEHNWETLVEAVQAHVKKLNFSYRVGLRSNKVQY  120

Query  278  ENMLGTFKDAHTLTLTNEAKKKGPTD-VTFRRAVIAVGGRPK-PLSCPG-WEHAISSDDI  334
             N L  F+D HTL+      K GPT  +T    +IA GGRP  P   PG  E+AI+SDD+
Sbjct  121  INALARFEDPHTLSY---QVKNGPTQTLTAAHILIATGGRPTVPKDIPGVAEYAITSDDL  177

Query  335  FSKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGEYMENE  394
            FS + APGKTLVVG SY+ALECAGFL    +  T+ VRSILLRGFD+ +A +I + M  +
Sbjct  178  FSLSTAPGKTLVVGGSYIALECAGFLNELHYPTTVAVRSILLRGFDRQVAAKIQDIMVAQ  237

Query  395  SGIAFIKESVPTSIEK-LPNGQLKVTHTHGEG------IYDTVLNATGRSPDVQMLNLPA  447
             G+ F   ++PTSI K    GQL V+  + E        +DTVL A GR+ D   + L  
Sbjct  238  -GMDFRFNTLPTSIVKDEATGQLHVSFANSETHETFTEAFDTVLYAVGRTADTFNIGLEK  296

Query  448  AGVTLNPKSGRIDVTNEQTSTPHIYAIGDVIDA-PELTPVAIQAGKLLARRLFG-NGTAL  505
            AGV   P +G+ +  NE T+ PHI+A+GDV+   PELTPVAI+AG+ L RRLF  N T  
Sbjct  297  AGVKALP-NGKFETVNEATNVPHIHAVGDVLQGKPELTPVAIRAGEHLVRRLFKPNYTKT  355

Query  506  MDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERP------  559
            M+Y  I T VFTPVEYG  GLSEE+AI   G+D+I VY   F  LEW   H +       
Sbjct  356  MNYDLIPTTVFTPVEYGTIGLSEEEAITRYGKDDIVVYPWEFQTLEWGAVHRKKAESAQE  415

Query  560  ------LAKECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVG  613
                      C +KL+   +  ++V+GFH++GPNAGEVTQ   VA+ + AT +DF N +G
Sbjct  416  GDYDTEFPANCLSKLVCQKSANEKVLGFHFVGPNAGEVTQGFAVAVTMGATKEDFDNVIG  475

Query  614  IHPTTAEIFTTLEITKESG  632
            IHPT AE F  L +TKESG
Sbjct  476  IHPTDAESFMALTVTKESG  494

>PYAR_17512
Length=533

 Score = 261 bits (666),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 182/518 (35%), Positives = 264/518 (51%), Gaps = 50/518 (10%)

Query  154  SSSDETQYDWDLVVIGGGSGGLACSKEASKL-GQKVLVLDYVKPSPVGSTWGLGGTCVNV  212
            S++++ +YD+  +VIG GSGG+A S+ A+     +V V++  +         LGGTCVNV
Sbjct  27   STANDVEYDY--LVIGAGSGGMASSRRAASYPNTRVAVVEQAR---------LGGTCVNV  75

Query  213  GCIPKKLMHQSSIIGELLHKDAEQFGW--------TVSNASFDWTKLVSSVQDYIHGLNF  264
            GC+PKK+M+ ++ +G LLH+D   +G+         +    F W KL      Y+  LN 
Sbjct  76   GCVPKKIMYLAANMGHLLHRDLFHYGFETKRGGGHLIDETQFHWNKLKERRDAYVLRLNG  135

Query  265  KYRIDLRDKKVKYENMLGTFK-------DAHTLTLTN-------EAKKKGPTDV-----T  305
             Y  +L + KV+      TF        D   +   N           +G  +V     +
Sbjct  136  IYERNLGNSKVELLTGTATFNAQGNVEVDGKEIPAKNVLIAVXXXXNAQGNVEVDGKEIS  195

Query  306  FRRAVIAVGGRPKPLSCPGWEHAISSDDIFSKAEAPGKTLVVGASYVALECAGFLKGQGF  365
             +  +IAVGG+P   + PG EH I SD  F   E P K  VVGA Y+A+E AG L G G 
Sbjct  196  AKNVLIAVGGKPLIPNIPGKEHCIDSDGFFELEEMPKKVAVVGAGYIAVELAGVLHGLGS  255

Query  366  DVTIMVRSI-LLRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHTHG-  423
            D TI  R   +LRGFD+ I   + + M+ + G+     S+   + K  +G   +    G 
Sbjct  256  DTTIFCRKDGVLRGFDELIRSTLHDAMDKD-GLKLRPHSLVAKVTKQADGTKTLVLQDGT  314

Query  424  -EGIYDTVLNATGRSPDVQMLNLPAAGVTLNPKSG-RIDVTNEQTSTPHIYAIGDVIDAP  481
                +DTV+ A GR P  Q LNL  AGV  + +   +ID     T+  +I+A+GDV   P
Sbjct  315  EHAGFDTVIYAAGRVPLTQSLNLEGAGVETDAQGFIKIDEYQRTTAKKNIFAVGDVCGTP  374

Query  482  ELTPVAIQAGKLLARRLFGN-GTALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNI  540
             LTPVAI AG+ L+ RLFG    A M Y  I T VF+    G  GL+E++A A  G D +
Sbjct  375  ALTPVAIAAGRRLSDRLFGGMKEAKMSYENIPTVVFSHPPIGTVGLTEKEARAKHGDDAV  434

Query  541  QVYHQNFTPLEWSLSHE-----RPLAKECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAI  595
            +VY   F  + + + +E     +   K   A  +V   ++++VVG H +G  A E+ Q  
Sbjct  435  KVYSSRFVNMHYGIVNEFGNDGQQKPKPMTAMKLVCVGKEEKVVGVHLIGMAADEILQGF  494

Query  596  GVAMKLHATYDDFVNTVGIHPTTAEIFTTLEITKESGE  633
            GVA+K+ AT  DF + V IHPT AE   T+     SGE
Sbjct  495  GVAVKMGATKADFDSCVAIHPTAAEELVTMAPWGLSGE  532

>SDRG_12187
Length=462

 Score = 257 bits (656),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 181/476 (38%), Positives = 253/476 (53%), Gaps = 30/476 (6%)

Query  160  QYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKL  219
            Q  +DLVV+GGGSGG+A ++ A+  G+KVLV++  +         LGGTCVNVGC+PKK+
Sbjct  2    QRVYDLVVMGGGSGGIASARRAATYGKKVLVVERGR---------LGGTCVNVGCVPKKV  52

Query  220  MHQSSIIGELLHKDAEQFGW-TVSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYE  278
            M+ ++ +   +  DA  +G+  V N + DW  L      Y+  LN  Y  +L+   V + 
Sbjct  53   MYAAADLAHSMRHDAPAYGFPAVPNTTVDWATLKQRRDAYVTRLNGIYSRNLQGSGVDFA  112

Query  279  NMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAISSDDIFSKA  338
              L +F     + +        P D      ++AVGG+P     PG EH ISSD  F   
Sbjct  113  QGLCSFGSDGRVQIDAT-----PLDAEATNVLVAVGGQPVMPDIPGIEHCISSDGFFELD  167

Query  339  EAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSI-LLRGFDQDIARRIGEYMENESGI  397
            E P +  VVGA Y+A+E AG L+G G D TI  R   +LR FD D+ + +        GI
Sbjct  168  ERPARVAVVGAGYIAVELAGVLRGLGSDTTIFCRQQGVLRSFD-DMLQAVLHDAFQRDGI  226

Query  398  AFIKESVPTSIEKLP-NGQLKVTHTHGE--GIYDTVLNATGRSPDVQMLNLPAAGVTLNP  454
                 S    ++K P  G L VT T GE    +D VL ATGR+P  + L L   G+ L+P
Sbjct  227  TLQPHSTIARVDKDPTTGSLSVTTTAGEHHSGFDCVLVATGRTPMTKDLGLEHRGIQLSP  286

Query  455  KSGRIDVTNEQ-TSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLFGN-GTALMDYTKIC  512
             +G I V   Q TS P ++A+GDV+D   LTPVAI AG+ LA RLFG    A  DYT I 
Sbjct  287  -NGFIPVDAYQATSAPGVFALGDVVDTAALTPVAIAAGRRLADRLFGGLHDAKADYTNIP  345

Query  513  TAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSL---SHERPLAKECYAKLI  569
            + VF+    G  GL+E++A      D ++VY   F  + +SL   +HE+P      A  +
Sbjct  346  SVVFSHPPIGTIGLTEQEARKVYRDDELKVYSSKFVNMHYSLYEHAHEKPTT----AMKL  401

Query  570  VDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIFTTL  625
            +     +++VG H +G  A E+ Q  GVA+K+ A   D    + IHPT AE   TL
Sbjct  402  ICVGPSEKIVGLHVIGRGADEMLQGFGVAIKMGACKKDLDACIAIHPTAAEELVTL  457

>SDRG_03822
Length=494

 Score = 255 bits (652),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 171/476 (36%), Positives = 251/476 (53%), Gaps = 28/476 (6%)

Query  163  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  222
            +D +V+G GSGG++ +  A   G KVLV++  + +      GLGGTCVNVGC+PKK+M  
Sbjct  4    YDYIVLGAGSGGVSSAHRAVAYGAKVLVIERGQAN---DGAGLGGTCVNVGCVPKKIMFN  60

Query  223  SSIIGELLHKDAEQFGWT----VSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYE  278
            +++  E+LH  A  + +     +   +FDW  + +    Y+  LN  Y   + + KV   
Sbjct  61   AALHAEMLHS-ARAYAFKGVQDIQFGAFDWAAMKAKRDAYVKWLNDMYGEGMLEDKVDLV  119

Query  279  NMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAISSDDIFSKA  338
                 F D HT+ +  +           +  +IAVGG P     PG EHAISSD  F+  
Sbjct  120  MGAAKFVDNHTVEVNGDRYAA-------KHILIAVGGVPAMPPLPGIEHAISSDGFFALE  172

Query  339  EAPGKTLVVGASYVALECAGFLKGQGFDVTIMVR-SILLRGFDQDIARRIGEYMENESGI  397
              P K  VVGA Y+A+E AG       D T+  R + +LR FD  +   +   ME+ +G+
Sbjct  173  TQPRKVAVVGAGYIAVELAGIFNALKSDTTVFCRGNQVLRTFDPIVRDLVNTEMEH-AGV  231

Query  398  AFIKESVPTSIEKLPNGQLKVTHTHGEGI------YDTVLNATGRSPDVQMLNLPAAGVT  451
             F++ES  TSIEK  +G L +  T   G+      ++TVL A GR+P    L L    + 
Sbjct  232  RFVRESGITSIEKAEDGTLTIQATVA-GVAQSFAGFETVLFAIGRTPRTHDLGLETTDIA  290

Query  452  LNPKSGRIDVTNEQTSTPHIYAIGDVIDAP-ELTPVAIQAGKLLARRLFGNG-TALMDYT  509
            L+P         E T+ P+++A+GDV     ELTPVAI AG+ LA RLFGN   A ++Y 
Sbjct  291  LSPDQFIQVDAQENTTVPNVHAVGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVNYH  350

Query  510  KICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAKECYAKLI  569
            +I T VF+    G  GL+E  A+A  G  N+  +  +F+ + +++S E+   K   A  +
Sbjct  351  QIPTVVFSHPPIGTIGLTEPQAVAQYGAHNVTTHTSSFSNMFYAMSAEKD--KVQTAMKL  408

Query  570  VDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIFTTL  625
            V    ++ VVG H  G  A E+ Q  GVA+K+ A   DF N V IHPT +E   T+
Sbjct  409  VCIGVEETVVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  464

>PYAP_21882
Length=502

 Score = 253 bits (646),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 176/493 (36%), Positives = 251/493 (51%), Gaps = 37/493 (8%)

Query  151  SDTSSSDETQYDWDLVVIGGGSGGLACSKEASKLGQ-KVLVLDYVKPSPVGSTWGLGGTC  209
            S ++++ +  YD+  +VIG GSGG+A S+ A+     +V V++  +         LGGTC
Sbjct  21   SASANAGDGMYDY--LVIGAGSGGMASSRRAATYANTRVAVVEQAR---------LGGTC  69

Query  210  VNVGCIPKKLMHQSSIIGELLHKDAEQFGWTVSNAS-------FDWTKLVSSVQDYIHGL  262
            VNVGC+PKK+M+ ++ +G  LH+D   +G+  +          F W KL      Y+  L
Sbjct  70   VNVGCVPKKIMYLAANLGHTLHRDLFHYGFESTKGEHLAHETQFHWKKLKERRDAYVLRL  129

Query  263  NFKYRIDLRDKKVKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSC  322
            N  Y  +L + KV        F+   T       +  G  ++  +  +IAVGG+P     
Sbjct  130  NGIYGRNLDNSKVDL------FRGTATFNAKGNVEVDGK-EIAAKNVLIAVGGKPLIPDI  182

Query  323  PGWEHAISSDDIFSKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSI-LLRGFDQ  381
            PG EH I SD  F   E P K  VVGA Y+A+E AG L G G D TI  R   +LRGFD+
Sbjct  183  PGKEHCIDSDGFFELEEQPKKVAVVGAGYIAVELAGVLHGLGSDTTIFCRKEGVLRGFDE  242

Query  382  DIARRIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHTHG--EGIYDTVLNATGRSPD  439
             I   + + M  E G+     S  T + K  +G   +    G     +D+V+ A GR P 
Sbjct  243  LIRTTLHDAMAKE-GVNLRPHSSVTKVIKAADGTKTLVLADGSEHSGFDSVIYAAGRVPL  301

Query  440  VQMLNLPAAGVTLNPKSG-RIDVTNEQTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRL  498
             + LNL AAG+  +     +ID     T+  +I+A+GDV   P LTPVAI AG+ LA RL
Sbjct  302  TESLNLEAAGIETDDHGFIKIDEYQRTTAKTNIFAVGDVCGTPALTPVAIAAGRRLADRL  361

Query  499  FGN-GTALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHE  557
            FG    A   Y  I T VF+    G  GL+E+ A A  G D I+VY   F  + + + +E
Sbjct  362  FGGMKDAKASYENIPTVVFSHPPIGTVGLTEDHARAKFGDDQIKVYTSRFVNMHYGIINE  421

Query  558  -----RPLAKECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTV  612
                 +   K   A  +V   + ++VVG H +G  A E+ Q  GVA+K+ AT  DF + V
Sbjct  422  FGEDGQQKPKPMTAMKLVCQGKDEKVVGVHIIGMAADEMLQGFGVAVKMGATKADFDSCV  481

Query  613  GIHPTTAEIFTTL  625
             IHPT AE   T+
Sbjct  482  AIHPTAAEELVTM  494

>SDRG_11131
Length=494

 Score = 253 bits (645),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 174/476 (37%), Positives = 254/476 (53%), Gaps = 28/476 (6%)

Query  163  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  222
            +D +V+G GSGG++ +  A   G KVLV++  + +      GLGGTCVNVGC+PKK+M  
Sbjct  4    YDYIVLGAGSGGVSTAHRAVAYGAKVLVVERGREN---DGAGLGGTCVNVGCVPKKIMFN  60

Query  223  SSIIGELLHKDAEQFGWT----VSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYE  278
            +++  E+LH  A  + +     +   +FDW  + +    Y+  LN  Y   + + KV   
Sbjct  61   AALHAEMLHS-ARAYAFKGVSDIQYGAFDWAAMKAKRDAYVTWLNSMYGEGMLEDKVDLV  119

Query  279  NMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAISSDDIFSKA  338
                 F D HT+ +  E         T +  +IAVGG P     PG EHAISSD  F+  
Sbjct  120  MGAAKFVDNHTIEVNGE-------RYTAKHILIAVGGVPALPPIPGIEHAISSDGFFALE  172

Query  339  EAPGKTLVVGASYVALECAGFLKGQGFDVTIMVR-SILLRGFDQDIARRIGEYMENESGI  397
              P K  VVGA Y+A+E AG       + T+  R + +LR FD  +   +   ME+ +G+
Sbjct  173  TQPRKVAVVGAGYIAVELAGIFNALKSNTTVFCRGNQVLRTFDPIVRDLVNTEMEH-AGV  231

Query  398  AFIKESVPTSIEKLPNGQLKVTHT-HGE----GIYDTVLNATGRSPDVQMLNLPAAGVTL  452
             F++ES   +IEK  +G L +  T  GE      ++TVL A GR+P    L L    + L
Sbjct  232  QFVRESGINAIEKAGDGTLTLQATVAGEPQSFTGFETVLFAIGRTPRTHDLGLETTDIAL  291

Query  453  N-PKSGRIDVTNEQTSTPHIYAIGDVIDAP-ELTPVAIQAGKLLARRLFGNG-TALMDYT  509
            +  K  ++D   E T+ P++YAIGDV     ELTPVAI AG+ LA RLFGN   A ++Y+
Sbjct  292  STEKFIQVD-AQENTTVPNVYAIGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVNYS  350

Query  510  KICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAKECYAKLI  569
            +I T VF+    G  GL+E  AIA  G  N+  +  +F+ + +++  E+   K   A  +
Sbjct  351  QIPTVVFSHPPIGTIGLTEAQAIAQYGAHNVTTHTSSFSNMFYAMCAEKD--KVQTAMKL  408

Query  570  VDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIFTTL  625
            V    ++ VVG H  G  A E+ Q  GVA+K+ A   DF N V IHPT +E   T+
Sbjct  409  VCIGVEEAVVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  464

>SDRG_15045
Length=494

 Score = 250 bits (638),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 173/476 (36%), Positives = 253/476 (53%), Gaps = 28/476 (6%)

Query  163  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  222
            +D +V+G GSGG++ +  A   G KVLV++  + +      GLGGTCVNVGC+PKK+M  
Sbjct  4    YDYIVLGAGSGGVSTAHRAVAYGAKVLVVERGREN---DGAGLGGTCVNVGCVPKKIMFN  60

Query  223  SSIIGELLHKDAEQFGWT----VSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYE  278
            +++  E+LH  A  + +     +   +FDW  + +    Y+  LN  Y   + + KV   
Sbjct  61   AALHAEMLHS-ARAYAFKGVSDIQYGAFDWAAMKAKRDAYVTWLNSMYGEGMLEDKVDLV  119

Query  279  NMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAISSDDIFSKA  338
                 F D HT+ +  E         T +  +IAVGG P     PG EHAISSD  F+  
Sbjct  120  MGAAKFVDNHTIEVNGE-------RYTAKHILIAVGGVPALPPIPGIEHAISSDGFFALE  172

Query  339  EAPGKTLVVGASYVALECAGFLKGQGFDVTIMVR-SILLRGFDQDIARRIGEYMENESGI  397
              P K  VVGA Y+A+E AG       + T+  R + +LR FD  +   +   ME+ +G+
Sbjct  173  TQPRKVAVVGAGYIAVELAGIFNALKSNTTVFCRGNQVLRTFDPIVRDLVNTEMEH-AGV  231

Query  398  AFIKESVPTSIEKLPNGQLKVTHT-HGEGI----YDTVLNATGRSPDVQMLNLPAAGVTL  452
             F++ES   +IEK  +G L +  T  GE      ++TVL A GR+P    L L    + L
Sbjct  232  QFVRESGINAIEKAGDGTLTLQATVAGEPQSFTGFETVLFAIGRTPRTHDLGLETTDIAL  291

Query  453  N-PKSGRIDVTNEQTSTPHIYAIGDVIDAP-ELTPVAIQAGKLLARRLFGNG-TALMDYT  509
            +  K  ++D   E T+ P++YAIGDV     ELTPVAI AG+ LA RLFGN   A ++Y+
Sbjct  292  STEKFIQVD-AQENTTVPNVYAIGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVNYS  350

Query  510  KICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAKECYAKLI  569
            +I T VF+    G  GL+E  AI   G  N+  +  +F+ + +++  E+   K   A  +
Sbjct  351  QIPTVVFSHPPIGTIGLTEPQAIEQYGAHNVTTHTSSFSNMFYAMCAEKD--KVQTAMKL  408

Query  570  VDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIFTTL  625
            V    ++ VVG H  G  A E+ Q  GVA+K+ A   DF N V IHPT +E   T+
Sbjct  409  VCIGVEEAVVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  464

>SDRG_03823
Length=497

 Score = 248 bits (633),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 176/480 (37%), Positives = 253/480 (53%), Gaps = 28/480 (6%)

Query  159  TQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKK  218
            T   +D +VIGGGSGG + ++ A+  G KVLV++           G+GGTCVNVGC+PKK
Sbjct  3    TTTTYDYIVIGGGSGGNSSARRAAAYGAKVLVIER---GHANDGAGMGGTCVNVGCVPKK  59

Query  219  LMHQSSIIGELLHKDAEQFGWT----VSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKK  274
            +M  +++  E+LH  A  + +     V   SFDW  L      Y+  LN  Y  +L + K
Sbjct  60   VMFNAAMHAEMLHS-AHAYTFKNIQDVEYGSFDWAALKKKRDAYVARLNGIYERNLGNNK  118

Query  275  VKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAISSDDI  334
            +        F D HT+ +  +         T +  +IAVGG P     PG EHAISSD  
Sbjct  119  IPLIYGAAKFVDNHTIEVNGD-------RYTAKHILIAVGGVPAMPPLPGIEHAISSDGF  171

Query  335  FSKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVR-SILLRGFDQDIARRIGEYMEN  393
            F+    P K  VVGA Y+A+E AG       D T+  R + +LR FD  +   +   ME+
Sbjct  172  FALETQPRKVAVVGAGYIAVELAGIFNALKSDTTVFCRGNQVLRTFDPIVRDLVNTEMEH  231

Query  394  ESGIAFIKESVPTSIEKLPNGQLKVTHTHGEGI------YDTVLNATGRSPDVQMLNLPA  447
             +G+ F++ES  TSIEK  +G L +  T   G+      ++TVL A GR+P    L L  
Sbjct  232  -AGVRFVRESGITSIEKAEDGTLTIQATVA-GVAQSFAGFETVLFAIGRTPRTHDLGLET  289

Query  448  AGVTLNPKSGRIDVTNEQTSTPHIYAIGDVIDAP-ELTPVAIQAGKLLARRLFGNG-TAL  505
              + L+P         E T+ P+++A+GDV     ELTPVAI AG+ LA RLFGN   A 
Sbjct  290  TDIALSPDQFIQVDAQENTTVPNVHAVGDVTTTGWELTPVAIAAGRRLADRLFGNEPNAC  349

Query  506  MDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAKECY  565
            ++Y +I T VF+    G  GL+E  AI   G  N++VY   F  + +++S +    K+  
Sbjct  350  VNYHQIPTVVFSHPPIGTIGLTEPQAIEQYGAHNVKVYTSTFFNMFYAMSEQDE--KQKT  407

Query  566  AKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIFTTL  625
            A  ++   +++ V+G H  G  A E+ Q  GVA+K+ A   DF N V IHPT +E   T+
Sbjct  408  AMKLMCIGEEETVIGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  467

>PHALS_08068
Length=497

 Score = 248 bits (632),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 169/492 (34%), Positives = 252/492 (51%), Gaps = 38/492 (8%)

Query  154  SSSDETQYDWDLVVIGGGSGGLACSKEASKL-GQKVLVLDYVKPSPVGSTWGLGGTCVNV  212
            S S   Q ++D +VIG GSGG+A ++ A+   G +V +++  +         LGGTCVNV
Sbjct  15   SVSRHLQTEYDYLVIGAGSGGMASARRAASYSGTRVAIVEQDR---------LGGTCVNV  65

Query  213  GCIPKKLMHQSSIIGELLHKDAEQFGWTVS--------NASFDWTKLVSSVQDYIHGLNF  264
            GC+PKKLM+ ++ +   LH D   +G+  +           F+W+KL +    Y+  LN 
Sbjct  66   GCVPKKLMYIAADMNHKLHHDFLYYGFEDAATGGHLSHRMHFNWSKLKARRDAYVLRLNE  125

Query  265  KYRIDLRDKKVKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPG  324
             Y  +L + KV        F +   + + ++       +V  ++ +IAVGGRP     PG
Sbjct  126  IYETNLANSKVDLIRGSAKFNERGNVEVDDK-------EVRAKKILIAVGGRPLIPDIPG  178

Query  325  WEHAISSDDIFSKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSI-LLRGFDQDI  383
             E  I SD  F     P K  +VGA Y+A+E AG L   G   ++  R   +LR FD  +
Sbjct  179  KELCIDSDGFFELETLPTKVAIVGAGYIAVELAGVLNALGSKTSVFCRKEGVLRSFDNIL  238

Query  384  ARRIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHTHGEGI--YDTVLNATGRSPDVQ  441
               + E M N+ G+     S    +++  +G   +  T+G     +D V+ ATGR P   
Sbjct  239  RTTLEEAMAND-GVHLRPNSTVARVKEAADGTKTLVLTNGSEHRGFDVVICATGRVPLTS  297

Query  442  MLNLPAAGVTLNPKSGRIDVTN-EQTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLFG  500
             LNL  AG+T +  +G I V   ++T+  ++YA+GDV + P LTPVAI AG+ L+ RLFG
Sbjct  298  TLNLEKAGITTD-DNGYIRVNEFQETTKNNVYAVGDVCNTPALTPVAIAAGRRLSDRLFG  356

Query  501  N-GTALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHER-  558
                A + Y  I T +F+    G  GL+EE A    G +NI+VY   F  + + L +E  
Sbjct  357  GMKDAKLSYENIPTVIFSHPPIGTIGLTEEGARKKYGDNNIKVYSSRFVNMYYGLINETI  416

Query  559  -----PLAKECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVG  613
                 P  K   A  +V    +++VVG H +G  A E+ Q  GVA+K+ AT  DF N + 
Sbjct  417  EATGVPKEKPKTAMKLVCAGNKEKVVGLHMIGMAADEILQGFGVAVKMGATKADFDNCIA  476

Query  614  IHPTTAEIFTTL  625
            IHPT  E   TL
Sbjct  477  IHPTAGEELVTL  488

>SPRG_11769
Length=453

 Score = 246 bits (629),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 178/477 (37%), Positives = 252/477 (53%), Gaps = 41/477 (9%)

Query  160  QYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKL  219
            Q  +DLVV+GGGSGG+A ++ A+  G+KVLV++  +         LGGTCVNVGC+PKK+
Sbjct  2    QRMYDLVVMGGGSGGIASARRAATYGKKVLVVERGR---------LGGTCVNVGCVPKKV  52

Query  220  MHQSSIIGELLHKDAEQFGW-TVSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYE  278
            M+ ++ +   +  DA  +G+  V N + DW  L      Y+  LN  Y  +L+   V + 
Sbjct  53   MYAAADLAHSMRHDAPAYGFPAVPNTTVDWATLKQRRDAYVTRLNGIYARNLQGSGVDF-  111

Query  279  NMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAISSDDIFSKA  338
                    AH L       ++G         ++AVGG+P     PG EH ISSD  F   
Sbjct  112  --------AHGLCSFGSDGRRG------DERLVAVGGQPVMPDIPGIEHCISSDGFFELD  157

Query  339  EAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSI-LLRGFDQDIARRIGEYMENESGI  397
            E P +  VVGA Y+A+E AG L+G G D TI  R   +LR FD D+ + +        GI
Sbjct  158  ERPARVAVVGAGYIAVELAGVLRGLGSDTTIFCRQQGVLRSFD-DMLQSVLHDAFKRDGI  216

Query  398  AFIKESVPTSIEKL--PNGQLKVTHTHGE--GIYDTVLNATGRSPDVQMLNLPAAGVTLN  453
                 S    ++K+    G L +T T G+    +D VL ATGR+P  + L L   G+ L+
Sbjct  217  TLQPHSTVARVDKVDPATGTLSLTTTAGDYHTGFDCVLVATGRTPMTKHLGLEHRGIELS  276

Query  454  PKSGRIDVTNEQ-TSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLFGN-GTALMDYTKI  511
            P +G I V   Q TS P ++A+GDV++   LTPVAI AG+ LA RLFG    A  DYT I
Sbjct  277  P-NGFIPVDAYQATSAPGVFALGDVVNTAALTPVAIAAGRRLADRLFGGLPDAKADYTSI  335

Query  512  CTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSL---SHERPLAKECYAKL  568
             + VF+    G  GL+E++A      D I+VY   F  + +SL   +HE+P      A  
Sbjct  336  PSVVFSHPPIGTIGLTEQEARKVYREDEIKVYSSKFVNMHYSLYEHAHEKPTT----AMK  391

Query  569  IVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIFTTL  625
            ++     +++VG H +G  A E+ Q  GVA+K+ A   D    + IHPT AE   TL
Sbjct  392  LICVGPTEKIVGLHVIGRGADEMLQGFGVAIKMGACKKDLDACIAIHPTAAEELVTL  448

>PYIR_17506
Length=509

 Score = 247 bits (630),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 174/483 (36%), Positives = 245/483 (51%), Gaps = 40/483 (8%)

Query  163  WDLVVIGGGSGGLACSKEASKL-GQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMH  221
            +D +VIG GSGG+A S+ A+     +V V++  +         LGGTCVNVGC+PKK+M+
Sbjct  39   YDYLVIGAGSGGMASSRRAASYPNTRVAVVEQAR---------LGGTCVNVGCVPKKIMY  89

Query  222  QSSIIGELLHKDAEQFGWTVS-------NASFDWTKLVSSVQDYIHGLNFKYRIDLRDKK  274
             ++ +   LH+DA  +G+          N  F W+KL      YI  LN  Y  +L + K
Sbjct  90   LAANMNHTLHRDAFYYGFESKDGSHIGDNVEFHWSKLKERRDAYILRLNGIYERNLGNSK  149

Query  275  VKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAISSDDI  334
            V        F     + +  +        ++ R  +IAVGG+P     PG EH I SD  
Sbjct  150  VDLIQGTAAFNAQGEVEVDGKV-------ISARNVLIAVGGKPLIPDIPGKEHCIDSDGF  202

Query  335  FSKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSI-LLRGFDQDIARRIGEYMEN  393
            F   E P K  VVGA Y+A+E AG L G G D TI  R   +LR FD+ +   + + M  
Sbjct  203  FELEELPNKVAVVGAGYIAVELAGVLHGLGSDTTIFCRKDGVLRTFDELVRDTLHDAMAK  262

Query  394  ESGIAFIKESVPTSIEKLPNGQLKVTHTHGE--GIYDTVLNATGRSPDVQMLNLPAAGVT  451
            + GI    +S    IEK  +G+  +    G     +DTV+ A GR P    LN+ AAG+ 
Sbjct  263  D-GIVVRPQSNVARIEKTLDGKKTLVLADGSEHAGFDTVIYAAGRIPLTSNLNISAAGIE  321

Query  452  LNPKSGRIDVTNEQTSTP-HIYAIGDVIDAPELTPVAIQAGKLLARRLFGN-GTALMDYT  509
             + K G I V   QT++  +++A+GDV     LTPVAI AG+ L+ RLFG    A + Y 
Sbjct  322  TD-KHGFIKVDEYQTTSKNNVFAVGDVCGTTALTPVAIAAGRRLSDRLFGGMEDAKISYN  380

Query  510  KICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHE-------RPLAK  562
             I T VF+    G  GL+E++A    G   I+ Y   F  + + L +E       +P  K
Sbjct  381  NIPTVVFSHPPIGTIGLTEKEAREKYGDAQIKTYTSRFVNMYYGLVNELDAEGNTKP--K  438

Query  563  ECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIF  622
               A  +V   + ++VVG H +G  A E+ Q  GVA+K+ AT  DF N V IHPT  E  
Sbjct  439  PMTAMKLVCLGKDEKVVGLHIIGMAADEILQGFGVAVKMGATKADFDNCVAIHPTAGEEL  498

Query  623  TTL  625
             TL
Sbjct  499  VTL  501

>SPRG_05609
Length=496

 Score = 246 bits (627),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 177/477 (37%), Positives = 256/477 (54%), Gaps = 30/477 (6%)

Query  163  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  222
            +D +VIGGGSGG + ++ A+  G KVL+++           G+GGTCVNVGC+PKK+M  
Sbjct  6    YDYIVIGGGSGGNSSARRAAAYGAKVLLIER---GHANDGAGMGGTCVNVGCVPKKIMFN  62

Query  223  SSIIGELLHKDAEQFGWT----VSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYE  278
            +++  E+LH  A  + +     V   SFDW  L      Y+  LN  Y  +L + ++   
Sbjct  63   AALHAEMLHS-AHAYTFKNIQDVEYGSFDWAALKKKRDAYVARLNGIYERNLGNNQIPLV  121

Query  279  NMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAISSDDIFSKA  338
                 F D HT+ +  +         T +  +IAVGG P     PG EHAISSD  F+  
Sbjct  122  YGAAKFVDNHTVEVNGD-------RYTAKHILIAVGGVPAMPPLPGIEHAISSDGFFALE  174

Query  339  EAPGKTLVVGASYVALECAGFLKGQGFDVTIMVR-SILLRGFDQDIARRIGEYMENESGI  397
              P K  VVGA Y+A+E AG       D T+  R + +LR FD  +   +   ME+ +G+
Sbjct  175  TQPRKVAVVGAGYIAVELAGIFNALKSDTTLFCRGNQVLRTFDPIVRDLVNTEMEH-AGV  233

Query  398  AFIKESVPTSIEKLPNGQLKVTHTHGEGI------YDTVLNATGRSPDVQMLNLPAAGVT  451
             F++ES  TSIEK  +G        G G+      ++TVL A GR+P    L L    + 
Sbjct  234  HFVRESGITSIEKAVDGYAD-DSGDGGGVPQSFPGFETVLFAIGRTPRTHDLGLETTDIA  292

Query  452  LNP-KSGRIDVTNEQTSTPHIYAIGDVIDAP-ELTPVAIQAGKLLARRLFGNG-TALMDY  508
            L+  K  ++D   E TS P++YA+GDV     ELTPVAI AG+ LA RLFGN   A ++Y
Sbjct  293  LSADKFIQVD-AQENTSVPNVYAVGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACINY  351

Query  509  TKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAKECYAKL  568
             +I T VF+    G  GL+E  AIA  G +N++VY  +F  + +++S +    K+  A  
Sbjct  352  HQIPTVVFSHPPIGTIGLTEPQAIAQYGANNVKVYTSSFFNMFYAMSEQDD--KQKTAMK  409

Query  569  IVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIFTTL  625
            ++   +++ VVG H  G  A E+ Q  GVA+K+ A   DF N V IHPT +E   T+
Sbjct  410  LICIGEEETVVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  466

>PHYSO_254571
Length=489

 Score = 244 bits (622),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 177/489 (36%), Positives = 240/489 (49%), Gaps = 40/489 (8%)

Query  157  DETQYDWDLVVIGGGSGGLACSKEASKL-GQKVLVLDYVKPSPVGSTWGLGGTCVNVGCI  215
            D T+YD+  +VIG GSGG+A ++ A+   G +V V++  +         LGGTCVNVGC+
Sbjct  12   DTTEYDY--LVIGAGSGGMASARRAASYPGTRVAVVEQSR---------LGGTCVNVGCV  60

Query  216  PKKLMHQSSIIGELLHKDAEQFGWTVSNAS--------FDWTKLVSSVQDYIHGLNFKYR  267
            PKKLM  ++ +   LH D   +G+              FDW KL +    Y+  LN  Y 
Sbjct  61   PKKLMFIAADMSHKLHHDFLHYGFEDEETGGHLGQRTHFDWPKLKARRDAYVLRLNGIYE  120

Query  268  IDLRDKKVKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEH  327
             +L + KV        F D   + +  +       ++  +  +IAVGG+P     PG E 
Sbjct  121  RNLANSKVALIRGSAKFNDKGNVEVDGK-------EILAKNVMIAVGGKPLIPDIPGKEL  173

Query  328  AISSDDIFSKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSI-LLRGFDQDIARR  386
             I SD  F     P K  VVGA Y+A+E AG L   G D +I  R   +LR FD DI R 
Sbjct  174  CIDSDGFFELETLPKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRSFD-DIVRT  232

Query  387  IGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHTHGEGI--YDTVLNATGRSPDVQMLN  444
              E    + G+     S    +EK  +G   +    G     YD V+ A GR P    L 
Sbjct  233  TLEDAMAKDGVHLRPHSNIARVEKADDGTKTLVLADGSEYSGYDVVIYAAGRVPLTSNLQ  292

Query  445  LPAAGVTLNPKSGRIDVTN-EQTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLFGN-G  502
            L  AGV  + K+G I V   ++TS   + A+GDV   P LTPVAI AG+ L+ RLFG   
Sbjct  293  LDKAGVDTD-KNGFIQVNEFQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLFGGMK  351

Query  503  TALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHE-----  557
             A + Y  I T VF+    G  GL+EE A    G D I+VY   F  + + L +E     
Sbjct  352  DAKVSYENIPTVVFSHPPIGTIGLTEEQARRKYGDDEIKVYTSRFVNMYYGLINEMDEAT  411

Query  558  -RPLAKECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHP  616
              P  K   A  +V   ++++VVG H +G  A E+ Q  GVA+K+ AT  DF N V IHP
Sbjct  412  GEPKDKPKTAMKLVCAGKEEKVVGLHMIGMAADEILQGFGVAVKMGATKADFDNCVAIHP  471

Query  617  TTAEIFTTL  625
            T  E   TL
Sbjct  472  TAGEELVTL  480

>H310_14447
Length=501

 Score = 244 bits (622),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 165/460 (36%), Positives = 238/460 (52%), Gaps = 25/460 (5%)

Query  178  SKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGELLHKDAEQF  237
            +  A + G KVLV++  +   V    G+GGTCVNVGC+PKK+M+ + +  E+LH  A+ +
Sbjct  24   ASRAVEYGAKVLVIERGR---VNGGAGMGGTCVNVGCVPKKIMYNAGVHAEILHS-AKDY  79

Query  238  GW----TVSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYENMLGTFKDAHTLTLT  293
             +     V   SFDW  + +    Y++ L+  Y   L ++ + +      F D HT+ + 
Sbjct  80   SFKDVVNVKFGSFDWAAMKAKRDAYVNWLSAAYEEGLGEENIDHVIGAAVFVDDHTVEV-  138

Query  294  NEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAISSDDIFSKAEAPGKTLVVGASYVA  353
            N  +   P        +IAVGG P+  + PG EHA+SSD  F     P K  VVGA Y+A
Sbjct  139  NGQRYTAP------HILIAVGGMPQMPNIPGIEHAVSSDGFFDLPTQPKKVAVVGAGYIA  192

Query  354  LECAGFLKGQGFDVTIMVR-SILLRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKLP  412
            +E AG       D  +  R + +LR FD  +   + + M  ++G+AF+  +   SI K  
Sbjct  193  VELAGIFNALKSDTVVFCRGNQVLRKFDPLVRDLVNDEMA-KAGVAFVTHAHLESIRKEA  251

Query  413  NGQLKVTHTHGEGI-----YDTVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDVTNEQTS  467
            +G L V    GE       +D +++A GR P  Q + L    V L+     +    E T+
Sbjct  252  DGSLTVVAKVGEATNEFAGFDAIVSAIGRIPRTQDVGLDKTHVELSDDGFVVVDAQENTT  311

Query  468  TPHIYAIGDVIDAP-ELTPVAIQAGKLLARRLFGNGT-ALMDYTKICTAVFTPVEYGCCG  525
               +YAIGDV     ELTPVAI AG+ LA RLFG  T A + Y +I T VF+    G  G
Sbjct  312  VDGVYAIGDVTTTGWELTPVAIAAGRRLADRLFGKETNACIHYHQIPTVVFSHPPIGTIG  371

Query  526  LSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAKECYAKLIVDTTQQKRVVGFHYLG  585
            L+E DAIA  GRDN+ VY   F+ + ++L+       +   KL+    ++  V+G H  G
Sbjct  372  LTEPDAIAKYGRDNVTVYTSTFSNMFYALATHSAHKPQTAMKLVCIGVEET-VIGAHVAG  430

Query  586  PNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIFTTL  625
              A E+ Q  GVA+KL A   DF N V IHPT AE   T+
Sbjct  431  LGADEMIQGFGVAIKLGAYKSDFDNVVAIHPTAAEEMVTM  470

>PPTG_09787
Length=493

 Score = 243 bits (619),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 176/483 (36%), Positives = 255/483 (53%), Gaps = 33/483 (7%)

Query  159  TQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKK  218
            T   +D +VIGGGSGG+A ++ A+  G KVLV++  +        GLGGTCVN GC+PKK
Sbjct  3    TDVVYDYMVIGGGSGGMASARRAATFGAKVLVVERGREF---DGMGLGGTCVNFGCVPKK  59

Query  219  LMHQSSIIGELLHKDAEQFGWTVSNAS-------FDWTKLVSSVQDYIHGLNFKYRIDLR  271
            +M  ++   E L+++ +   ++++ AS       FDW  + +    YI  LN  Y  +L 
Sbjct  60   VMFNTAAHVEHLNRNKD---YSINTASKDFEFGDFDWGNMKTKRDAYIKRLNGIYERNLG  116

Query  272  DKKVKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAISS  331
            + KV +   +        + +  +         T +  ++A GG P     PG EH I S
Sbjct  117  NAKVDHVQGIAKLVAKDKIEVAGQV-------YTGKHVLVAPGGVPTIPDLPGMEHVIDS  169

Query  332  DDIFSKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVR-SILLRGFDQDIARRIGEY  390
            D  F   + P K  VVGA Y+A+E AG       D T+  R   +LR FD  +   + E 
Sbjct  170  DGFFKLEQQPKKVAVVGAGYIAVELAGIFNVLKSDTTLFCRYDQVLRKFDPIVRDLVNEE  229

Query  391  MENESGIAFIKESVPTSIEKLPNGQLK-VTHTHGE----GIYDTVLNATGRSPDVQMLNL  445
            ME ++G+ F++ S    +EK  NG+L  V   +GE      +DT++ A GR P  + L L
Sbjct  230  ME-KAGVKFVRNSRAVRVEKQENGKLTFVVTVNGEEQKFADFDTIVFAIGREPRTKDLGL  288

Query  446  PAAGVTLNPKSGRIDV-TNEQTSTPHIYAIGDV-IDAPELTPVAIQAGKLLARRLFG-NG  502
               GV L+ + G I+V   E TS P +YAIGD  +   ELTPVAI AG+ L+ RLFG   
Sbjct  289  EEIGVKLS-EGGFIEVDAQENTSVPGVYAIGDATVTGWELTPVAIAAGRRLSDRLFGGEK  347

Query  503  TALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAK  562
             A ++Y +I T +F+    G  G +E +AIA  G +NI+VY   F  L  S++   P  K
Sbjct  348  DACLNYHQIPTVIFSHPPIGTIGYTEPEAIAKYGEENIKVYTSKFVNLLHSMAD--PERK  405

Query  563  ECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIF  622
               A  +V   +++ VVG H  G  A E+ Q  GVA+K++AT  DF N V IHPT AE  
Sbjct  406  GKTAMKLVTVGEKETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEEL  465

Query  623  TTL  625
             T+
Sbjct  466  VTM  468

>PHYKE_10327
Length=1200

 Score = 252 bits (644),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 178/498 (36%), Positives = 251/498 (50%), Gaps = 50/498 (10%)

Query  154  SSSDETQYDWDLVVIGGGSGGLACSKEASKL-GQKVLVLDYVKPSPVGSTWGLGGTCVNV  212
            S+S   Q ++D +VIG GSGG+A ++ A+   G +V V++  +         LGGTCVNV
Sbjct  18   SASRALQTEYDYLVIGAGSGGMASARRAASYPGTRVAVVEQAR---------LGGTCVNV  68

Query  213  GCIPKKLMHQSSIIGELLHKDAEQFGW--------TVSNASFDWTKLVSSVQDYIHGLNF  264
            GC+PKKLM  ++ +G  LH D   +G+           +A FDW KL +    Y+  LN 
Sbjct  69   GCVPKKLMFIAADLGHKLHHDLLHYGFEDAASGGHVSQHARFDWAKLKTRRDAYVLRLNG  128

Query  265  KYRIDLRDKKVKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPG  324
             Y  +L + KV+       F D   + +  +       +V  +  +IAVGG+P     PG
Sbjct  129  IYERNLANSKVELIRGSAAFNDNGNVVVDGK-------EVRAKNVLIAVGGKPMIPDIPG  181

Query  325  WEHAISSDDIFSKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSI-LLRGFD---  380
             E  I SD  F     P K  VVGA Y+A+E AG L   G D +I  R   +LR FD   
Sbjct  182  KELCIDSDGFFELEMLPKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRTFDGIV  241

Query  381  ----QDIARRIGEYMENESGIAFIKESVP-TSIEKLPNGQLKVTHTHGEGIYDTVLNATG  435
                +D  ++ G +++  S IA + ++   T    L +G     H+     YD V+ A G
Sbjct  242  RTTLEDAMKKDGVHLQRHSNIARVNQAADGTKTLVLADGS---EHSG----YDVVIYAAG  294

Query  436  RSPDVQMLNLPAAGVTLNPKSGRIDVTN-EQTSTPHIYAIGDVIDAPELTPVAIQAGKLL  494
            R P    L L  AG+  + K+G I V   ++TS   + A+GDV   P LTPVAI AG+ L
Sbjct  295  RVPLTSTLKLDKAGIATD-KNGFIQVNKFQETSNSKVLAVGDVCGTPALTPVAIAAGRRL  353

Query  495  ARRLFGN-GTALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWS  553
            + RLFG  G A + Y  I T VF+    G  GL+EE A    G D+I+VY   F  + + 
Sbjct  354  SDRLFGGMGGAKVSYENIPTVVFSHPPIGTIGLTEEQARQKYGDDSIKVYTSRFVNMYYG  413

Query  554  LSHE------RPLAKECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDD  607
            L +E       P  K   A  +V   + ++VVG H +G  A E+ Q  GVA+K+ AT  D
Sbjct  414  LINEMDETTGEPKDKPKTAMKLVCAGKDEKVVGLHMIGMAADEILQGFGVAVKMGATKAD  473

Query  608  FVNTVGIHPTTAEIFTTL  625
            F N + IHPT  E   TL
Sbjct  474  FDNCMAIHPTAGEELVTL  491

>PPTG_18033
Length=500

 Score = 238 bits (607),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 172/492 (35%), Positives = 242/492 (49%), Gaps = 38/492 (8%)

Query  154  SSSDETQYDWDLVVIGGGSGGLACSKEASKL-GQKVLVLDYVKPSPVGSTWGLGGTCVNV  212
            S+S   Q ++D +VIG GSGG+A ++ A+   G +V V++  +         LGGTCVNV
Sbjct  18   SASRAPQTEYDYLVIGAGSGGMASARRAASYPGTRVAVVEQAR---------LGGTCVNV  68

Query  213  GCIPKKLMHQSSIIGELLHKDAEQFGW--------TVSNASFDWTKLVSSVQDYIHGLNF  264
            GC+PKKLM  ++ +   L  D   +G+              FDW KL +    Y+  LN 
Sbjct  69   GCVPKKLMFIAADMSHKLDHDFLHYGFEDEATGEHLGKRTHFDWMKLKARRDAYVLRLNG  128

Query  265  KYRIDLRDKKVKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPG  324
             Y  +L + KV+       F +   + +  +       ++  +  +IAVGG+P     PG
Sbjct  129  IYERNLANSKVELIRGSAKFNENGNVEVDGK-------ELLAKNVLIAVGGKPLIPDIPG  181

Query  325  WEHAISSDDIFSKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSI-LLRGFDQDI  383
             E  I SD  F     P K  VVGA Y+A+E AG L   G D +I  R   +LR FD DI
Sbjct  182  KELCIDSDGFFELEILPKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRSFD-DI  240

Query  384  ARRIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHTHGEGI--YDTVLNATGRSPDVQ  441
             R   E    + G+     S    +E+  +G   V  T G     YD V+ A GR P   
Sbjct  241  VRTTLEDAMVKDGVHLRPHSNVARVEQAADGTKTVVLTDGSEYNGYDVVMYAAGRVPLTS  300

Query  442  MLNLPAAGVTLNPKSGRIDVTN-EQTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLFG  500
             L L  AGVT + + G I V   ++TS   + A+GDV   P LTPVAI AG+ L+ RLFG
Sbjct  301  NLQLDKAGVTTD-EHGFIPVNEFQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLFG  359

Query  501  N-GTALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHE--  557
                + + Y  I T VF+    G  GL+E+ A    G D ++VY   F  + + L +E  
Sbjct  360  GLNNSKVSYENIPTVVFSHPPIGTIGLTEDQARRKYGDDAVKVYTSRFVNMYYGLINEVD  419

Query  558  ----RPLAKECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVG  613
                 P  K   A  +V   ++++VVG H +G  A E+ Q  GVA+K+ AT  DF N + 
Sbjct  420  ESTGEPKDKPKTAMKLVCVGKEEKVVGLHMIGMAADEILQGFGVAVKMGATKADFDNCIA  479

Query  614  IHPTTAEIFTTL  625
            IHPT  E   TL
Sbjct  480  IHPTAGEELVTL  491

>PITG_14083
Length=493

 Score = 237 bits (605),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 173/479 (36%), Positives = 251/479 (52%), Gaps = 33/479 (7%)

Query  163  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  222
            +D +VIGGGSGG+A ++ A+  G KVLV++  +        GLGGTCVN GC+PKK+M  
Sbjct  7    YDYMVIGGGSGGMASARRAATYGAKVLVVERGREF---DGMGLGGTCVNFGCVPKKVMFN  63

Query  223  SSIIGELLHKDAEQFGWTVSNAS-------FDWTKLVSSVQDYIHGLNFKYRIDLRDKKV  275
            ++   E L+++ +   ++++ AS       FDW  + +    YI  LN  Y  +L + KV
Sbjct  64   AAAHVEHLNRNKD---YSINTASKDFEFGDFDWANMKTKRDAYIKRLNGIYERNLGNAKV  120

Query  276  KYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAISSDDIF  335
             +   +        + +  +         T +  ++A GG P     PG EH I SD  F
Sbjct  121  DHVQGIAKLVAKDKIEVAGQV-------YTGKHVLVAPGGTPTVPDLPGMEHVIDSDGFF  173

Query  336  SKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVR-SILLRGFDQDIARRIGEYMENE  394
               + P K  VVGA Y+A+E AG       D T+  R   +LR FD  +   + E ME +
Sbjct  174  KLEQQPKKVAVVGAGYIAVELAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNEEME-K  232

Query  395  SGIAFIKESVPTSIEKLPNGQLK-VTHTHGE----GIYDTVLNATGRSPDVQMLNLPAAG  449
            +G+ F++ S    +EK  NG+L  V    GE      +D+++ A GRSP  + L L   G
Sbjct  233  AGVNFVRNSRAVRVEKQDNGKLTYVVTVDGEEQKFTDFDSIVYAIGRSPRTKDLGLEEVG  292

Query  450  VTLNPKSGRIDV-TNEQTSTPHIYAIGDV-IDAPELTPVAIQAGKLLARRLF-GNGTALM  506
            V L  + G I+V   E TS   +YAIGD  +   ELTPVAI AG+ L+ RLF G   A +
Sbjct  293  VKL-AEGGFIEVDAQENTSVAGVYAIGDATVTGWELTPVAIAAGRRLSDRLFGGEKDACL  351

Query  507  DYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAKECYA  566
            +Y +I T +F+    G  G +E +AIA  G +N++VY   F  L  S++   P  K   A
Sbjct  352  NYHQIPTVIFSHPPIGTIGYTEPEAIAKYGEENVKVYSSKFVNLIHSMAD--PERKGKTA  409

Query  567  KLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIFTTL  625
              +V    ++ VVG H  G  A E+ Q  GVA+K++AT  DF N V IHPT AE   T+
Sbjct  410  MKLVTVGDKETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVTM  468

>HYAP_08763
Length=473

 Score = 236 bits (601),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 163/462 (35%), Positives = 239/462 (52%), Gaps = 25/462 (5%)

Query  175  LACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGELLH--K  232
            +A ++ A+  G KVLV++  +        GLGGTCVN GC+PKK+M  ++   E L+  K
Sbjct  1    MASARRAATYGAKVLVIERGRQY---DGMGLGGTCVNFGCVPKKIMFNTAAHVEHLNRAK  57

Query  233  DAEQFGWTVSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYENMLGTFKDAHTLTL  292
            D        +   FDW+K+ +    YI+ L   Y+ +L + +V +   +  F   + + +
Sbjct  58   DYSIHTAEFAFGDFDWSKMKTKRDAYINRLTGIYQRNLGNARVDHVEGIAKFVAKNKVQV  117

Query  293  TNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAISSDDIFSKAEAPGKTLVVGASYV  352
             +          T +  +IA GG P     PG  H I SDD F   + P K  VVGA Y+
Sbjct  118  ADRV-------FTGKHVLIAPGGVPLKPDLPGINHVIDSDDFFRLEQQPQKVAVVGAGYI  170

Query  353  ALECAGFLKGQGFDVTIMVR-SILLRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKL  411
            A+E AG       D T+  R   +LR F+  +   + E ME ++G+ F++      +EK 
Sbjct  171  AVEMAGIFHALKSDTTLFCRHDQVLRRFEPIVRDLVNEEME-KAGVTFVRNMSAVGVEKQ  229

Query  412  PNGQLK-VTHTHGEGI----YDTVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDV-TNEQ  465
             +G+L  V + H E      +DT+L A GR P  + L L   GV L  + G I V   E 
Sbjct  230  LDGKLTLVVNVHNEEQKFTDFDTILFAVGRKPRTEDLGLEDIGVKL-AEGGFIQVDAQEN  288

Query  466  TSTPHIYAIGDV-IDAPELTPVAIQAGKLLARRLF-GNGTALMDYTKICTAVFTPVEYGC  523
            TS P +YAIGD  +   ELTPVAI AG+ LA RLF G   A ++Y +I + +F+    G 
Sbjct  289  TSVPGVYAIGDATVTGWELTPVAIAAGRRLADRLFGGEKDACLNYHQIPSVIFSHPPIGT  348

Query  524  CGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAKECYAKLIVDTTQQKRVVGFHY  583
             G +E +A+A  G +N++VY   F  L  S++   P  K   A  +V   +Q+ VVG H 
Sbjct  349  IGYTEPEAVAKYGEENVKVYTSKFVNLLHSMAD--PEHKGKTAMKLVTVGEQETVVGVHV  406

Query  584  LGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIFTTL  625
             G  A E+ Q  GVA+K++AT  DF N V IHPT +E   T+
Sbjct  407  AGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTASEELVTM  448

>PYIW_25301
Length=512

 Score = 236 bits (601),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 168/483 (35%), Positives = 244/483 (51%), Gaps = 40/483 (8%)

Query  163  WDLVVIGGGSGGLACSKEASKL-GQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMH  221
            +D +VIG GSGG+A S+ A+     +V V++  +         LGGTCVNVGC+PKK+M+
Sbjct  40   YDYLVIGAGSGGMASSRRAALYPNTRVAVVEQAR---------LGGTCVNVGCVPKKIMY  90

Query  222  QSSIIGELLHKDAEQFGW-------TVSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKK  274
             ++ +  +LH+DA  +G+          N +F W KL      YI  LN  Y  +L + K
Sbjct  91   LAANMNHMLHRDAFHYGFEGKDGVRIGDNVAFHWDKLKERRDAYILRLNDIYERNLGNSK  150

Query  275  VKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAISSDDI  334
            V        F     + +  +       ++  +  +IAVGG+P     PG E  I SD  
Sbjct  151  VDLLTGTAVFNAHGNVEMDGK-------EIQAKNILIAVGGKPLIPDIPGKELCIDSDGF  203

Query  335  FSKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSI-LLRGFDQDIARRIGEYMEN  393
            F   + P K  VVGA Y+A+E AG L G G + TI  R   +LR FD+ +   + + M  
Sbjct  204  FELEQLPKKVAVVGAGYIAVELAGVLHGLGSNTTIFCRKDGVLRTFDELVRDTLHDAMAK  263

Query  394  ESGIAFIKESVPTSIEKLPNGQLKVTHTHG--EGIYDTVLNATGRSPDVQMLNLPAAGVT  451
            + GI    +S    +E+  +G+  +   +G     +DTV+ A GR P    LNL AAG+ 
Sbjct  264  D-GIVVRPQSNVARVEQTADGKKTLFLQNGSEHAGFDTVIYAAGRVPLTSELNLSAAGIA  322

Query  452  LNPKSGRIDVTNEQ-TSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLFGN-GTALMDYT  509
             + K G I V   Q TS  +++A+GDV     LTPVAI AG+ L+ RLFG    A + Y 
Sbjct  323  TD-KHGFIKVDEYQTTSKSNVFAVGDVCGTTALTPVAIAAGRRLSDRLFGGMADAKISYD  381

Query  510  KICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHE-------RPLAK  562
             I T VF+    G  GL+E +A    G   I+ Y   F  + + L ++       +P  K
Sbjct  382  NIPTVVFSHPPIGTIGLTEHEAREKHGDAQIKTYTSRFVNMYYGLVNDVDADGAAKP--K  439

Query  563  ECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIF  622
               A  +V   + ++VVG H +G  A E+ Q  GVA+K+ AT  DF N V IHPT  E  
Sbjct  440  PMTAMKLVCLGKDEKVVGLHVIGMAADEMLQGFGVAVKMGATKADFDNCVAIHPTAGEEL  499

Query  623  TTL  625
             T+
Sbjct  500  VTM  502

>PHYSO_550665
Length=491

 Score = 235 bits (599),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 175/483 (36%), Positives = 254/483 (53%), Gaps = 33/483 (7%)

Query  159  TQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKK  218
            T   +D VVIGGGSGG+A ++ A+  G KVLV++  +        GLGGTCVN GC+PKK
Sbjct  3    TDVVYDYVVIGGGSGGMASARRAATYGAKVLVVERGREF---EGMGLGGTCVNFGCVPKK  59

Query  219  LMHQSSIIGELLHKDAEQFGWTVSNAS-------FDWTKLVSSVQDYIHGLNFKYRIDLR  271
            +M  ++   E L ++ +   ++++ A+       FDW  + +    YI  LN  Y  +L 
Sbjct  60   VMFNAAAHVEHLARNKD---YSINTAAKDFEFGDFDWANMKTKRDAYIKRLNGIYERNLG  116

Query  272  DKKVKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAISS  331
            + +V  +++ G  K    L   ++ +  G    T +  ++A GG P     PG EH I S
Sbjct  117  NAQV--DHVQGIAK----LVAKDKVEVAGKV-FTGKHVLVAPGGVPSVPDLPGMEHVIDS  169

Query  332  DDIFSKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVR-SILLRGFDQDIARRIGEY  390
            D  F   + P K  VVGA Y+A+E AG       D T+  R   +LR FD  +   + E 
Sbjct  170  DGFFKLEQQPKKVAVVGAGYIAVEMAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNEE  229

Query  391  MENESGIAFIKESVPTSIEKLPNGQLKVTHT-----HGEGIYDTVLNATGRSPDVQMLNL  445
            ME ++G+ F++      +EK  +G+L    T     H    +D +L A GR P  + L L
Sbjct  230  ME-KAGVKFVRNMRAARVEKQADGKLTFVVTINGEEHKFPDFDAILYAVGREPRTKDLGL  288

Query  446  PAAGVTLNPKSGRIDV-TNEQTSTPHIYAIGDV-IDAPELTPVAIQAGKLLARRLFG-NG  502
               GV L+ + G I+V   E TS P +YAIGD  I   ELTPVAI AG+ L+ RLFG   
Sbjct  289  EEVGVKLS-EGGFIEVDAQENTSVPGVYAIGDATITGWELTPVAIAAGRRLSDRLFGGEK  347

Query  503  TALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAK  562
             A ++Y +I T +F+    G  G +E +A+A  G +N++ Y   F  L  S++   P  K
Sbjct  348  DACLNYHQIPTVIFSHPPIGTIGYTEPEAVAKYGEENVKCYTSKFVNLLHSMAD--PERK  405

Query  563  ECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIF  622
               A  +V   +Q+ VVG H  G  A E+ Q  GVA+K++AT  DF N V IHPT AE  
Sbjct  406  GKTAMKLVTVGEQETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEEL  465

Query  623  TTL  625
             T+
Sbjct  466  VTM  468

>PHYRA_72037
Length=493

 Score = 233 bits (595),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 173/479 (36%), Positives = 249/479 (52%), Gaps = 33/479 (7%)

Query  163  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  222
            +D VVIGGGSGG+A ++ A+  G KVLV++  +        GLGGTCVN GC+PKK+M  
Sbjct  7    YDYVVIGGGSGGMASARRAATYGAKVLVVERGREF---DGMGLGGTCVNFGCVPKKVMFN  63

Query  223  SSIIGELLHKDAEQFGWTVSNAS-------FDWTKLVSSVQDYIHGLNFKYRIDLRDKKV  275
            ++   E LH++ +   +++  A+       FDW  +      YI  LN  Y  +L + KV
Sbjct  64   AAAHVEHLHRNED---YSIKTATRDFAFGDFDWANMKKKRDAYILRLNGIYERNLGNAKV  120

Query  276  KYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAISSDDIF  335
             +   + T      L   ++ +  G    T +  ++A GG P     PG EH   SD  F
Sbjct  121  DHVQGIAT------LVAKDQVEVAGKV-YTGKHVLVAPGGVPFVPDLPGMEHVTDSDGFF  173

Query  336  SKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVR-SILLRGFDQDIARRIGEYMENE  394
               + P K  VVGA Y+A+E AG       D T+  R   +LR FD  +   + + ME +
Sbjct  174  RLEQQPKKVAVVGAGYIAVELAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNDEME-K  232

Query  395  SGIAFIKESVPTSIEKLPNGQLK-VTHTHGEGI----YDTVLNATGRSPDVQMLNLPAAG  449
            +G+ F++ +    ++K  +G+L  V    GE      +D +L A GR P  + L L   G
Sbjct  233  AGVKFVRNTRAVRVDKQDDGKLTFVVTVDGEEQKFPDFDVILYAIGREPRTKDLGLEKVG  292

Query  450  VTLNPKSGRIDV-TNEQTSTPHIYAIGDVIDAP-ELTPVAIQAGKLLARRLFG-NGTALM  506
            V L    G I+V   E TS P +YAIGD      ELTPVAI AG+ L+ RLFG    A +
Sbjct  293  VKL-ADGGFIEVDAQENTSVPGVYAIGDATTTGWELTPVAIAAGRRLSDRLFGGEKDACL  351

Query  507  DYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAKECYA  566
            +Y +I T +F+    G  G +E +A+A  G +N++VY   F  L  S++   P  K   A
Sbjct  352  NYHQIPTVIFSHPPIGTIGYTEPEAVAKFGEENVKVYSSKFVNLLHSMAD--PERKGKTA  409

Query  567  KLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIFTTL  625
              +V   +Q+ VVG H  G  A E+ Q  GVA+K++AT  DF N V IHPT AE   T+
Sbjct  410  MKLVTVGEQETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVTM  468

>PHALS_09136
Length=493

 Score = 233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 172/480 (36%), Positives = 249/480 (52%), Gaps = 27/480 (6%)

Query  159  TQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKK  218
            T   +D +VIGGGSGG+A ++ A+  G KVLV++  +        GLGGTCVN GC+PKK
Sbjct  3    TDMVYDFMVIGGGSGGMASARRAATCGAKVLVVERGREF---DGMGLGGTCVNFGCVPKK  59

Query  219  LMHQSSIIGELLHKDAEQFGWTVSN----ASFDWTKLVSSVQDYIHGLNFKYRIDLRDKK  274
            +M  +++  E L+++ +    T +       FDW  + +    YI  LN  Y  +L + +
Sbjct  60   VMFNTAVHVEHLNRNKDYSINTCAKDFEFGDFDWANMKTKRDAYIQRLNGIYERNLSNAQ  119

Query  275  VKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAISSDDI  334
            V     +        + +            T +  ++A GG P     PG EH I SD  
Sbjct  120  VDVIQGIAKIVAKDKIQVAGHI-------YTGKHVLVAPGGVPNIPDIPGKEHVIDSDGF  172

Query  335  FSKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVR-SILLRGFDQDIARRIGEYMEN  393
            F   + P K  VVGA Y+A+E AG       D T+  R   +LR FD  +   + E ME 
Sbjct  173  FKLEQQPKKVAVVGAGYIAVELAGIFNMLKSDTTLFCRHDQVLRKFDPIVRDLVNEEME-  231

Query  394  ESGIAFIKESVPTSIEKLPNGQLK-VTHTHGEGI----YDTVLNATGRSPDVQMLNLPAA  448
            ++G+ F++    T IEK  + +L  V   +GE      +DT+L A GR P  + L L   
Sbjct  232  KAGVEFVRNMSATRIEKSNDDKLTFVVTMNGEEQEFTNFDTILFAVGRVPRTKDLGLEEI  291

Query  449  GVTLNPKSGRIDV-TNEQTSTPHIYAIGDV-IDAPELTPVAIQAGKLLARRLFG-NGTAL  505
            GV L    G I+V   E T+ P +YAIGDV +   ELTPVAI AG+ LA RLFG    A 
Sbjct  292  GVKL-ADGGYIEVDAQENTTVPGVYAIGDVTVTGWELTPVAIAAGRRLADRLFGGEKDAC  350

Query  506  MDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAKECY  565
            ++Y +I T +F+    G  G +E +AIA  G++NI++Y   F  L  +++   P  K   
Sbjct  351  LNYHQIPTVIFSHPPIGTIGYTEPEAIARFGKENIKIYTSKFVNLLHAMAD--PERKGKT  408

Query  566  AKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIFTTL  625
            A  +V   +++ VVG H  G  A E+ Q  GVA+K++AT  DF N V IHPT +E   T+
Sbjct  409  AMKLVTVGEEETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTASEELVTM  468

>PHYRA_71927
Length=485

 Score = 232 bits (592),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 170/496 (34%), Positives = 242/496 (49%), Gaps = 38/496 (8%)

Query  159  TQYDWDLVVIGGGSGGLACSKEASKL-GQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPK  217
            ++ ++D +VIG GSGG+A ++ A+   G +V V++  +         LGGTCVNVGC+PK
Sbjct  8    SRTEYDYLVIGAGSGGMASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPK  58

Query  218  KLMHQSSIIGELLHKDAEQFGW--------TVSNASFDWTKLVSSVQDYIHGLNFKYRID  269
            KLM  ++ +   L  D   +G+              FDW KL +    Y+  LN  Y  +
Sbjct  59   KLMFIAADMSHKLRHDFLHYGFEDEATGGHLGQRTHFDWPKLKARRDAYVLRLNGIYERN  118

Query  270  LRDKKVKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAI  329
            L + KV+  +    F +   + +  +       ++  +  ++AVGG+P     PG E  I
Sbjct  119  LANSKVELIHGSAKFNEKGNVEVDGK-------ELLAKNVLVAVGGKPLIPDIPGKELCI  171

Query  330  SSDDIFSKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSI-LLRGFDQDIARRIG  388
             SD  F     P K  VVGA Y+A+E AG L   G D +I  R   +LR FD  I R   
Sbjct  172  DSDGFFELEMLPKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRTFD-GIVRTTL  230

Query  389  EYMENESGIAFIKESVPTSIEKLPNGQLKVTHTHG--EGIYDTVLNATGRSPDVQMLNLP  446
            E    + G+     S  T +E++ +G   +    G     YD V+ A GR P    L L 
Sbjct  231  EDAMAKDGVHLRPHSNVTRVEQVADGTKTLVLADGSEHSGYDVVIYAAGRVPLTSNLQLD  290

Query  447  AAGVTLNPKSGRIDVTN-EQTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLFGN-GTA  504
             A +  + K G I V   ++TS   + A+GDV   P LTPVAI AG+ L+ RLFG    A
Sbjct  291  NADIATD-KHGFIQVNEFQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLFGGMKDA  349

Query  505  LMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHE------R  558
             + Y  I T VF+    G  GL+EE A    G DN +VY   F  + + L +E       
Sbjct  350  KVSYENIPTVVFSHPPIGTIGLTEEQARRQYGDDNTKVYASRFVNMYYGLINEVDEATGE  409

Query  559  PLAKECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTT  618
            P  K   A  +V   ++++VVG H +G  A E+ Q  GVA+K+ AT  DF N + IHPT 
Sbjct  410  PKDKPKTAMKLVCVGKEEKVVGLHMIGMAADEILQGFGVAVKMGATKADFDNCIAIHPTA  469

Query  619  AEIFTTLEITKESGED  634
             E   TL     SG D
Sbjct  470  GEELVTLAPWGLSGRD  485

>PHYCA_504517
Length=493

 Score = 231 bits (590),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 172/482 (36%), Positives = 248/482 (51%), Gaps = 39/482 (8%)

Query  163  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  222
            +D +VIGGGSGG+A ++ A+  G KVLV++  +        GLGGTCVN GC+PKK+M  
Sbjct  7    YDYMVIGGGSGGMASARRAATYGAKVLVVERGREF---DGMGLGGTCVNFGCVPKKVMFN  63

Query  223  SSIIGELLHKDAE----------QFGWTVSNASFDWTKLVSSVQDYIHGLNFKYRIDLRD  272
            ++   E L+++ +          QFG       FDW  +      YI  LN  Y  +L +
Sbjct  64   TAAHVEHLNRNKDYSINTADKEFQFG------DFDWNNMKIKRDAYIKRLNGIYERNLGN  117

Query  273  KKVKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAISSD  332
              V +   +          +  +  + G    T +  ++A GG P     PG E+ I SD
Sbjct  118  ANVDHVQGIAKL-------VAKDKIQVGDKVYTGKHVLVAPGGVPSVPDLPGMENVIDSD  170

Query  333  DIFSKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVR-SILLRGFDQDIARRIGEYM  391
              F   + P K  VVGA Y+A+E AG       D T+  R   +LR FD  +   + E M
Sbjct  171  GFFKLEQQPKKVAVVGAGYIAVEMAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNEEM  230

Query  392  ENESGIAFIKESVPTSIEKLPNGQLK-VTHTHGEGI----YDTVLNATGRSPDVQMLNLP  446
            E ++G+ F++      +EK  NG+L  V   +GE      +DT+L A GR P  + L L 
Sbjct  231  E-KAGVKFVRNMRAARVEKQDNGKLTFVVTINGEEQKFPDFDTILYAVGREPRTKDLGLE  289

Query  447  AAGVTLNPKSGRIDV-TNEQTSTPHIYAIGDV-IDAPELTPVAIQAGKLLARRLFG-NGT  503
              GV L+ + G I+V   E TS P +YAIGD  +   ELTPVAI AG+ L+ RLFG    
Sbjct  290  EVGVKLS-EGGFIEVDAQENTSVPGVYAIGDATVTGWELTPVAIAAGRRLSDRLFGGEKD  348

Query  504  ALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAKE  563
            A ++Y +I T +F+    G  G +E +A+   G +N++VY   F  L  S++   P  K 
Sbjct  349  ACLNYHQIPTVIFSHPPIGTIGYTEPEAVEKYGEENVKVYTSKFVNLLHSMAD--PERKG  406

Query  564  CYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIFT  623
              A  +V   +++ VVG H  G  A E+ Q  GVA+K++AT  DF N V IHPT AE   
Sbjct  407  KTAMKLVTVGEKETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELV  466

Query  624  TL  625
            T+
Sbjct  467  TM  468

>PYAP_23435
Length=951

 Score = 241 bits (614),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 184/489 (38%), Positives = 252/489 (52%), Gaps = 29/489 (6%)

Query  151  SDTSSSDETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCV  210
            S  ++S  T   +D VVIGGGSGG+A ++ A+  G KVL+++  +        GLGGTCV
Sbjct  459  SAFAASRLTDMVYDYVVIGGGSGGMASARRAATYGAKVLLVERGRAH---DGMGLGGTCV  515

Query  211  NVGCIPKKLMHQSSIIGELLHKDAEQFGWTVSNA----SFDWTKLVSSVQDYIHGLNFKY  266
            N GC+PKK+M  ++   E L ++ +    T   A     FDW  + +    YI  LN  Y
Sbjct  516  NYGCVPKKVMFNAAAHVEHLARNGDYSINTAPKAFEFGDFDWANMKTKRDAYILRLNGIY  575

Query  267  RIDLRDKKVKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWE  326
              ++ +  +         +   TL  +N+ +  G    T +  ++AVGG P   + PG E
Sbjct  576  ERNVGNAGIDL------VQGVATLVSSNQIEVDGKV-FTGKHVLVAVGGVPAMPAIPGIE  628

Query  327  HAISSDDIFSKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVR-SILLRGFDQDIAR  385
            HAI SD  F     P K  VVGA Y+A+E AG       +  +  R   +LR FD  +  
Sbjct  629  HAIDSDGFFKLESQPKKVAVVGAGYIAVEIAGIFNTLKSETFLFCRYDQVLRAFDPYVRD  688

Query  386  RIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHTHGEGI------YDTVLNATGRSPD  439
             + E ME + G+ F++ S    IEK  +G+L + H   +G       +D VL A GR P 
Sbjct  689  LVNEEME-KHGVNFVRRSRIEKIEKQADGKLTI-HAKVDGQDQTLEGFDEVLFAIGREPR  746

Query  440  VQMLNLPAAGVTLNPKSGRIDV-TNEQTSTPHIYAIGDVIDAP-ELTPVAIQAGKLLARR  497
             + L L  AGV LN   G I+V   E TS P +YAIGD      ELTPVAI AG+ LA R
Sbjct  747  TRGLGLDKAGVKLN-DGGFIEVDAQENTSVPGVYAIGDATTTGWELTPVAIAAGRRLADR  805

Query  498  LFGNG-TALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSH  556
            LFGN   A + Y +I T VF+    G  G +E +A+A  G D ++VY   F  L  S++ 
Sbjct  806  LFGNEPDACLHYHQIPTVVFSHPPLGTIGYTEPEAVAKFGADKVKVYTSKFVNLLHSMAD  865

Query  557  ERPLAKECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHP  616
              P  K   A  +V     + VVG H  G  A E+ Q  GVAMK++AT  DF N V IHP
Sbjct  866  --PENKGKTAMKLVCVGDDEVVVGLHVAGEGADEMVQGFGVAMKMNATKADFDNIVAIHP  923

Query  617  TTAEIFTTL  625
            T AE F T+
Sbjct  924  TAAEEFVTM  932

>CCI11048
Length=496

 Score = 231 bits (589),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 164/465 (35%), Positives = 229/465 (49%), Gaps = 29/465 (6%)

Query  179  KEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGELLHKDA----  234
            + A+  G KVL+++  +        G GGTCVN GC+PKK+M+ ++   E + + +    
Sbjct  22   RRAATYGAKVLLIERHREY---DGAGYGGTCVNYGCVPKKVMYNAAAHVEHIERASDYSI  78

Query  235  ------EQFGWTVSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYENMLGTFKDAH  288
                  E    + S   FDW ++ +    YI  LN  Y  +L + K+       T K   
Sbjct  79   RPFTSKECASHSFSFGDFDWGRMKTKRDAYIERLNGIYTRNLANAKID------TVKGIA  132

Query  289  TLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAISSDDIFSKAEAPGKTLVVG  348
             L   +  +    +    +  +IAVGG P   S PG EHAI SD  F     P K  VVG
Sbjct  133  KLIAKDRVQVNQDSVYEGKHILIAVGGTPAMPSLPGIEHAIDSDGFFKLETQPKKVAVVG  192

Query  349  ASYVALECAGFLKGQGFDVTIMVR-SILLRGFDQDIARRIGEYMENESGIAFIKESVPTS  407
            A Y+A+E AG       D  +  R   +LR FD  +   + E ME + G+ F+++S    
Sbjct  193  AGYIAVEIAGVFNTLKSDTFVFCRFDQVLRKFDPLVRDLVNEEMEKD-GVNFVRKSHLEK  251

Query  408  IEKLPNGQLKVTHTHGE-----GIYDTVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDVT  462
            I K  + +L +T   GE       +D ++ A GRSP    L L   GV LN     I   
Sbjct  252  ITKAKDDKLAITARIGEENQTFSDFDQIVMAVGRSPRTVGLGLEEVGVALNETGHIIVDA  311

Query  463  NEQTSTPHIYAIGDVIDAP-ELTPVAIQAGKLLARRLFGN-GTALMDYTKICTAVFTPVE  520
             E TS P +YA+GDV     ELTPVAI AG+ LA RLF N   A + Y +I T VF+   
Sbjct  312  QENTSVPGVYALGDVTTTGWELTPVAIAAGRRLADRLFNNEKEACLHYHQIPTVVFSHPP  371

Query  521  YGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAKECYAKLIVDTTQQKRVVG  580
             G  G +E +AIA  G +N++ Y   F  L +S++ E P  K+  A  +V    ++ VVG
Sbjct  372  LGTIGYTEPEAIAKYGEENVKCYSSKFVNLLYSMA-EDPEKKKKTAMKLVCVGSKETVVG  430

Query  581  FHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIFTTL  625
             H  G  A E+ Q  GVAMK+ AT  DF N V IHPT +E   T+
Sbjct  431  LHVAGDGADEMVQGFGVAMKMGATKADFDNIVAIHPTASEELVTM  475

>H257_09722
Length=518

 Score = 229 bits (585),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 170/482 (35%), Positives = 246/482 (51%), Gaps = 35/482 (7%)

Query  163  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  222
            +D +V+GGGSGG++ ++ A+  G  VLV++  +        GLGGTCVNVGC+PKK+M+ 
Sbjct  28   YDYIVLGGGSGGISSARRAASYGANVLVIERGREQ---GGAGLGGTCVNVGCVPKKVMYN  84

Query  223  SSIIGELLHKDAEQFGWT----VSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYE  278
            ++   E+LH  A+ + +     V   SFDW  + +    Y+  L+  Y  +L    +   
Sbjct  85   AAFHAEILHS-AKAYAFKGVQDVGFGSFDWATMKTKRDSYVARLHGIYERNLAKDNITLV  143

Query  279  NMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAISSDDIFSKA  338
            +   +F D HT+ +            T    ++AVGG P+  S PG EHAISSD  F   
Sbjct  144  SGRASFVDNHTIAVDGAT-------FTAPHILVAVGGVPQLPSIPGIEHAISSDGFFGLE  196

Query  339  EAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSI-LLRGFDQDIARRIGEYMENESGI  397
              P K  V+GA Y+A+E AG       +  +  R   +LR FD  +   + + M   SG+
Sbjct  197  TQPKKVAVIGAGYIAVELAGIFNALQSETVVFCRGRQVLRTFDPLVRDLVNDEMR-RSGV  255

Query  398  AFIKESVPTSIEKLPNGQLKVTHT-----------HGEGIYDTVLNATGRSPDVQMLNLP  446
             F+  S   SI K P+G L +  T           H    +D ++ A GR+P      + 
Sbjct  256  QFVPHSGVQSIRKEPDGTLTIEATLTTEDGHSTTHHAFRGFDAIVMAVGRTPRTSGF-ME  314

Query  447  AAGVTLNPKSGRIDVT-NEQTSTPHIYAIGDVIDAP-ELTPVAIQAGKLLARRLFGNG-T  503
               +  N K G I+V   E TS P +YAIGDV +   ELTPVAI AG+ LA RLFG    
Sbjct  315  HTTIIRNEK-GFIEVDGQENTSVPGVYAIGDVTNTGWELTPVAIAAGRRLADRLFGGEPD  373

Query  504  ALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAKE  563
            A + Y +I T VF+    G  G +E DA+A  G  N++VY  +F  L +S+    P  K 
Sbjct  374  ACLHYHQIPTVVFSHPPIGTVGYTEPDAVAKFGPSNVKVYTSSFVNLFYSML--APENKP  431

Query  564  CYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIFT  623
              A  ++   +++ VVG H  G  A E+ Q  GVA+K+ A   D  N V IHPT +E F 
Sbjct  432  KTAMKLICVGKEETVVGMHVAGMGADEMIQGFGVAVKMGAYKSDLDNIVAIHPTASEEFV  491

Query  624  TL  625
            T+
Sbjct  492  TM  493

>H257_17037
Length=498

 Score = 227 bits (578),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 159/460 (35%), Positives = 234/460 (51%), Gaps = 25/460 (5%)

Query  178  SKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGELLHKDAEQF  237
            +  A + G KVLV++  + +      G+GGTCVNVGC+PKK+M+ +    E+LH  A+ +
Sbjct  23   ASRAVEYGAKVLVIERGRAN---GGAGMGGTCVNVGCVPKKIMYNAGFHAEILHS-AKDY  78

Query  238  GW----TVSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYENMLGTFKDAHTLTLT  293
             +     V   SFDW  + +    Y++ L   Y   L ++ + +     TF D HT+ + 
Sbjct  79   SFKEVVNVKFGSFDWAAMKAKRDAYVNWLTGAYEEGLGEENIDHVIGAATFVDDHTVEV-  137

Query  294  NEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAISSDDIFSKAEAPGKTLVVGASYVA  353
            N  +   P        +IAVGG P+  + PG EHAISSD  F     P K  VVGA Y+A
Sbjct  138  NGLRFTAP------HILIAVGGVPQLPTIPGIEHAISSDGFFDLPTQPKKVAVVGAGYIA  191

Query  354  LECAGFLKGQGFDVTIMVRS-ILLRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKLP  412
            +E AG       D  +  R   +LR FD  +   + + M  +SG+ F+ +S   SI K  
Sbjct  192  VELAGIFNALKSDTVVFCRGDQVLRKFDPLVRDLVNDEMA-KSGVTFVTQSHLQSIRKEA  250

Query  413  NGQLKVTHTHGE-----GIYDTVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDVTNEQTS  467
            +G L +  T  +       ++ +++A GR P    + L    V L+     +    E T+
Sbjct  251  DGTLTIVATVNDIRAEFPGFNAIVSAIGRIPRTFDVGLDKTTVELSTDGFVVVDAQENTT  310

Query  468  TPHIYAIGDV-IDAPELTPVAIQAGKLLARRLFGN-GTALMDYTKICTAVFTPVEYGCCG  525
             P +YAIGD  I   ELTPVAI AG+ LA RLFG+   A + Y +I T +F+    G  G
Sbjct  311  VPGVYAIGDATITGWELTPVAIAAGRRLADRLFGHEANACIHYHQIPTVIFSHPPIGTIG  370

Query  526  LSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAKECYAKLIVDTTQQKRVVGFHYLG  585
            L+E +AIA  G+ N+  Y  +F+ L +SL        +   KL+    ++  VVG H  G
Sbjct  371  LTEPEAIAKYGQANVTAYTSSFSNLFYSLGKPADHKPQTAMKLVCIGVEET-VVGAHVAG  429

Query  586  PNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIFTTL  625
              A E+ Q  GVA+K+ A   DF N V IHPT +E   T+
Sbjct  430  LGADEMIQGFGVAIKMGAYKSDFDNIVAIHPTASEEMVTM  469

>PITG_13427
Length=463

 Score = 222 bits (565),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 165/470 (35%), Positives = 227/470 (48%), Gaps = 38/470 (8%)

Query  176  ACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGELLHKDAE  235
            +  + AS  G +V V++  +         LGGTCVNVGC+PKKLM  ++ +   L  D  
Sbjct  3    SARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLMFIAADMSHKLRHDLL  53

Query  236  QFGW--------TVSNASFDWTKLVSSVQDYIHGLNFKY-RIDLRDKKVKYENMLGTFKD  286
             +G+              FDW KL +    Y+  LN  Y R +L + KV+    L TF +
Sbjct  54   HYGFEDEATGGHLGKRTHFDWPKLKAGRDAYVLRLNGIYERRNLANSKVELIRGLATFNE  113

Query  287  AHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAISSDDIFSKAEAPGKTLV  346
               + +       G  ++  +  +IAVGG+P     PG E  I SD  F     P K  V
Sbjct  114  KGNVEV-------GGKELLAKNVLIAVGGKPLIPDLPGKELCIDSDGFFELETLPKKVAV  166

Query  347  VGASYVALECAGFLKGQGFDVTIMVRSI-LLRGFDQDIARRIGEYMENESGIAFIKESVP  405
            VGA Y+A+E AG L   G D ++  R   +LR FD DI R   E    + G+     S  
Sbjct  167  VGAGYIAVELAGVLNALGSDTSLFCRKEGVLRAFD-DIVRTTLEDAMAKEGVHLRPHSNV  225

Query  406  TSIEKLPNGQLKVTHTHGEGI--YDTVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDVTN  463
              +E   +G   +  T G     YD V+ A GR P    L L  AG+T + + G I V  
Sbjct  226  ARVELGADGTKTLVLTDGSKYSGYDVVIYAAGRVPLTSNLQLDKAGITTD-EHGFIPVNE  284

Query  464  -EQTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLFGN-GTALMDYTKICTAVFTPVEY  521
             ++TS   + A+GDV   P LTPVAI AG+ L+ RLFG    A + Y  I T VF+    
Sbjct  285  LQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLFGGMNDAKVSYENIPTVVFSHPPI  344

Query  522  GCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHE------RPLAKECYAKLIVDTTQQ  575
            G  GL+EE A    G D I+VY   F  + + L +E       P  K   A  +V   ++
Sbjct  345  GTIGLTEEQARRKYGDDAIKVYTSRFVNMYYGLINEVDESTGEPKDKPKTAMKLVCAGKE  404

Query  576  KRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIFTTL  625
            ++VVG H +G  A E+ Q  GVA+K+ AT  DF N + IHPT  E   TL
Sbjct  405  EKVVGLHMIGMAADEILQGFGVAVKMGATKADFDNCIAIHPTAGEELVTL  454

>CCA23647
Length=496

 Score = 223 bits (567),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 158/465 (34%), Positives = 228/465 (49%), Gaps = 29/465 (6%)

Query  179  KEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGELLHKDAE---  235
            + A+  G KVL+++  +        G GGTCVN GC+PKK+M+ ++   E + +  +   
Sbjct  22   RRAATYGAKVLLIERHREY---EGAGYGGTCVNYGCVPKKVMYNAAAHVEHIERAPDYSI  78

Query  236  -------QFGWTVSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYENMLGTFKDAH  288
                       + S   FDW ++      YI  LN  Y  +L + K+     +       
Sbjct  79   RPFASKGDTSHSFSFGDFDWGRMKVKRDAYIERLNGIYTRNLANAKIDTVTGIAKLIAKD  138

Query  289  TLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAISSDDIFSKAEAPGKTLVVG  348
             + +  ++  +G      +  +IAVGG P   S PG EHAI SD  F     P K  VVG
Sbjct  139  RVQVNQDSFFEG------KHILIAVGGTPAMPSIPGIEHAIDSDGFFKLETQPKKVAVVG  192

Query  349  ASYVALECAGFLKGQGFDVTIMVR-SILLRGFDQDIARRIGEYMENESGIAFIKESVPTS  407
            A Y+A+E AG       D  +  R   +LR FD  +   + E ME ++G+ F+++S    
Sbjct  193  AGYIAVEIAGVFNTLKSDTFLFCRFDQVLRKFDPLVRDLVNEEME-KNGVNFVRKSHLEK  251

Query  408  IEKLPNGQLKVTHTHGE-----GIYDTVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDVT  462
            I K  + +L +T   G+       +D ++ A GRSP    L L   GV LN     I   
Sbjct  252  IVKSEDDKLAITARIGDQSQTFSNFDQIVMAVGRSPRTVDLGLEDVGVELNETGHIIVDA  311

Query  463  NEQTSTPHIYAIGDVIDAP-ELTPVAIQAGKLLARRLFGN-GTALMDYTKICTAVFTPVE  520
             E TS P +YA+GDV     ELTPVAI AG+ LA RLF N   A + Y +I T VF+   
Sbjct  312  QENTSIPGVYALGDVTTTGWELTPVAIAAGRRLADRLFNNEKEACLYYHQIPTVVFSHPP  371

Query  521  YGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAKECYAKLIVDTTQQKRVVG  580
             G  G +E +AIA  G +N++ Y   F  L +S++ +    K+   KL+     ++ VVG
Sbjct  372  LGTIGYTEPEAIAKYGEENVKCYSSKFVNLLYSMAEDPEKKKKTCMKLVC-VGSKETVVG  430

Query  581  FHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIFTTL  625
             H  G  A E+ Q  GVAMK+ AT  DF N V IHPT +E   T+
Sbjct  431  LHVAGDGADEMVQGFGVAMKMGATKADFDNIVAIHPTASEELVTM  475

>H310_11259
Length=519

 Score = 220 bits (561),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 173/481 (36%), Positives = 250/481 (52%), Gaps = 33/481 (7%)

Query  163  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  222
            +D +V+GGGSGG+A ++ A+  G KVLV++  +        GLGGTCVNVGC+PKK+M+ 
Sbjct  29   YDYIVLGGGSGGIASARRAASYGAKVLVVERGRTL---GGAGLGGTCVNVGCVPKKVMYN  85

Query  223  SSIIGELLHKDAEQFGWT----VSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYE  278
            ++ + E++H  A+ + +     V   SFDW  + S    Y+  L+  Y  +L    +   
Sbjct  86   AAFLAEIMHS-AKTYTFKGVQGVEFGSFDWPAMKSKRDAYVTRLHGIYERNLAKDGISLV  144

Query  279  NMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAISSDDIFSKA  338
            + +  F D HT+ + + AK   P        ++AVGG P+  S PG E AISSD  F+  
Sbjct  145  SGVAAFVDNHTIAV-DGAKFTAP------HILVAVGGTPQLPSIPGIELAISSDGFFALE  197

Query  339  EAPGKTLVVGASYVALECAGFLKGQGFDVTIMVR-SILLRGFDQDIARRIGEYMENESGI  397
              P K  VVGA Y+A+E AG       D T+  R   +LR FD  +   + + M   +G+
Sbjct  198  TQPRKVAVVGAGYIAVELAGIFNALQTDTTLFCRHDQVLRKFDPLVRDHVNKEMR-RAGV  256

Query  398  AFIKESVPTSIEKLPNGQLKVTHT----HGEGI------YDTVLNATGRSPDVQMLNLPA  447
            AF+ +S   SI K  NG L +  T    +G         YD V+ A GR+P         
Sbjct  257  AFVTQSGVDSIHKEANGTLTIQATIKQENGSATTQEFSGYDAVVVAIGRTPRTTDCGFDR  316

Query  448  AGVTLNPKSGRIDVT-NEQTSTPHIYAIGDVIDAP-ELTPVAIQAGKLLARRLF-GNGTA  504
              +  + K G I V   E T+ P +YAIGD      ELTPVAI AG+ LA RLF G   A
Sbjct  317  TDIVFDRK-GFIQVDGQENTTVPGVYAIGDATATGWELTPVAIAAGRRLADRLFGGEPDA  375

Query  505  LMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAKEC  564
             ++Y +I T VF+    G  G +E DAIA  G  N++VY  +F  L ++L   + +    
Sbjct  376  CINYHQIPTVVFSHPPIGTIGYTEPDAIAKYGPANVKVYTSSFVNLFYTLLPPKDMPST-  434

Query  565  YAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIFTT  624
             A  +V   +++ VVG H  G  A E+ Q  GVA+K+ A   D  N + IHPT +E   T
Sbjct  435  -AMKVVCVGKEETVVGMHVAGMGADEMIQGFGVAVKMGAYKSDLDNVIAIHPTASEELVT  493

Query  625  L  625
            +
Sbjct  494  M  494

>PHYKE_6836
Length=493

 Score = 217 bits (553),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 172/482 (36%), Positives = 251/482 (52%), Gaps = 39/482 (8%)

Query  163  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  222
            +D VVIGGGSGG+A ++ A+  G KVLV++  +        GLGGTCVN GC+PKK+M  
Sbjct  7    YDYVVIGGGSGGMASARRAATYGAKVLVVERGRKY---DGMGLGGTCVNYGCVPKKVMFN  63

Query  223  SSIIGELLHKDAE----------QFGWTVSNASFDWTKLVSSVQDYIHGLNFKYRIDLRD  272
            +++  E L ++ +          QFG       FDW+ + +    YI  LN  Y  +L++
Sbjct  64   TAMHVEHLARNRDYSINTAQRDFQFG------DFDWSNMKTKRDAYILRLNGIYERNLQN  117

Query  273  KKVKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAISSD  332
            ++V +   +        + +  +         T +  ++A GG P     PG EH I SD
Sbjct  118  QQVDHVQGIAKIVAKDKIQVDGQV-------FTGKNLLVAPGGVPTIPDFPGNEHVIDSD  170

Query  333  DIFSKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVR-SILLRGFDQDIARRIGEYM  391
              F   + P K  VVGA Y+A+E AG       D T+  R   +LR FD  +   + E M
Sbjct  171  GFFKLEQQPKKVAVVGAGYIAVEMAGIFNTLKSDTTLFCRFDQVLRKFDPIVRDLVNEEM  230

Query  392  ENESGIAFIKESVPTSIEKLPNGQLK-VTHTHGEG----IYDTVLNATGRSPDVQMLNLP  446
            E ++G+ F++ S    +EK  +G+L  V    G+      +DT+L A GR+P  + L L 
Sbjct  231  E-KAGVKFVRNSRAVRVEKQTDGKLTFVVTVDGKEEKFPDFDTILYAVGRTPRTKDLGLE  289

Query  447  AAGVTLNPKSGRIDV-TNEQTSTPHIYAIGDVIDAP-ELTPVAIQAGKLLARRLFG-NGT  503
               V L+ + G I+V   E TS   +YAIGD      ELTPVAI AG+ L+ RLFG    
Sbjct  290  EINVKLS-QDGFIEVDAQENTSVEGVYAIGDATTTGWELTPVAIAAGRRLSDRLFGGEKD  348

Query  504  ALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAKE  563
            A ++Y +I T +F+    G CG +E +A+   G++NI+ Y   F  L  S++   P  K 
Sbjct  349  ACLNYHQIPTVIFSHPPIGTCGYTEPEAVEKFGQENIKTYSSKFVNLLHSMAD--PERKG  406

Query  564  CYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIFT  623
              A  +V   +++ VVG H  G  A E+ Q  GVAMK++AT  DF N V IHPT AE   
Sbjct  407  KTAMKLVCVGEEEVVVGVHVAGEGADEMIQGFGVAMKMNATKADFDNIVAIHPTAAEELV  466

Query  624  TL  625
            T+
Sbjct  467  TM  468

>PHYCA_7619
Length=462

 Score = 211 bits (536),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 156/466 (33%), Positives = 219/466 (47%), Gaps = 37/466 (8%)

Query  179  KEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGELLHKDAEQFG  238
            + AS  G +V V++  +         LGGTCVNVGC+PKKLM  ++ +   LH D   +G
Sbjct  6    RAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLMFIAADMSHKLHHDFLHYG  56

Query  239  WTVS--------NASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYENMLGTFKDAHTL  290
            +              FDW KL +    Y+  LN  Y  +L + KV        F     +
Sbjct  57   FEDEVTGGHLGKRTHFDWPKLKARRDAYVLRLNGIYERNLENSKVDLIRGSAKFNQNGNV  116

Query  291  TLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAISSDDIFSKAEAPGKTLVVGAS  350
             +  +       ++     +IAVGG+P     PG E  I SD  F     P K  VVGA 
Sbjct  117  EVDGK-------EILADNVMIAVGGKPLIPDIPGKELCIDSDGFFELETLPKKVAVVGAG  169

Query  351  YVALECAGFLKGQGFDVTIMVRSI-LLRGFDQDIARRIGEYMENESGIAFIKESVPTSIE  409
            Y+A+E AG L   G + +I  R   +LR FD  +   + + ME + G+     S    +E
Sbjct  170  YIAVELAGVLNALGSETSIFCRKEGVLRTFDDIVPTTLEDAMEKD-GVHLCPHSNVVRVE  228

Query  410  KLPNGQLKVTHTHG--EGIYDTVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDVTN-EQT  466
            +  +    +    G     Y+ V+ A GR P    L L  AGVT +   G I V   +QT
Sbjct  229  QAADNTRTLVLADGSEHSGYEVVIYAAGRVPLTTSLQLDKAGVTTD-NHGFIQVDEYQQT  287

Query  467  STPHIYAIGDVIDAPELTPVAIQAGKLLARRLFGN-GTALMDYTKICTAVFTPVEYGCCG  525
            S  +++A+GD    P LTPVAI AG+ L+ RLFG    A + Y  I T VF+    G  G
Sbjct  288  SNSNVFAVGDACGTPALTPVAIAAGRRLSDRLFGGMKDAKISYENIPTVVFSHPPIGTIG  347

Query  526  LSEEDAIASAGRDNIQVYHQNFTPLEWSLSHE------RPLAKECYAKLIVDTTQQKRVV  579
            L+E  A    G D I+VY   F  + + L +E       P  K   A  +V   + ++VV
Sbjct  348  LTEAQARCKYGDDEIKVYTSRFVNMYYGLINEIDEETGEPKDKPKTAMKLVCAGKDEKVV  407

Query  580  GFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIFTTL  625
            G H +G  A E+ Q  GVA+K+ AT  DF + + IHPT  E   TL
Sbjct  408  GLHMIGMAADEILQGFGVAVKMGATKADFDDCIAIHPTAGEELVTL  453

>PYVX_21517
Length=482

 Score = 199 bits (505),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 158/510 (31%), Positives = 237/510 (46%), Gaps = 86/510 (17%)

Query  159  TQYDWDLVVIGGGSGGLACSKEASKL-GQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPK  217
            T  ++DL+VIG GSGG+A S+ A+     +V V++  +         LGGTCVNVGC+PK
Sbjct  24   TAREFDLLVIGAGSGGMAASRRAASYPNTRVAVVERAR---------LGGTCVNVGCVPK  74

Query  218  KLMHQSSIIGELLHKDAEQFGW---------TVSNASFDWTKLVSSVQDYIHGLNFKYRI  268
            K+M+  + +   LH+DA  +G+           +  +FDW KL      Y+  LN  Y  
Sbjct  75   KIMYTGASLSHALHRDAFHYGFEDAASPGKSIGARVAFDWQKLKQRRDAYVLRLNGIYER  134

Query  269  DLRDKKVKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPK----PLSCPG  324
            +L + KV  E + GT +      +  + +  G  +V  ++ ++AVGG+P     P++  G
Sbjct  135  NLANSKV--ELLTGTAR----FNVDGKIEVDG-VEVRAKKVLLAVGGKPLIPDIPVAATG  187

Query  325  WEHAISSDDIFSKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSI-LLRGFD---  380
             E  I SD  F   + P K  VVGA Y+A+E AG L   G D TI  R   +LR FD   
Sbjct  188  KELCIDSDGFFELEQLPRKVAVVGAGYIAVELAGVLNALGADTTIFTRRDGVLRSFDWWN  247

Query  381  ---------QDIARRIGEYMENESGIAFIKESVPTSIEKLPNGQLKV------THTHGEG  425
                     Q+I R   +    + G+     S    +E   +G   +      THT    
Sbjct  248  SQFLAGDSEQEIVRSTLQDTMAQDGVTLRPHSNIERVELAADGTKTLVLADGSTHTG---  304

Query  426  IYDTVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDVTN-EQTSTPHIYAIGDVIDAPELT  484
             +++V+ A GR P    L L  AGV  + + G I V   +QT+ P I A+GD      LT
Sbjct  305  -FESVIYAAGRVPLTGDLGLDNAGVATDER-GHIRVDEYQQTTAPDILAVGDACGTIALT  362

Query  485  PVAIQAGKLLARRLFGNGTALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYH  544
            P++                    Y  + T VF+    G  GL+E+ A A  G + I++Y 
Sbjct  363  PIS--------------------YENVPTVVFSHPPIGTVGLTEKQARAKFGDEQIKIYK  402

Query  545  QNFTPLEWSLSHERPLAKECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHAT  604
              F  + + + +E           +V     +++VG H +G  A E+ Q  GVA+K+ AT
Sbjct  403  STFVNMYYGVVNE-----------LVCAGPDEKIVGLHVIGMGADEMLQGFGVAVKMGAT  451

Query  605  YDDFVNTVGIHPTTAEIFTTLEITKESGED  634
              D  + V IHPT AE   T+     SG D
Sbjct  452  KADLDSCVAIHPTGAEELVTMAPWGLSGAD  481

>HYAP_04843
Length=430

 Score = 192 bits (488),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 141/392 (36%), Positives = 195/392 (50%), Gaps = 22/392 (6%)

Query  246  FDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYENMLGTFKDAHTLTLTNEAKKKGPTDVT  305
            FDWTKL +    Y+  LN  Y  +L   KV++      F     + +  +       +V 
Sbjct  29   FDWTKLKTRRDAYVRRLNGIYERNLASSKVEFIQGSARFNKQGNVEVDGK-------EVL  81

Query  306  FRRAVIAVGGRPKPLSCPGWEHAISSDDIFSKAEAPGKTLVVGASYVALECAGFLKGQGF  365
             +  +IAVGG+P     PG E  I SD  F     P K  V+GA Y+A+E AG L   G 
Sbjct  82   AKNVMIAVGGKPMIPDIPGKELCIDSDGFFELDTLPKKVAVIGAGYIAVELAGVLNALGS  141

Query  366  DVTIMVRSI-LLRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHTHGE  424
            + +I  R   +LR FD DI R   E      G+     S    +E+  +G   +  T G 
Sbjct  142  ETSIFCRKEGVLRTFD-DIVRTTLEDAMAIDGLHLRPNSNVARVEQAADGTNTLVLTDGS  200

Query  425  GI--YDTVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDVTNE--QTSTPHIYAIGDVIDA  480
                +D V+ A GR P    L+L  AGV  N K G I V NE  +TS   ++A+GDV   
Sbjct  201  AHCGFDIVIYAAGRVPLTDKLDLDNAGVATN-KHGYI-VVNEFQETSNSKVFAVGDVCGT  258

Query  481  PELTPVAIQAGKLLARRLFGN-GTALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDN  539
            P LTPVA+ AG+ L+ RLFGN   A + Y  I T VF+    G  GL+E+ A    G D+
Sbjct  259  PALTPVAVAAGRKLSDRLFGNMKDARVSYENIPTVVFSHPPIGTIGLTEKQAQGKYGDDD  318

Query  540  IQVYHQNFTPLEWSLSHERPLA------KECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQ  593
            I+VY  +F  + + L +E   A      K   A  +V   ++++VVG H +G  A E+ Q
Sbjct  319  IKVYTSHFVNMYYGLINEVDEATGELKEKPKTAIKLVCAGKKEKVVGLHMIGMAADEILQ  378

Query  594  AIGVAMKLHATYDDFVNTVGIHPTTAEIFTTL  625
              GVA+K+ AT  DF N + IHPT +E   TL
Sbjct  379  GFGVAVKMGATKADFDNCIAIHPTASEELVTL  410

>PYIR_23431
Length=468

 Score = 186 bits (472),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 153/460 (33%), Positives = 215/460 (47%), Gaps = 52/460 (11%)

Query  179  KEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGELLHKDAEQFG  238
            + A+  G KVLV++  +        GLGGTCVN GC+PKK+M  +S   E L+++A+ + 
Sbjct  23   RRAATYGAKVLVVERGRKY---DGMGLGGTCVNYGCVPKKVMFNASAHVEHLNRNAD-YS  78

Query  239  WTVSNAS------FDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYENMLGTFKDAHTLTL  292
             T + +       FDW  + +    YI  LN  Y  +L +  V     +        +  
Sbjct  79   ITTNGSKKFEFGDFDWANMKTKRDAYILRLNGIYERNLGNAAVDLVEGIAK------VVA  132

Query  293  TNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAISSDDIFSKAEAPGKTLVVGASYV  352
             N+ +  G    T +  ++AVGG+P   + PG EH I SD  F     P K  VVGA Y+
Sbjct  133  KNQIEVNGVV-YTGKHILVAVGGKPSLPNIPGIEHVIDSDGFFRLEAQPKKVAVVGAGYI  191

Query  353  ALECAGFLKGQGFDVTIMVR-SILLRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKL  411
            A+E AG       D ++  R   +LR FD  +   I E  E ++GI F++ S    I+K 
Sbjct  192  AIELAGIFNTLKSDTSLFCRYDHVLRQFDPIVRDLINEESE-KAGINFVRNSRIERIDKQ  250

Query  412  PNGQLKVT-HTHGE----GIYDTVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDVTNEQT  466
             +G L +T    GE      +DT+L A GR P  + L L   GV L      +    E T
Sbjct  251  ADGTLTITAKVDGEEQVLSGFDTILYAIGREPRTKDLGLEEVGVKLTDAGFIVVDAQENT  310

Query  467  STPHIYAIGDV-IDAPELTPVAIQAGKLLARRLFGNGTALMDYTKICTAVFTPVEYGCCG  525
            S P IYAIGD  I   ELTP                         I T VF+    G  G
Sbjct  311  SVPGIYAIGDATITGWELTP-------------------------IPTVVFSHPPLGTIG  345

Query  526  LSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAKECYAKLIVDTTQQKRVVGFHYLG  585
             +E  AI   G +N++VY   F  L ++++   P  K   A  +V   + + VVG H  G
Sbjct  346  YTEPQAIEKFGAENVKVYTSKFVNLLYAMAD--PDHKGKTAMKLVTVGEDEVVVGVHVAG  403

Query  586  PNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIFTTL  625
              A E+ Q  GVA+K++AT  DF N V IHPT AE   T+
Sbjct  404  EGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVTM  443

>PYAR_17714
Length=444

 Score = 182 bits (463),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 157/483 (33%), Positives = 229/483 (47%), Gaps = 72/483 (15%)

Query  156  SDETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCI  215
            S ET YD+  +VIGGGSGG+A ++ A+  G KVL+++  + +      GLGGTCVN GC+
Sbjct  2    STETVYDY--IVIGGGSGGMASARRAAVHGAKVLLIERGRAN---DGMGLGGTCVNFGCV  56

Query  216  PKKLMHQSSIIGELLHKDAE---QFGWTVSNASFDWTKLVSSVQDYIHGLNFKYRIDLRD  272
            PKK+M  ++   E L ++A+   + G       FDW  + +    YI  LN  Y  ++ +
Sbjct  57   PKKVMWNAASHVEHLARNADYSIRSGAEFQYGDFDWANMAAKRDAYILRLNGIYERNIGN  116

Query  273  KKVKYENMLGTFKDAHTLTLTNEAKKKGPTDVTF-RRAVIAVGGRPKPLSCPGWEHAISS  331
             K+         +   +LT  +     G T     +  ++AVGG P     PG EHAI S
Sbjct  117  AKIDL------IEGIASLTAKDAVTVDGKTXXXXGKHILVAVGGVPAMPQIPGIEHAIDS  170

Query  332  DDIFSKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVR-SILLRGFDQDIARRIGEY  390
            DD F     P K  VVGA Y+A+E AG       +  +  R   +LR FD  I R +   
Sbjct  171  DDFFKLKTQPKKVAVVGAGYIAVEIAGVFNTLKSETHLFCRYDQVLRAFDP-IVRDLVNA  229

Query  391  MENESGIAFIKESVPTSIEKLPNGQLKVTHTHGEGI------YDTVLNATGRSPDVQMLN  444
              ++ G+ F++ S   +I K P+G+L V  T  +G+      +D VL A GR P  + L 
Sbjct  230  EMDKHGVHFVRRSRIHAIVKQPDGKLSVQATV-DGVDTVLNDFDQVLFAIGREPRTKGLG  288

Query  445  LPAAGVTLNPKSGRIDVTN-EQTSTPHIYAIGDVIDAP-ELTPVAIQAGKLLARRLFGNG  502
            L + GV L+  +G I+V   E TS   +YAIGD      ELTP                 
Sbjct  289  LESVGVKLS-DAGFIEVDKFENTSVDGVYAIGDATTTGYELTP-----------------  330

Query  503  TALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAK  562
                                       +A+   G D+++VY   F  L ++++   P  K
Sbjct  331  --------------------------PEAVEKFGADHVKVYTSTFVNLLYAMAD--PDHK  362

Query  563  ECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIF  622
               A  +V   + ++VVG H  G  A E+ Q  GVA+K++AT  DF N V IHPT AE  
Sbjct  363  SKTAMKLVCVGENEQVVGVHVAGEGADEMIQGFGVAIKMNATKSDFDNIVAIHPTAAEEL  422

Query  623  TTL  625
             T+
Sbjct  423  VTM  425

>PYVX_16175
Length=446

 Score = 175 bits (443),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 147/460 (32%), Positives = 208/460 (45%), Gaps = 70/460 (15%)

Query  179  KEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGELLHKDAEQFG  238
            + A+  G KVL+++  + +      GLGGTCVN GC+PKK+M  ++   E L++  +   
Sbjct  23   RRAASHGAKVLLVERGRAN---DGAGLGGTCVNYGCVPKKVMFNAAAHVEHLNRAGDYSV  79

Query  239  WTVSN-----ASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYENMLGTFKDAHTLTLT  293
             T+         FDW  + +    YI  LN  Y  +L + K+         +    +   
Sbjct  80   TTLGERKFQFGDFDWLNMKTKRDAYIARLNGIYERNLGNAKID------VVQGVARVVAR  133

Query  294  NEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAISSDDIFSKAEAPGKTLVVGASYVA  353
            N+ +  G    T +  ++A GG P     PG EHAI SD  F   + P K  VVGA Y+A
Sbjct  134  NQLEVDGKV-YTGKNLLLAPGGVPTLPPIPGIEHAIDSDGFFKLEQQPRKVAVVGAGYIA  192

Query  354  LECAGFLKGQGFDVTIMVR-SILLRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKLP  412
            +E AG       +  +  R   +LR FD  +   +   ME ++G+ F++ S  T I+KL 
Sbjct  193  VEIAGIFNVLQSETFLFCRYDQVLRTFDPIVRDLVNAEME-KNGVQFVRRSHITRIDKLE  251

Query  413  NGQLKVT-----HTHGEGIYDTVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDV-TNEQT  466
            +G+L++T      T   G +DTVL A GR P    L L A GV L+ K G I V   E T
Sbjct  252  DGKLQITAEVDGATQTIGGFDTVLFAIGREPRTADLGLEAIGVDLDDK-GFIKVDAQENT  310

Query  467  STPHIYAIGDVIDAP-ELTPVAIQAGKLLARRLFGNGTALMDYTKICTAVFTPVEYGCCG  525
            S   +YAIGD      ELTP                                        
Sbjct  311  SAAGVYAIGDATTTGWELTP----------------------------------------  330

Query  526  LSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAKECYAKLIVDTTQQKRVVGFHYLG  585
                DA+A  G +N++VY   F  L  +++   P  K   A  +V    Q+ VVG H  G
Sbjct  331  ---PDAVAKYGAENVKVYTSTFVNLVHAMAD--PDHKGKTAMKLVTVGAQETVVGVHVAG  385

Query  586  PNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIFTTL  625
              A E+ Q  GVA+KL AT  DF N V IHPT +E   T+
Sbjct  386  EGADEMIQGFGVAVKLGATKADFDNIVAIHPTASEELVTM  425

>CCA22989
Length=494

 Score = 143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 126/471 (27%), Positives = 210/471 (45%), Gaps = 30/471 (6%)

Query  162  DWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMH  221
            ++DL+VIGGG GG   + +A++LG K + ++        S   LGGTC+NVGCIP K + 
Sbjct  26   EYDLIVIGGGPGGYVAAIKAAQLGMKTVCIE--------SRGTLGGTCLNVGCIPSKALL  77

Query  222  QSSIIGELLHKDAEQFGWTVSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYENML  281
             SS +      D +  G   S+   ++ K++ + +  +  L        +  KV Y    
Sbjct  78   HSSHMFHTAQHDFKAIGIEASDLRLNFGKMMKAKEKSVKVLTSGIEGLFKKNKVAYIKGH  137

Query  282  GTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPL-SCP---GWEHAISSDDIFSK  337
            GT      ++++   + KG   +  +  +IA G    PL  CP        + S      
Sbjct  138  GTIVGKDQVSVSYSDESKGKETIQAKNILIATGSEVSPLPPCPVDNEKGRIVDSTGALVL  197

Query  338  AEAPGKTLVVGASYVALECAGFLKGQGFDVTIM-VRSILLRGFDQDIARRIGEYMENESG  396
               P + +VVGA  + LE     +  G +VT++   + +  G D ++ R   + ++ + G
Sbjct  198  KSTPKEMVVVGAGVIGLELGSVYRRLGANVTVIEYLNHVCPGLDMELGREFAKTLQKQ-G  256

Query  397  IAFIKESVPTSIEKLPNGQLKVTHTHGEG------IYDTVLNATGRSPDVQMLNLPAAGV  450
              F K +   +  K+   ++ +T    +G        D VL ATGR P  Q L L   G+
Sbjct  257  FKF-KFATKVTSTKVNEDRVTITMEDAKGGNETNMECDVVLVATGRRPFTQNLGLENLGI  315

Query  451  TLNPKSGRIDVTNE-QTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLFGNGTALMDYT  509
              + K GRI V N  +T  P+IYAIGDVI  P L   A + G      + G     ++Y 
Sbjct  316  QTD-KLGRIPVDNHFRTLVPNIYAIGDVIAGPMLAHKAEEEGIAAVEIMLGK-QGHVNYN  373

Query  510  KICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAKECYAKLI  569
             I   ++T  E  C G +EE       ++    Y+    P+  + S  R + +      +
Sbjct  374  AIPGVIYTFPEVACVGRTEEQL-----KEEGVSYNVGKFPM-IANSRARAVGETDGFVKV  427

Query  570  VDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAE  620
            +      R++G H +  NAGE+     + ++  A+ +D   T   HPT +E
Sbjct  428  LAQKDNDRILGIHLMTSNAGEMIAEGVLGIEYGASSEDIGRTCHAHPTLSE  478

>CCI10477
Length=494

 Score = 142 bits (357),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 126/471 (27%), Positives = 209/471 (44%), Gaps = 30/471 (6%)

Query  162  DWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMH  221
            ++DLVVIGGG GG   + +A++LG K   ++        S   LGGTC+NVGCIP K + 
Sbjct  26   EYDLVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGSLGGTCLNVGCIPSKALL  77

Query  222  QSSIIGELLHKDAEQFGWTVSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYENML  281
             SS +      D +  G  VS+   ++ K++ + +  +  L        +  KV Y    
Sbjct  78   HSSHLFHTAQHDFKSIGIEVSDLRLNFGKMMKAKEKSVKVLTSGIEGLFKKNKVAYIKGH  137

Query  282  GTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPL-SCPGWEHA---ISSDDIFSK  337
            G     + +++    + KG   +T +  +IA G    PL  CP        + S      
Sbjct  138  GKIVAKNQVSVALSDESKGNETITAKNILIATGSEVSPLPPCPVDNEKGKIVDSTGALVL  197

Query  338  AEAPGKTLVVGASYVALECAGFLKGQGFDVTIM-VRSILLRGFDQDIARRIGEYMENESG  396
               P + +VVGA  + LE     +  G +VT++   + +  G D ++ R   + ++ + G
Sbjct  198  KSIPKEMVVVGAGVIGLELGSVYRRLGANVTVVEYLNHVCPGLDMELGREFAKTLQKQ-G  256

Query  397  IAFIKESVPTSIEKLPNGQLKVTHTHGEG------IYDTVLNATGRSPDVQMLNLPAAGV  450
            + F K +   +  K+    + +T    +G        D VL ATGR P    L L + G+
Sbjct  257  LKF-KFATRVTSTKVNGDNVTITMEDAKGGNETSMECDVVLVATGRRPFTNGLGLESMGI  315

Query  451  TLNPKSGRIDVTNE-QTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLFGNGTALMDYT  509
              + K GRI V +  +T+ P IYAIGDVI  P L   A + G      + G     ++Y 
Sbjct  316  QTD-KMGRIQVDDHFRTAIPSIYAIGDVIAGPMLAHKAEEEGIAAVEIMLGK-HGHVNYN  373

Query  510  KICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAKECYAKLI  569
             I   ++T  E  C G +EE       ++    Y+    P+  + S  R + +      +
Sbjct  374  AIPGVIYTHPEVACVGKTEEQL-----KEEGISYNVGKFPM-IANSRARAVGETDGFVKV  427

Query  570  VDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAE  620
            +      R++G H +  NAGE+     + ++  A  +D   T   HPT +E
Sbjct  428  LAQKDNDRILGIHIMTSNAGEMIAEGVLGLEYGAASEDIGRTCHAHPTLSE  478

>PYU1_G014259
Length=244

 Score = 133 bits (335),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 83/230 (36%), Positives = 116/230 (50%), Gaps = 24/230 (10%)

Query  151  SDTSSSDETQYDWDLVVIGGGSGGLACSKEASKL-GQKVLVLDYVKPSPVGSTWGLGGTC  209
            S  S S + Q ++D +VIG GSGG+A S+ A+     +V V++  +         LGGTC
Sbjct  23   STRSLSSQQQDEYDYLVIGAGSGGMASSRRAASYPNTRVAVVEKAR---------LGGTC  73

Query  210  VNVGCIPKKLMHQSSIIGELLHKDAEQFGWTVS-------NASFDWTKLVSSVQDYIHGL  262
            VNVGC+PKK+M+ ++ +  +LH+DA  +G+          N SF W KL      Y+  L
Sbjct  74   VNVGCVPKKIMYLAADMNHMLHRDAFHYGFETQDGKRIGENVSFHWNKLKERRDAYVLRL  133

Query  263  NFKYRIDLRDKKVKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSC  322
            N  Y  +L + KV        F     + +  +       +V  +  +IAVGG+P     
Sbjct  134  NGIYERNLANSKVDLLQGTAAFNAQGNVEVDGK-------EVKAKNILIAVGGKPLIPDI  186

Query  323  PGWEHAISSDDIFSKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVR  372
            PG EH I SD  F     P K  VVGA Y+A+E AG L G G D TI  R
Sbjct  187  PGKEHCIDSDGFFELEVLPKKVAVVGAGYIAVELAGVLNGLGSDTTIFCR  236

>PYAP_22645
Length=1565

 Score = 140 bits (352),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 142/495 (29%), Positives = 226/495 (46%), Gaps = 48/495 (10%)

Query  145   AANAHVSDTSSSDETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWG  204
             AA A  S  SS      ++DLVVIGGG GG   + +A++LG        +K + V S   
Sbjct  1088  AARAFSSTASS------EYDLVVIGGGPGGYVAAIKAAQLG--------LKTACVESRGS  1133

Query  205   LGGTCVNVGCIPKKLMHQSSIIGELLHKDAEQFGWTVSNASFDWTKLVSSVQDYIHGLNF  264
             LGGTC+NVGCIP K +  ++ +      D  ++G  VS+   ++  ++ S +  +  L  
Sbjct  1134  LGGTCLNVGCIPSKALLHATHMYHAAQHDFSKYGIEVSDVKMNFDGMMKSKEKAVKTLTG  1193

Query  265   KYRIDLRDKKVKYENMLGTFKDAHTLTLT-NEAKKKGPTDVTFRRAVIAVGGRPKPLSCP  323
                   +  KV Y    G    A+ +++  N+A   G   +  +  +IA G    PL   
Sbjct  1194  GIEGLFKKNKVTYVKGFGKIVSANEVSVALNDA---GNETLKAKNILIATGSEVAPLPPV  1250

Query  324   GWEHA----ISSDDIFSKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLR-G  378
               ++A    + S       + P   +V+G   + LE     K  G  VT++  +  +  G
Sbjct  1251  PVDNAAGKIVDSTGALELKKVPEHLVVIGGGVIGLELGSVYKRLGAKVTVVEYADRVAPG  1310

Query  379   FDQDIARRIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHTHGEGI--------YDTV  430
              DQ++ +   + ++ + G+ F   +  T+ E   NG  KVT T              DTV
Sbjct  1311  LDQELGKEFTKLLKKQ-GLQFEFSTKVTASE--VNGD-KVTLTVEPAAGGASSTIEADTV  1366

Query  431   LNATGRSPDVQMLNLPAAGVTLNPKSGRIDVTNE-QTSTPHIYAIGDVIDAPELTPVAIQ  489
             L ATGR P  + L L   G+  + K GRI V N  +T  P+I+AIGDVI  P L   A +
Sbjct  1367  LVATGRRPFTKGLGLEQMGIQTD-KLGRIQVDNHFRTQIPNIFAIGDVIAGPMLAHKAEE  1425

Query  490   AGKLLARRLFG-NGTALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFT  548
              G      + G +G   ++Y  I   ++T  E    G +EE       ++    Y+    
Sbjct  1426  EGIACVENIAGLHGH--VNYDAIPGVIYTYPEVASVGKTEEQL-----KEEGVAYNVGKF  1478

Query  549   PLEWSLSHERPLAK-ECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDD  607
             P+  + S  R +A+ + + K+I D T   R++G H +  NAGE+     + M+  A  +D
Sbjct  1479  PM-MANSRARAVAESDGFVKVIADKTTD-RILGIHIIASNAGEMISEGVLGMEYGAASED  1536

Query  608   FVNTVGIHPTTAEIF  622
                T   HPT +E F
Sbjct  1537  IGRTCHAHPTLSEAF  1551

>PYIR_20273
Length=505

 Score = 135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 141/504 (28%), Positives = 221/504 (44%), Gaps = 56/504 (11%)

Query  146  ANAHVSDTSSSDETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGL  205
            ++A V+   +      ++DLVVIGGG GG   + +A++LG        +K + V S   L
Sbjct  17   SSAQVTSARAFSSASTEYDLVVIGGGPGGYVAAIKAAQLG--------LKTACVESRGSL  68

Query  206  GGTCVNVGCIPKKLMHQSSIIGELLHKDAEQFGWTVSNASFDWTKLVSSVQDYIHGLNFK  265
            GGTC+NVGCIP K +  S+ +      D  ++G  VS  S ++ K++ S +  +  L   
Sbjct  69   GGTCLNVGCIPSKALLHSTHLYHSAQHDFAKYGIEVSEVSMNFGKMMKSKEKAVKTLTGG  128

Query  266  YRIDLRDKKVKYENMLGTF--KDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCP  323
                 +  KV Y    G    K+   + L +     G   VT +  +IA G    PL   
Sbjct  129  IEQLFKKNKVTYIKGHGKIVAKNEVAVALNDS----GNQTVTAKNILIATGSEVSPLPPV  184

Query  324  GWEHA----ISSDDIFSKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLR--  377
              ++A    + S       + P   +VVGA  + LE     K  G  VT++    L R  
Sbjct  185  PVDNAAGKIVDSTGALELKKVPEHLVVVGAGVIGLELGSVYKRLGAKVTVV--EYLDRVC  242

Query  378  -GFDQDIARRIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHTHGEGIY---------  427
             G D ++ +   + ++ + G+ F   +  T+ E   NG+ K+T T               
Sbjct  243  PGLDLELGKEFTKLLKKQ-GLGFEFSTKVTASE--VNGE-KITLTXXXXXXXXXXAGGAA  298

Query  428  -----DTVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDVTNE-QTSTPHIYAIGDVIDAP  481
                 D VL ATGR P    L L   G+  + K GRI V +  +T  P+I+AIGDVI  P
Sbjct  299  STIECDAVLVATGRRPYTNGLGLENMGIQTD-KFGRISVDDHFRTQIPNIFAIGDVIAGP  357

Query  482  ELTPVAIQAGKLLARRLFGNGTALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQ  541
             L   A + G   A  + G     ++Y  I   ++T  E    G +EE       ++   
Sbjct  358  MLAHKAEEEGIACAETIAGK-HGHVNYNAIPGVIYTFPEVASVGKTEEQL-----KEEGV  411

Query  542  VYHQNFTPLEWSLSHERPLA---KECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVA  598
             Y+    P+   L++ R  A    +   K+I D    K ++G H +  NAGE+     + 
Sbjct  412  TYNVGKFPM---LANSRARAVGEADGLVKVIADKATDK-ILGVHIIASNAGEMISEGVLG  467

Query  599  MKLHATYDDFVNTVGIHPTTAEIF  622
            M+  A+ +D   T   HPT +E F
Sbjct  468  MEYGASSEDIARTCHAHPTLSEAF  491

>SPRG_19943
Length=343

 Score = 130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 86/252 (34%), Positives = 126/252 (50%), Gaps = 21/252 (8%)

Query  163  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  222
            +D +V+G GSGG++ +  A   G KVLV++           GLGGTCVNVGC+PKK+M  
Sbjct  21   YDYIVLGAGSGGVSSAHRAVAYGAKVLVIER---GHANDGAGLGGTCVNVGCVPKKIMFN  77

Query  223  SSIIGELLHKDAEQFGWT----VSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYE  278
            +++  E+LH  A  + +     +   +FDW  + +    Y+  LN  Y   + + KV   
Sbjct  78   AALHAEMLHS-ARAYAFKGVQDIQFGAFDWAAMKAKRDAYVKWLNDMYGEGMLEDKVDLV  136

Query  279  NMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAISSDDIFSKA  338
                 F D HT+ +  +         T +  +IAVGG P     PG EHAISSD  F+  
Sbjct  137  MGAAKFVDNHTVEVNGD-------RYTAKHILIAVGGVPAMPPLPGIEHAISSDGFFALE  189

Query  339  EAPGKTLVVGASYVALECAGFLKGQGFDVTIMVR-SILLRGFDQDIARRIGEYMENESGI  397
              P K  VVGA Y+A+E AG       D T+  R + +LR FD  +   +   ME+    
Sbjct  190  TQPRKVAVVGAGYIAVELAGIFNALKSDTTLFCRGNQVLRTFDPIVRDLVNSEMEHAG--  247

Query  398  AFIKESVPTSIE  409
               KE V T+++
Sbjct  248  ---KEKVQTAMK  256

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 30/51 (59%), Gaps = 0/51 (0%)

Query  575  QKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIFTTL  625
            ++ VVG H  G  A E+ Q  GVA+K+ A   DF N V IHPT +E   T+
Sbjct  263  EETVVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  313

>HYAP_12621
Length=501

 Score = 127 bits (319),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 131/476 (28%), Positives = 215/476 (45%), Gaps = 37/476 (8%)

Query  162  DWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKK-LM  220
            D+DLVVIGGG GG   + +A++LG        +K + V S   LGGTC+NVGCIP K L+
Sbjct  34   DYDLVVIGGGPGGYVAAIKAAQLG--------LKTACVESRGKLGGTCLNVGCIPSKALL  85

Query  221  HQSSIIGELLHKDAEQFGWTVSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYENM  280
            H + ++    H + + +G    N + ++ +++ + +  +  L           KV Y   
Sbjct  86   HSTHLLHTAQH-EFKSYGIDAPNVTANFPQMMKAKEKAVRTLTAGIESLFSKNKVTYIKG  144

Query  281  LGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPL-SCPGWEHA---ISSDDIFS  336
            +G       +++T  A ++G   +T +  ++A G    PL   P    A   + S    +
Sbjct  145  VGKLAAKGQVSVT-LADRQGNGTLTAKNIILATGSEVTPLPPVPVDNDAGKIVDSTGALA  203

Query  337  KAEAPGKTLVVGASYVALECAGFLKGQGFDVTIM-VRSILLRGFDQDIARRIGEYMENES  395
                P   +VVGA  + LE     K  G  VT++        G D+   +   + ++ + 
Sbjct  204  LTRVPEHLVVVGAGVIGLELGSVYKRLGAKVTVVEYLDSACSGMDKGAVKEFLKLLKKQ-  262

Query  396  GIAFIKESVPTSIEKLPNGQLKVTHTH----GEGIY---DTVLNATGRSPDVQMLNLPAA  448
            G+ F   +  T+ E   NG +    T     G+G     DTVL ATGR      L L   
Sbjct  263  GLEFQFGTKVTASE--VNGDVVTLTTEPANGGDGSTIKCDTVLVATGRRAFTAGLGLEQM  320

Query  449  GVTLNPKSGRIDVTNE-QTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLFGNGTALMD  507
            G+  + K GRI+V +  QT  P ++AIGDVI    L   A + G      + G     ++
Sbjct  321  GIQTD-KQGRIEVDHAFQTQVPGVFAIGDVIKGTMLAHKAEEEGIACVENIAGK-HGHVN  378

Query  508  YTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAK-ECYA  566
            Y  I   ++T  E+   G +EE+  A     N+  +     P+  + S  R +A+ +   
Sbjct  379  YGAIPNVIYTFPEFASVGKTEEELKAEGVEYNVGKF-----PM-MANSRARTVAEADGMV  432

Query  567  KLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIF  622
            K++ D    K ++G H +  NAGE+     + ++  A  +D   T   HPT +E F
Sbjct  433  KVLADKKTDK-LLGVHIIASNAGEMISEGVIGIEYGAASEDLARTCHAHPTLSEAF  487

>SDRG_14446
Length=495

 Score = 123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 136/499 (27%), Positives = 222/499 (44%), Gaps = 56/499 (11%)

Query  144  SAANAHVSDTSSSDETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTW  203
            S A  H + TS   +   ++DLVVIG G   + C+ E+ K G+ V V+D           
Sbjct  13   SLATRHATTTSLQLK---EYDLVVIGSGPSAVQCAIESVKKGKTVAVID--------KKA  61

Query  204  GLGGTCVNVGCIPKKLMHQSSI-IGELLHKDAEQFGWTVSNASFD-----WTKLVSSVQD  257
            G+GG CV+ G IP K   +S + +    H+      +   N + +        +VS   D
Sbjct  62   GIGGVCVHTGTIPSKTFRESVLHLSGFRHQGFYGKSYARDNITLNDILGRVNTVVSKEMD  121

Query  258  YIHGLNFKYRIDLRDKKVKYENMLGTFKDAHTLTLTNEAKKKG----PTDVTFRRAVIAV  313
             I       R+DL     ++EN              NE   +G    PT +  ++ ++A 
Sbjct  122  VIQAQLKAARVDLVPGLARFEN-------------ENEVSVEGDDGQPTRLRGKKFLVAC  168

Query  314  GGRP--KPLSCPGWEHAISSDDIFSKA--EAPGKTLVVGASYVALECAGFLKGQ-GFDVT  368
            G RP   PL     +  + SD I +    + P   +VVGA  + +E A  L    G +VT
Sbjct  169  GTRPAHSPLVPCDGKVILDSDQILNHGTTKLPKSWIVVGAGVIGMEYASMLNVLPGINVT  228

Query  369  IM-VRSILLRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHTHGEGIY  427
            ++  R+ +L   D +I   +   M ++     + ES+  S+E   NG +KV    G+ ++
Sbjct  229  VVDGRAEILSFCDDEIVSSLKMEMRHKGARFLLGESIK-SVEHFKNG-VKVEFNSGKAMF  286

Query  428  -DTVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDVTNE-QTSTPHIYAIGDVIDAPELTP  485
             + +L   GR  +   LNL A G++ N + G I V  + QTS PHIYA GD I AP L  
Sbjct  287  AEALLYCVGRQANTDGLNLEAVGLSKNHR-GLITVNEQYQTSHPHIYAAGDCIGAPSLAS  345

Query  486  VAIQAGKLLARRLFGNG---TALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQV  542
             +++ G+L A  ++ +    T+ ++       ++T  E    G +E+         N  V
Sbjct  346  TSMEQGRLAACDMWSDKDQTTSQLESGNYPYGIYTIPEISMVGKTEQQLTKEGA--NYAV  403

Query  543  YHQNFTPL-EWSLSHERPLAKECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKL  601
                F+ L +  +S +     E   KL+ D    + ++G H +G  A E+     VAM +
Sbjct  404  GLAKFSELAKGQMSGD----IEGILKLLFDPVSLQ-LLGVHAIGHGATEIIHIGQVAMAM  458

Query  602  HATYDDFVNTVGIHPTTAE  620
            +     F + V  +PT AE
Sbjct  459  NCKLTYFRDAVFNYPTLAE  477

>PPTG_00938
Length=550

 Score = 121 bits (304),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 146/542 (27%), Positives = 240/542 (44%), Gaps = 78/542 (14%)

Query  133  RTQSAPSTGAPSAANAHVSDTSSSDETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLD  192
            R  +A ST AP A N  ++DT         +DL+VIG G  G  C+ +++K G+ V ++D
Sbjct  19   RAANAFSTEAP-AENRPLTDTLRELRASEHFDLIVIGSGPAGQKCAIDSAKHGKSVAIID  77

Query  193  YVKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSI-IGELLHK--------DAEQFG-----  238
                        LGG CV+ G +P K   ++++ +    HK         +++FG     
Sbjct  78   --------KRDMLGGVCVHTGTVPSKTFREAALHLTGYRHKAFYNGQAGPSKRFGVEDIL  129

Query  239  ---WTVSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKY----ENMLGTFKDAHTLT  291
                 V NA  D T+         H L  +  + L +   ++    +NM+    +    T
Sbjct  130  QRVRKVENAETDITR---------HQL-LRNGVQLINGTARFLPGSKNMVAVLSNESYET  179

Query  292  LTNEAKKKGPTDVTFR-----RAVIAVGGRP--KPLSCPGWEHAISSDDIF--SKAEAPG  342
             T+ AK+    D+  R     + ++ VG RP  +P      E    SD++        P 
Sbjct  180  ATD-AKRHSSADICKRVLTADKFLVCVGTRPARRPDIPFDGETIFDSDELLWGKVKSVPR  238

Query  343  KTLVVGASYVALECAGFLKG-QGFDVTIM-VRSILLRGFDQDIARRIGEYMENESGIAFI  400
            + ++VGA  V +E A  +    G DVT++  R  +L   D+ ++  +  Y   ++G  F+
Sbjct  239  RLIIVGAGVVGMEYASMMTIIPGTDVTVIDGRQEILNMADKQVSEALC-YSMTQTGTRFL  297

Query  401  KESVPTSIEKLPNGQLKVTHTHGEGIY-DTVLNATGRSPDVQMLNLPAAGVTLNPKSGRI  459
                  S+EK P G++ V    G+ +  D +L   GR  +V+ LNL A G++ + K GRI
Sbjct  298  TGETIKSVEKSPKGEVFVHLESGKTVVGDGLLYTVGRQGNVEGLNLEAVGLSPD-KRGRI  356

Query  460  DVTNE-QTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLFG----NGTALMDYTKI--C  512
             V N  QT+ PHIYA GD+I  P L   +++ G+L +  +      N   L D  K+   
Sbjct  357  KVDNNFQTAVPHIYAAGDIIGFPGLASTSMEQGRLASVHMRTSKPLNDLELSDDKKMDDP  416

Query  513  TAVFTPVEYGCC---GLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAK-------  562
              V T +  G     G+     I+  G++  Q+  +   P E  ++    LA+       
Sbjct  417  DRVRTRMRSGEVFPFGIYTVPEISMVGKNEQQLTKEQ-VPYEVGVARYEELARGQMLGGV  475

Query  563  ECYAKLIV--DTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAE  620
              + K+I   DT    ++ G H +G  A E+     V M    T + F N V  +PT AE
Sbjct  476  PGFLKIIFCPDTL---KIFGVHAIGEGATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAE  532

Query  621  IF  622
             +
Sbjct  533  AY  534

>H257_01186
Length=496

 Score = 120 bits (302),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 128/490 (26%), Positives = 220/490 (45%), Gaps = 41/490 (8%)

Query  148  AHVSDTSSSDETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGG  207
            AH+S + S  E    +DL+VIG G  GL C+ E++K+G+ V ++D         +  +GG
Sbjct  18   AHLSTSVSPKE----YDLIVIGSGPSGLQCALESAKMGKSVAIID--------KSEEIGG  65

Query  208  TCVNVGCIPKKLMHQSSIIGELLHKDAEQ----FGWTVSNASFDWTKLVSSVQDYIHGLN  263
             CV+ G IP K   ++     +LH         +G + S      + ++  V   +    
Sbjct  66   VCVHTGTIPSKTFREA-----VLHLSGFNHHGFYGKSYSRERITLSDILHRVNVVVSSEM  120

Query  264  FKYRIDLRDKKVKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRP--KPLS  321
               R  L+   V+       F++A+ +++ N    +       ++ +IA G  P   P+ 
Sbjct  121  DVIRAQLKAAHVQIIPGKARFENANEVSVENGTVHREAMIYRGKKFLIACGTYPAHSPVV  180

Query  322  CPGWEHAISSDDIF--SKAEAPGKTLVVGASYVALECAGFLKGQ-GFDVTIM-VRSILLR  377
                E  + SD I   SK E P   +VVGA  + +E A  L    G  VT++  R  +L 
Sbjct  181  PVDGEVILDSDGILEASKGELPKSWIVVGAGVIGMEYASMLNVLPGVAVTVVDGRPDILT  240

Query  378  GFDQDIARRIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHTHGEGIY-DTVLNATGR  436
              D +I   +   M ++     + E++  S+ ++  G ++V    G+  + + +L   GR
Sbjct  241  FCDDEIVSALKMEMRHKGARFLLGETI-QSVTRVAKG-VRVDFASGKSSFAEALLYCVGR  298

Query  437  SPDVQMLNLPAAGVTLNPKSGRIDVTNE-QTSTPHIYAIGDVIDAPELTPVAIQAGKLLA  495
              +   LNL   G+  N K G + V  + QTS PHIYA GD I AP L   +++ G+L A
Sbjct  299  QANTDALNLEGVGLAKN-KRGLLTVNKQYQTSQPHIYAAGDCIGAPSLASTSLEQGRLAA  357

Query  496  RRLFGNG---TALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEW  552
              ++ +    T+ +D       ++T  E    G +E+  +   GR N  V    ++ L  
Sbjct  358  CDMWHHEDQPTSQLDSGNYPYGIYTIPEISMVGKTEQQ-LTKEGR-NYAVGMAKYSELAK  415

Query  553  SLSHERPLAKECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTV  612
             +       ++   K++ D   Q  V+G H +G  A E+     VAM ++     F + V
Sbjct  416  GMMAG---GQKGALKILFDPDTQS-VLGVHAIGQGATEIIHIGQVAMAMNCKITYFRDAV  471

Query  613  GIHPTTAEIF  622
              +PT AE +
Sbjct  472  FNYPTLAEAY  481

>CCI50816
Length=807

 Score = 119 bits (299),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 132/483 (27%), Positives = 217/483 (45%), Gaps = 45/483 (9%)

Query  163  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  222
            +DL+VIG G     C+ +A+K G+ V ++D  K S VG      G CV+ G IP K   +
Sbjct  30   YDLIVIGSGPSATNCALDAAKRGKHVAIID--KKSSVG------GVCVHTGTIPSKTFRE  81

Query  223  SSI-IGELLHKDAEQFGWTVSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYENML  281
            + + +    H       +++ N + D   ++  V   I       R+  +  +V Y +  
Sbjct  82   AVLHLSGYRHHGFYGKSYSMKNVTID--DILYRVNRVIQSEVDLLRVQFKSARVDYISGH  139

Query  282  GTFKDAHTLTLTNEAKKKGPTDVTFR----RAVIAVGGRP--KPLSCPGWEHAISSDDIF  335
              F+D H +++  EA       +T R    + ++A G RP   P      +    SD I 
Sbjct  140  ARFEDDHQVSII-EADGPAHEKITKRLRASKFLVACGTRPAHNPNIPIDGKVIFDSDQIL  198

Query  336  S--KAEAPGKTLVVGASYVALECAGFLKG-QGFDVTIMV-RSILLRGFDQDIARRIGEYM  391
            S    + P   +VVGA  + +E A  L   +G  VT++  R  +L   D +I   +   M
Sbjct  199  SWNIRQLPRSLIVVGAGVIGMEYASMLNVIRGHSVTVIDGREEILSFCDDEIISTLTHEM  258

Query  392  ENESGIAFIKESVPTSIEKLPNGQLKVTHTHGEGIY-DTVLNATGRSPDVQMLNLPAAGV  450
             N      + E++  S++K   G L V    G+ ++ D +L   GR  +   LNL AAG+
Sbjct  259  RNHGARFLLGETIE-SVDKSSRGVL-VGLKSGKKVHGDALLYVVGRQANTDGLNLEAAGL  316

Query  451  TLNPKSGRIDV-TNEQTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLFGNGTALMDY-  508
            + NP+ G + V T  QT  PHI+A+GD I AP L   +++ G+L +  ++    +  D  
Sbjct  317  SRNPR-GLLSVNTKYQTKKPHIFAVGDCIGAPSLASTSMEQGRLASCYMWNEDESNDDSI  375

Query  509  -TKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAK-----  562
             +++ T  F    YG   + E   I+  G    Q+  Q     E  ++    LAK     
Sbjct  376  PSQLKTGNFP---YGIYTIPE---ISMVGHTEKQLTSQQIN-YEIGVAKYSELAKGQMSG  428

Query  563  ---ECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTA  619
               +   K++ D    K + G H +G  A E+     VA+ + AT   F + V  +PT A
Sbjct  429  ASADGMLKILFDPHSLK-LFGVHAIGEGATEIIHIGQVAIAMGATLTYFRDAVFNYPTLA  487

Query  620  EIF  622
            E +
Sbjct  488  EAY  490

>PYVX_21248
Length=502

 Score = 117 bits (294),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 121/445 (27%), Positives = 198/445 (44%), Gaps = 31/445 (7%)

Query  194  VKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGELLHKDAEQFGWTVSNASFDWTKLVS  253
            +K + V S   LGGTC+NVGCIP K +  S+ +      D  ++G  V     +   ++ 
Sbjct  59   LKTACVESRGKLGGTCLNVGCIPSKALLHSTHLYHSAQHDFAKYGVEVEGVKANLGGMMK  118

Query  254  SVQDYIHGLNFKYRIDLRDKKVKYENMLGTF--KDAHTLTLTNEAKKKGPTDVTFRRAVI  311
            + +  +  L        +  KV Y    G    K+   + L ++   KG   VT +  +I
Sbjct  119  AKEKAVTTLTGGIESLFKKNKVTYIKGHGKIVGKNEVAVALNDD---KGNQTVTAKNIMI  175

Query  312  AVGGRPKPLSCPGWEHA----ISSDDIFSKAEAPGKTLVVGASYVALECAGFLKGQGFDV  367
            A G  P PL     +++    + S    S  + P   +VVGA  + LE     K  G  V
Sbjct  176  ATGSEPAPLPPVPVDNSKFKIVDSTGALSLPKIPEHLVVVGAGVIGLELGSVYKRLGSKV  235

Query  368  TIMVRSILLR---GFDQDIARRIGEYMENESGIAF-IKESVPTSIEKLPNGQLKVTHTHG  423
            T++    L R   G D ++++   + ++ + G+ F     V  S  K  N  L V  + G
Sbjct  236  TVV--EFLDRACPGLDLEVSKEFTKLLKKQ-GLEFQFSTKVTASEVKGDNVTLTVEPSAG  292

Query  424  EGIY----DTVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDVTNE-QTSTPHIYAIGDVI  478
                    DTVL ATGR P  + L L   G+  + K GR++V +  +T  P+IYA GDVI
Sbjct  293  GSAASIECDTVLVATGRRPFTEGLGLEQMGIQTD-KQGRVEVDSHFRTQIPNIYAFGDVI  351

Query  479  DAPELTPVAIQAGKLLARRLFGNGTALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRD  538
                L   A + G   A  + G     ++Y  I   ++T  E    G +EE+      ++
Sbjct  352  KGAMLAHKAEEEGVACAEIISGK-HGHVNYDAIPGVIYTTPEVASVGKTEEEL-----KN  405

Query  539  NIQVYHQNFTPLEWSLSHERPLAK-ECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGV  597
                Y+    P+  + S  R +A+ + + K++ D     R++G H +  NAGE+     +
Sbjct  406  EGVTYNVGKFPM-MANSRARTIAEADGFVKILADKATD-RILGVHIIAGNAGEMVAEGVL  463

Query  598  AMKLHATYDDFVNTVGIHPTTAEIF  622
             ++  A+ +D   T   HPT +E F
Sbjct  464  GLEYGASSEDIARTCHAHPTLSEAF  488

>PHYRA_73883
Length=551

 Score = 116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 134/516 (26%), Positives = 229/516 (44%), Gaps = 59/516 (11%)

Query  150  VSDTSSSDETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTC  209
            ++DT         +DL+VIG G  G  C+ +++K G+ V ++D            LGG C
Sbjct  33   LTDTLRELRASEHFDLIVIGSGPAGQKCAIDSAKHGKSVAIID--------KRDMLGGVC  84

Query  210  VNVGCIPKKLMHQSSI-IGELLHKD--AEQFGWTVSNASFDWTKLVSSVQDYIHGLN---  263
            V+ G +P K   ++++ +    HK     Q G +      D  + V  V+D    +    
Sbjct  85   VHTGTVPSKTFREAALHLTGYRHKAFYNGQAGPSKRFGVEDILQRVRKVEDAETDITRHQ  144

Query  264  -FKYRIDLRDKKVKY----ENMLGTFKDAHTLTLTNEAKKKGPTDVTFR-----RAVIAV  313
              +  + L +   ++    +NM+    +    T T +AK+    D+  R     + ++ V
Sbjct  145  LMRNGVQLINGTARFLPGNKNMVAVLSNESYETAT-DAKRHTSADICKRVLTADKFLVCV  203

Query  314  GGRPK--PLSCPGWEHAISSDDIF--SKAEAPGKTLVVGASYVALECAGFLKG-QGFDVT  368
            G RP   P      E    SD +        P + +VVGA  V +E A  +    G DVT
Sbjct  204  GTRPARHPDIPFDGETIFDSDQLLWGKVKTVPRRLIVVGAGVVGMEYASMMTIIPGTDVT  263

Query  369  IM-VRSILLRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHTHGEGIY  427
            ++  R  +L   D++++  +  Y   ++G  F+ E    S+EK  NG++ V    G+ + 
Sbjct  264  VIDGRKEILNMADKEVSEGLC-YSMAQTGTRFLTEETIKSVEKADNGEIFVHLESGKTVV  322

Query  428  -DTVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDVTNE-QTSTPHIYAIGDVIDAPELTP  485
             D +L   GR  +V+ LNL A G+  + K GRI V N  QT+ PHIYA GD+I  P L  
Sbjct  323  GDGLLYTVGRQGNVEGLNLEAVGLAPD-KRGRIKVDNNFQTAAPHIYAAGDIIGFPGLAS  381

Query  486  VAIQAGKL----------LARRLFGNGTALMDYTKICTAVFTPVEYGCCGLSEEDAIASA  535
             +++ G+L          L  ++  +   + D  ++ T + +  E    G+     I+  
Sbjct  382  TSMEQGRLASVHMRTSKPLNNQVLSDDKKMDDPDRVRTRMRSG-EVFPFGIYTVPEISMV  440

Query  536  GRDNIQVYHQNFTPLEWSLSHERPLAK-------ECYAKLIV--DTTQQKRVVGFHYLGP  586
            G++  Q+  +  TP E  ++    LA+         + K+I   DT    +++G H +G 
Sbjct  441  GKNEQQLTKEQ-TPYEVGMARYEELARGQMLGGVPGFLKIIFCPDTL---KILGVHAIGE  496

Query  587  NAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIF  622
             A E+     V M      + F N V  +PT AE +
Sbjct  497  GATEIIHIGQVVMSTGGNLEYFRNAVFNYPTLAEAY  532

>H310_00561
Length=497

 Score = 115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 126/495 (25%), Positives = 219/495 (44%), Gaps = 42/495 (8%)

Query  143  PSAANAHVSDTSSSDETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGST  202
            P    AH+S     +     +DL+VIG G  GL C+ E++K+G+ V ++D         +
Sbjct  15   PKPRRAHLSTMVPKE-----YDLIVIGSGPSGLQCALESAKMGKSVAIVD--------KS  61

Query  203  WGLGGTCVNVGCIPKKLMHQSSIIGELLHKDAEQ----FGWTVSNASFDWTKLVSSVQDY  258
              +GG CV+ G IP K   ++     +LH         +G + S        ++  V   
Sbjct  62   EEIGGVCVHTGTIPSKTFREA-----VLHLSGFNHHGFYGKSYSRERITLRDILHRVNVV  116

Query  259  IHGLNFKYRIDLRDKKVKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRP-  317
            +       R  L+   V+       F++A+ +++  E      T    ++ +IA G  P 
Sbjct  117  VSSEMDVIRAQLKAAHVQIIPGKARFENANEVSVATEPVGSEATIYRGQKFLIACGTYPA  176

Query  318  -KPLSCPGWEHAISSDDIF--SKAEAPGKTLVVGASYVALECAGFLKG-QGFDVTIM-VR  372
              P+     E  + SD I   SK E P   +VVGA  + +E A  L    G  VT++  R
Sbjct  177  HSPVVPVDGEVILDSDGILDASKGELPRSWIVVGAGVIGMEYASMLNVLPGVSVTVVDGR  236

Query  373  SILLRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHTHGEGIY-DTVL  431
              +L   D +I   +   M ++     + E++  S++++  G ++V    G+  + + +L
Sbjct  237  PDILTFCDDEIVSALKMEMRHKGARFLLGETI-QSVKRVRKG-VRVDFASGKSSFAEALL  294

Query  432  NATGRSPDVQMLNLPAAGVTLNPKSGRIDVTNE-QTSTPHIYAIGDVIDAPELTPVAIQA  490
               GR  +   LNL   G++ N K G + V  + QT+ PHI+A GD I AP L   +++ 
Sbjct  295  YCVGRQANTDTLNLEGVGLSKN-KRGLLSVNEQYQTTQPHIFAAGDCIGAPSLASTSLEQ  353

Query  491  GKLLARRLFGNG---TALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNF  547
            G+L A  ++ +    T+ +D       ++T  E    G +E+  +   GR N  V    +
Sbjct  354  GRLAACAMWRHEDQPTSQLDSGNYPYGIYTIPEISMVGKTEQQ-LTKEGR-NYAVGVAKY  411

Query  548  TPLEWSLSHERPLAKECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDD  607
            + L   +       ++   KL+ D      V+G H +G  A E+     VAM ++     
Sbjct  412  SELAKGMMAG---GQKGALKLLFDPDSHS-VLGVHAIGQGATEIIHIGQVAMAMNCKLTY  467

Query  608  FVNTVGIHPTTAEIF  622
            F + V  +PT AE +
Sbjct  468  FRDAVFNYPTLAEAY  482

>CCA16670
Length=520

 Score = 116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 126/484 (26%), Positives = 220/484 (45%), Gaps = 47/484 (10%)

Query  163  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  222
            +DL+VIG G     C+ +A+K G+ V ++D  K S VG      G CV+ G IP K   +
Sbjct  30   YDLIVIGSGPSASNCALDAAKRGKHVAIID--KKSSVG------GVCVHTGTIPSKTFRE  81

Query  223  S--SIIGELLH----KDAEQFGWTVSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVK  276
            +   + G   H    K       T+ +  +   +++ S  D++       R   +  ++ 
Sbjct  82   AVLHLSGYRHHGFYGKSYSMKHVTIDDILYRVNRVIQSEVDFL-------RTQFKSARID  134

Query  277  YENMLGTFKDAHTLTLTNE---AKKKGPTDVTFRRAVIAVGGRP--KPLSCPGWEHAISS  331
            Y +    F+D H +++      A +K    +   + ++A G RP   P      +    S
Sbjct  135  YISGHARFEDDHQVSIIEADGPAHEKTTKRLRASKFLVACGTRPAHNPNIPIDGKVIFDS  194

Query  332  DDIFS--KAEAPGKTLVVGASYVALECAGFLKG-QGFDVTIM-VRSILLRGFDQDIARRI  387
            D I S    + P   +VVGA  + +E A  L   +G  VT++  R  +L   D +I   +
Sbjct  195  DQILSWNIRQLPRSLIVVGAGVIGMEYASMLNVIRGHSVTVIDGREEILSFCDDEIISTL  254

Query  388  GEYMENESGIAFIKESVPTSIEKLPNGQLKVTHTHGEGIY-DTVLNATGRSPDVQMLNLP  446
               M N  G  F+   +  S+EK   G + V    G+ ++ D +L   GR  +   LNL 
Sbjct  255  THEMRNH-GARFLLGEIIESVEKSSRG-VSVGLKSGKKVHGDALLYVVGRQANTDGLNLE  312

Query  447  AAGVTLNPKSGRIDV-TNEQTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLFGNGTAL  505
            AAG++ NP+ G + V T  QT  PHI+A+GD I AP L   +++ G+L +  ++    A 
Sbjct  313  AAGLSRNPR-GLLSVNTKYQTKKPHIFAVGDCIGAPSLASTSMEQGRLASCYMWNENEAN  371

Query  506  MDY--TKICT-----AVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHER  558
             D   +++ T      ++T  E    G +E++   ++ + N ++    ++  E +     
Sbjct  372  DDSIPSQLTTGNFPYGIYTIPEISMVGKTEKE--LTSLKMNYEIGVAKYS--ELAKGQMS  427

Query  559  PLAKECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTT  618
              + +   K++ D    K + G H +G  A E+     VA+ + AT   F + V  +PT 
Sbjct  428  GASADGMLKILFDPISLK-LYGVHAIGEGATEIIHIGQVAIAMGATLTYFRDAVFNYPTL  486

Query  619  AEIF  622
            AE +
Sbjct  487  AEAY  490

>PYIW_25190
Length=206

 Score = 105 bits (262),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 97/185 (52%), Gaps = 4/185 (2%)

Query  443  LNLPAAGVTLNPKSGRIDVTNEQTSTPHIYAIGDV-IDAPELTPVAIQAGKLLARRLFG-  500
            L L A GV LN     +    E TS   IYAIGD  I   ELTPVAI AG+ LA RLFG 
Sbjct  2    LGLEAVGVKLNDAGFIVVDAQENTSVSGIYAIGDATITGWELTPVAIAAGRRLADRLFGG  61

Query  501  NGTALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPL  560
               AL+ Y +I T VF+    G  G +E  AI   G  N++ Y   F  L  +++   P 
Sbjct  62   EPDALLHYHQIPTVVFSHPPLGTIGYTEPQAIEKFGAANVKSYTSKFVNLLHAMA--DPD  119

Query  561  AKECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAE  620
             K   A  +V   + + VVG H  G  A E+ Q  GVAMK++AT  DF N V IHPT +E
Sbjct  120  HKGKTAMKLVTVGEDEVVVGVHVAGEGADEMIQGFGVAMKMNATKADFDNIVAIHPTASE  179

Query  621  IFTTL  625
               T+
Sbjct  180  ELVTM  184

>PYU1_G005699
Length=550

 Score = 111 bits (278),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 136/544 (25%), Positives = 234/544 (43%), Gaps = 61/544 (11%)

Query  126  TLAFFRARTQSAPSTGAPSAANAHVSDTSS----SD-----ETQYDWDLVVIGGGSGGLA  176
            TLA  R + + A +  A  A ++  + TS     SD     +    +DL+VIG G  G  
Sbjct  4    TLALLRQQQRKALAMTARRALSSSATTTSGGKPLSDMLRELKASEHFDLIVIGSGPAGQK  63

Query  177  CSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGELLHKDAEQ  236
            C+ +++K G+ V ++D             GG CV+ G +P K   ++++        +  
Sbjct  64   CAIDSAKHGKSVAIIDKRDMH--------GGVCVHTGTVPSKTFREATLHLTAYRHRSFY  115

Query  237  FGWTVSNASFDWTKLVSSVQDYIHGLN-------FKYRIDLRDKKVKY-----ENMLGTF  284
             G +     F    ++  V+   H           +  ++L +   ++     +NM+   
Sbjct  116  DGQSSPTKRFGIEDILQRVKKVEHAETDITRHQLLRNGVELINGTARFLPDANKNMIAVL  175

Query  285  KDAHTLTLTNEAKKKGPTDVTFR-----RAVIAVGGRP--KPLSCPGWEHAISSDDIF--  335
             +  + T   +AK+    D+  R     + +IAVG RP  +P      +    SD +   
Sbjct  176  SN-DSYTTATDAKRHASADICKRVLTADKFLIAVGTRPARRPDIPFDGQAVFDSDQLLWG  234

Query  336  SKAEAPGKTLVVGASYVALECAGFLKG-QGFDVTIM-VRSILLRGFDQDIARRIGEYMEN  393
                 P + +VVGA  + +E A  +    G +VTI+  R  +L   D++++  +  Y   
Sbjct  235  GVKTVPKRLIVVGAGVIGMEYASMMSIIPGMEVTIIDGRKEILDMADREVSEALC-YSMR  293

Query  394  ESGIAFIKESVPTSIEKLPNGQLKVTHTHGEGIY-DTVLNATGRSPDVQMLNLPAAGVTL  452
            ++G  F  E    S+EK+ NG++ V    G+ +  D +L   GR  +   LNLPA G+  
Sbjct  294  QTGARFFVEETIKSVEKV-NGEVIVHLNSGKTLVGDGLLYTLGRQGNTDGLNLPAVGLEA  352

Query  453  NPKSGRIDV-TNEQTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLF----GNGTALMD  507
            + K G I V  N QT+ PHIYA GD I  P L   +++ G+L +  +      N T   +
Sbjct  353  D-KRGLIQVDENFQTAVPHIYAAGDCIGFPALASTSMEQGRLASVHMRTEKPTNKTGDSE  411

Query  508  YT--KICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAK---  562
             T  +         +    G+     I+  G++  Q+  +N  P E  L+    LAK   
Sbjct  412  STDPQFMRTRMRSGDVFPFGIYTVPEISMVGKNEQQLTKEN-VPYEVGLARYEELAKGQM  470

Query  563  ----ECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTT  618
                  + K+I    +  +++G H +G  A E+     V M    T + F N V  +PT 
Sbjct  471  LGGVPGFLKIIF-CPKTLQLLGVHAIGEGATEIIHIGQVVMSTGGTIEYFRNAVFNYPTL  529

Query  619  AEIF  622
            AE +
Sbjct  530  AEAY  533

>PYVX_20512
Length=528

 Score = 111 bits (278),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 128/493 (26%), Positives = 209/493 (42%), Gaps = 54/493 (11%)

Query  162  DWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMH  221
            D+DLVVIG G     C+ E++K G++V ++D  K + VG      G CV+ G IP K   
Sbjct  37   DYDLVVIGSGPSATQCAMESAKQGKRVAIVD--KRTRVG------GVCVHTGTIPSKTFR  88

Query  222  QSSIIGELLHKDAEQ----FGWTVSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKY  277
            ++     +LH    +    +G + S  +     ++  VQ  +       +  L+  +V Y
Sbjct  89   EA-----VLHLSGYRHHGFYGKSYSMKNITIDDILYRVQRVVASEVDVIKAQLKAARVDY  143

Query  278  ENMLGTFKDAHTLTLTNEAKKKGP--TDVTFR------------RAVIAVGGRP--KPLS  321
                 +F+  H L+++ ++    P   DV  R            + +IA G RP   PL 
Sbjct  144  IAGTASFESPHELSISMDSTDSDPDLADVLDRADGLAPSRLRADKFLIACGTRPAHNPLV  203

Query  322  CPGWEHAISSDDIFSKA--EAPGKTLVVGASYVALECAGFLKG-QGFDVTIM-VRSILLR  377
                +    SD I S    + P   +VVGA  + +E A  +    G  VT++  R  +L 
Sbjct  204  PVDGKVVFDSDQILSGQIHQLPRSLIVVGAGVIGIEYASMVNVVPGHSVTVVDGRPDILS  263

Query  378  GFDQDIARRIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHTHGE-GIYDTVLNATGR  436
              D +I   +   M ++     + E++  SIEK   G +KV    G+    D +L   GR
Sbjct  264  FCDTEIISNLMYEMRSKGARFLLGETIK-SIEKSERG-VKVFFNSGKVATADALLYTVGR  321

Query  437  SPDVQMLNLPAAGVTLNPKSGRIDVTNEQTSTPHIYAIGDVIDAPELTPVAIQAGKLLAR  496
                  LNL A G++ NP+       N QT   HIYA GD I AP L   +++ G+L A 
Sbjct  322  QASTDGLNLEAVGLSRNPRGLLTVNKNYQTDQAHIYAAGDCIGAPALASTSMEQGRLAAC  381

Query  497  RLFGNGTALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSH  556
             ++ +   L   +++    +    YG   + E   I+  G+   Q+  +     E  ++ 
Sbjct  382  HMWDDQAQLQSTSQLDNGNY---PYGIYTIPE---ISMVGKTEQQLTKEGVN-YEVGIAK  434

Query  557  ERPLAKECYAKLIVDTTQQ-------KRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFV  609
               LAK      I     +         + G H +G  A E+     VA+ +  +   F 
Sbjct  435  YSELAKGQMTGAIAGGMLKILFCPDSLELFGVHAIGEGATEIIHIGQVAIAMGCSLTYFR  494

Query  610  NTVGIHPTTAEIF  622
            N V  +PT AE +
Sbjct  495  NAVFNYPTLAEAY  507

>PYU1_G011605
Length=524

 Score = 110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 124/490 (25%), Positives = 214/490 (44%), Gaps = 53/490 (11%)

Query  162  DWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMH  221
            D+DLVVIG G     C+ E++K G++V ++D            +GG CV+ G IP K   
Sbjct  40   DYDLVVIGSGPSATQCAIESAKQGKRVAIVD--------KKTSVGGVCVHTGTIPSKTFR  91

Query  222  QSSIIGELLHKDAEQ----FGWTVSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKY  277
            ++     +LH    +    +G + S  +     ++  V+  ++      +  L+  +V+Y
Sbjct  92   EA-----VLHLSGYRHHGFYGKSYSMKTVTIDDILYRVKRVVNSEVDVIKAQLKAARVEY  146

Query  278  ENMLGTFKDAHTLTL-----TNEAKKKGPTDVTFRRA-----VIAVGGRP--KPLSCPGW  325
                  F++ H +++     T E+++ G    T  R      +IA G RP   P      
Sbjct  147  IPGFARFENDHEISIVRDPETGESQEAGEITNTVSRLRADKFLIACGTRPAHNPNVPIDG  206

Query  326  EHAISSDDIFSK--AEAPGKTLVVGASYVALECAGFLKG-QGFDVTIM-VRSILLRGFDQ  381
            +    SD I S    + P   +VVGA  + +E A  L    G  VT++  R  +L   D 
Sbjct  207  KVIFDSDQILSGDIRDLPRSLIVVGAGVIGIEYASMLNVIPGHSVTVIDARPEILSFCDN  266

Query  382  DIARRIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHTHGEGIYDTVLNATGRSPDVQ  441
            +I   +   M ++     + E++   +EK  NG     ++      D +L   GR     
Sbjct  267  EIISNLTYEMRSKGARFLLGETI-NRVEKTGNGVTVYLNSGKVTSADAMLYTVGRQASTD  325

Query  442  MLNLPAAGVTLNPKSGRIDVTNE-QTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLFG  500
             LNL A  ++ NP+ G ++V    QT  PHIYA+GD I AP L   +++ G+L A  ++ 
Sbjct  326  GLNLEAVNLSRNPR-GLLNVNKSYQTGQPHIYAVGDCIGAPSLASTSMEQGRLAACHMWD  384

Query  501  NGTALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPL  560
                L+  +++    +    YG   + E   I+  G+   Q+  +     E  ++    L
Sbjct  385  QEEQLVT-SQLENGNY---PYGIYTIPE---ISMVGKTEQQLTKEGVN-FEIGIAKYSEL  436

Query  561  AKECYA--------KLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTV  612
            AK   +        K++ D T  K + G H +G  A E+     VA+ +  +   F + V
Sbjct  437  AKGQMSGSTAGGMLKILFDPTTLK-LFGVHAIGEGATEIIHIGQVAIAMGCSVTYFRDAV  495

Query  613  GIHPTTAEIF  622
              +PT AE +
Sbjct  496  FNYPTLAEAY  505

>PHYRA_47253
Length=481

 Score = 109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 129/492 (26%), Positives = 216/492 (44%), Gaps = 56/492 (11%)

Query  163  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  222
            +DLVVIG G     C+ E++K G++V ++D            LGG CV+ G IP K   +
Sbjct  1    YDLVVIGSGPSATQCALESAKQGKRVAIVD--------KRTRLGGVCVHTGTIPSKTFRE  52

Query  223  SSIIGELLHKDAEQ----FGWTVSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYE  278
            +     +LH    +    +G + S  +     ++  VQ  +       R  L+  +V   
Sbjct  53   A-----VLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDVV  107

Query  279  NMLGTFKDAHTLTLT---NEAKKKGPT---------DVTFRRAVIAVGGRP--KPLSCPG  324
                 F+  H +++    ++ +KKG +          V   + +IA G RP   PL    
Sbjct  108  PGFARFESEHEISIVRDDDDDQKKGASASSTLDSLSRVKADKFLIACGTRPAHNPLVPID  167

Query  325  WEHAISSDDIFSKA--EAPGKTLVVGASYVALECAGFLKG-QGFDVTIMV-RSILLRGFD  380
             +  I SD I S+   + P   +VVGA  + +E A  +    G  VT++  R  +L   D
Sbjct  168  GQVVIDSDQILSRDMHQLPRSLIVVGAGVIGMEYASMVNVVPGHSVTVVDGRPDILSFCD  227

Query  381  QDIARRIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHTHGEGI-YDTVLNATGRSPD  439
            ++I   +   M++ +G  F+       +E   N ++KV    G+ +  D +L   GR   
Sbjct  228  REIISNLTYEMQS-NGARFLLGETIKKVETADN-RVKVFFDSGKVLSADALLYTVGRQAS  285

Query  440  VQMLNLPAAGVTLNPKSGRIDVT-NEQTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRL  498
               LNL A G++ N + G I+V  N QT  PHIYA GD I AP L   +++ G+L +  +
Sbjct  286  TDGLNLEAVGLSRNHR-GLINVNKNYQTDQPHIYAAGDCIGAPALASTSMEQGRLASCHM  344

Query  499  FGNGTALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHER  558
            +     L   +++ +  +    YG   + E   I+  G+   Q+  ++    E  ++   
Sbjct  345  WKPDEELAVTSQLESGNY---PYGIYTIPE---ISMVGQTEQQLT-KDCVNYEIGVAKYS  397

Query  559  PLAKECYA--------KLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVN  610
             LAK            K++ D    K V G H +G  A E+     VAM +  +   F +
Sbjct  398  ELAKGQMMGAMAGGTLKILFDPDTLK-VFGVHAIGEGATEIIHIGQVAMAMDCSLTYFRD  456

Query  611  TVGIHPTTAEIF  622
             V  +PT AE +
Sbjct  457  AVFNYPTLAEAY  468

>PHALS_12028
Length=579

 Score = 110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 134/534 (25%), Positives = 236/534 (44%), Gaps = 63/534 (12%)

Query  150  VSDTSSSDETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTC  209
            ++DT S       +DL+VIG G  G  C+ +++K G+ V ++D            LGG C
Sbjct  23   LTDTLSKLRASEHFDLIVIGSGPAGQKCAIDSAKHGKSVAIIDKRDM--------LGGVC  74

Query  210  VNVGCIPKKLMHQSSI-IGELLHKD--------AEQFGWTVSNASFDWTKLVSSVQDYIH  260
            V+ G IP K   ++++ +    HK         +++FG  V +      K+ S+  D   
Sbjct  75   VHTGTIPSKTFREAALHLTGYRHKAFYNGQGGPSKRFG--VEDILQRVKKVESAETDITR  132

Query  261  GLNFKYRIDLRDKKVKY----ENMLGTFKDAHTLTLTNEAKKKGPTDVTFR-----RAVI  311
                +  + L +   ++    ++M+    +    T T+ A++    D+  R     + ++
Sbjct  133  HQLLRNGVQLINGTARFLPGSKHMIAVLSNESYETATD-AQRHSSADICKRVLTADKFLL  191

Query  312  AVGGRP-KPLSCP-GWEHAISSDDIF--SKAEAPGKTLVVGASYVALECAGFLKG-QGFD  366
             VG RP +    P   E    SD +        P + +VVGA  + +E A  +    G D
Sbjct  192  CVGTRPARRADIPFDGETIFDSDQLLWGKVKSVPRRLIVVGAGVIGMEYASMMTIIPGTD  251

Query  367  VTIM-VRSILLRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHTHGEG  425
            VT++  R  +L   D +++  +   M  ++G  F+   V  S+EK   G++ V    G+ 
Sbjct  252  VTVIDARKEILNMADNEVSEALCFSMA-QTGTRFLTGEVIKSVEKSAMGEVFVHLESGKT  310

Query  426  IY-DTVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDVTNE-QTSTPHIYAIGDVIDAPEL  483
            +  D +L   GR  +V+ LNL A G+  + K G+I V N  QT+ PHIYA GD+I  P L
Sbjct  311  VVGDGLLYTVGRQGNVEGLNLEAVGIVPD-KRGQIKVDNNFQTAVPHIYAAGDIIGFPGL  369

Query  484  TPVAIQAGKL----------LARRLFGNGTALMDYTKICTAVFTPVEYGCCGLSEEDAIA  533
               +++ G+L          L  +   +   + D  ++ T + +  E    G+     I+
Sbjct  370  ASTSMEQGRLASVHMRTSQPLNDQKISDDKKMDDPDRVRTRMRSG-EVFPFGIYTVPEIS  428

Query  534  SAGRDNIQVYHQNFTPLEWSLSHERPLAK-------ECYAKLIV--DTTQQKRVVGFHYL  584
              G++  Q+  +   P E  ++    LAK         + K+I   DT    +V+G H +
Sbjct  429  MVGKNEQQLTKEG-VPYEVGVARYEELAKGQMLGGVPGFLKIIFCPDTL---KVLGVHAI  484

Query  585  GPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIFTTLEITKESGEDASAS  638
            G  A E+     V M    T + F N V  +PT AE +    +     E++ ++
Sbjct  485  GEGATEIIHIGQVLMSTDGTLEYFRNAVFNYPTLAEAYRVAALNGLRNENSKST  538

>PYIR_14132
Length=513

 Score = 108 bits (270),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 128/499 (26%), Positives = 212/499 (42%), Gaps = 51/499 (10%)

Query  163  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  222
            +DL+VIG G  G  C+ + +K G+ V V+D            LGG C++ G +P K   +
Sbjct  11   FDLIVIGSGPAGQKCAVDHAKHGKSVAVID--------KRDMLGGVCIHTGTVPSKTFRE  62

Query  223  SSIIGELLHKDAEQFGWTVSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYENMLG  282
            +++        +   G +     F    ++  V+   H      R  L    ++  N   
Sbjct  63   ATLHLTAYRHRSFYDGQSNPTKRFGIEDILQRVKKVEHAETDITRHQLLRNNIELINGTA  122

Query  283  TF-KDA----------HTLTLTNEAKKKGPTDVTFR-----RAVIAVGGRP--KPLSCPG  324
             F  DA           + T   +AK+    D+  R     + +IAVG RP  +P     
Sbjct  123  RFLPDAGKKMVAVLSNDSYTTATDAKRHSSADICKRVLTADKFLIAVGTRPARRPDIPFD  182

Query  325  WEHAISSDDIF--SKAEAPGKTLVVGASYVALECAGFLKG-QGFDVTIM-VRSILLRGFD  380
             +    SD +        P + +VVGA  + +E A  +    G +VTI+  R  +L   D
Sbjct  183  GQTIFDSDQLLWGGVKSVPKRLIVVGAGVIGMEYASMMSIIPGMEVTIIDGRKEILDMAD  242

Query  381  QDIARRIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHTHGEGIY-DTVLNATGRSPD  439
            ++++  +  Y   ++G  F  E    S+EK  NG++ V    G+ +  D +L   GR  +
Sbjct  243  REVSEALC-YSMRQTGARFFVEETIKSVEKADNGEVIVHLNSGKTLVGDGLLYTLGRQGN  301

Query  440  VQMLNLPAAGVTLNPKSGRIDVTNE-QTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRL  498
             + LNL A G+  + K G I V ++ QT  PHIYA GD I  P L   +++ G+L +  +
Sbjct  302  TEGLNLAAVGLEAD-KRGLIQVDDDFQTDVPHIYAAGDCIGFPALASTSMEQGRLASVHM  360

Query  499  FGN------GTALMDYT--KICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPL  550
              +      G +  + T  +         E    G+     I+  G++  Q+  QN  P 
Sbjct  361  RTSKPTNKKGESETESTDPQYMRTRMRSGEVFPFGIYTVPEISMVGKNEQQLTSQNI-PY  419

Query  551  EWSLSHERPLAK-------ECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHA  603
            E  ++    LAK         + K+I    +  +V+G H +G  A E+     V M    
Sbjct  420  EVGVARYEELAKGQMLGGVPGFLKIIF-CPKTLQVLGVHAIGEGATEIIHIGQVVMSTGG  478

Query  604  TYDDFVNTVGIHPTTAEIF  622
            T + F N V  +PT AE +
Sbjct  479  TIEYFRNAVFNYPTLAEAY  497

>PHYRA_72215
Length=499

 Score = 107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 136/505 (27%), Positives = 225/505 (45%), Gaps = 42/505 (8%)

Query  132  ARTQSAPSTGAPSAANAHVSDTSSSDETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVL  191
            +R  SA  + +P  A A  S +S       D+D+VVIGGG GG   + +A++LG      
Sbjct  9    SRRSSALRSASPLTARAFSSASS-------DYDVVVIGGGPGGYVAAIKAAQLG------  55

Query  192  DYVKPSPVGSTWGLGGTCVNVGCIPKK-LMHQSSIIGELLHKDAEQFGWTVSNASFDWTK  250
               K + V S   LGGTC+NVGCIP K L+H + ++    H D + +G      + ++ +
Sbjct  56   --FKTACVESRGKLGGTCLNVGCIPSKALLHSTHLLHTAQH-DFKSYGIDAPGVTANFPQ  112

Query  251  LVSSVQDYIHGLNFKYRIDLRDKKVKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAV  310
            ++ + +  +  L        +  KV Y    G       +++      KG   V  +  +
Sbjct  113  MMKAKEKAVTTLTGGIESLFKKNKVTYIKGYGKVSAQGEVSVALN-DNKGNETVKAKNII  171

Query  311  IAVGGRPKPLSCPGWEHA----ISSDDIFSKAEAPGKTLVVGASYVALECAGFLKGQGFD  366
            IA G    PL     ++A    I S    +    P   +VVGA  + LE     K  G  
Sbjct  172  IATGSEVTPLPPVPVDNAAGKIIDSTGALALTRVPEHLVVVGAGVIGLELGSVYKRLGSK  231

Query  367  VTIM-VRSILLRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHTHGEG  425
            VT++  +     G D++  +   + ++ + G+ F K     +  ++    +K+T    +G
Sbjct  232  VTVVEFQDAACPGMDKEAVKEFTKLLKKQ-GLDF-KFGTKVTASEVNGDVVKLTTEAAKG  289

Query  426  ------IYDTVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDVTNE-QTSTPHIYAIGDVI  478
                    DTVL ATGR      L L   G+  + K GRI+V +  +T  P I+AIGDVI
Sbjct  290  GNAATIECDTVLVATGRRAFTAGLGLEQMGIQTD-KLGRIEVDDAFRTQVPGIFAIGDVI  348

Query  479  DAPELTPVAIQAGKLLARRLFGNGTALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRD  538
                L   A + G      + G     ++Y  I   ++T  E+   G +EE+  A     
Sbjct  349  KGAMLAHKAEEEGIACVENIAGK-HGHVNYGAIPGVIYTFPEFASVGKTEEELKAEGIEY  407

Query  539  NIQVYHQNFTPLEWSLSHERPLAK-ECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGV  597
            N+  +     P+  + S  R +A+ +   K++ D    K ++G H +  NAGE+     +
Sbjct  408  NVGKF-----PM-MANSRARTVAEADGLVKVLADKKTDK-MLGVHIIASNAGEMISEGVI  460

Query  598  AMKLHATYDDFVNTVGIHPTTAEIF  622
            A++  A+ +D   T   HPT +E F
Sbjct  461  ALEYGASSEDIARTCHAHPTLSEAF  485

>PYIW_19795
Length=519

 Score = 107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 121/483 (25%), Positives = 202/483 (42%), Gaps = 42/483 (9%)

Query  163  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  222
            +DLVVIG G     C+ E++K G++V V+D  K + VG      G CV+ G IP K   +
Sbjct  37   YDLVVIGSGPSATQCAIESAKKGKRVAVVD--KKTFVG------GVCVHTGTIPSKTFRE  88

Query  223  SSIIGELLHKDAEQ----FGWTVSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYE  278
            +     +LH    +    +G + S  +     ++  V+  ++      +  L+  +V+Y 
Sbjct  89   A-----VLHLSGYRHHGFYGKSYSMKTVTIDDILYRVKRVVNSEVDVIKAQLKAARVEYI  143

Query  279  NMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAV---------IAVGGRP--KPLSCPGWEH  327
              L  F+  H +++  +A     +D      V         IA G RP   PL     + 
Sbjct  144  PGLARFEGDHEISIVRDAADAEASDGEIANTVSRLHADKFLIACGTRPAHNPLVPIDGKV  203

Query  328  AISSDDIFSK--AEAPGKTLVVGASYVALECAGFLKG-QGFDVTIM-VRSILLRGFDQDI  383
               SD I S    E P   +VVGA  + +E A  L    G  VT++  R  +L   D +I
Sbjct  204  IFDSDQILSGDIRELPRSLIVVGAGVIGMEYASMLNVIPGHSVTVVDGRPEILSFCDNEI  263

Query  384  ARRIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHTHGEGIYDTVLNATGRSPDVQML  443
               +   M ++     + E++   +EK  +G     ++      D +L   GR      L
Sbjct  264  ISNLTYEMRSKGARFLLGETIK-QVEKTEDGVTVHFNSGKTATADALLYTVGRQASTDGL  322

Query  444  NLPAAGVTLNPKSGRIDVTNEQTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLFGNG-  502
            NL A  +  NP+      T+ QT+  HIYA GD I AP L   +++ G+L A  ++    
Sbjct  323  NLEAVNLARNPRGLLTVNTSYQTNQSHIYAAGDCIGAPSLASTSMEQGRLAACHMWDQEE  382

Query  503  ---TALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERP  559
               T+ ++       ++T  E    G +E+          I +   +    E +      
Sbjct  383  QLVTSQLENGNYPYGIYTIPEISMVGKTEQQLTKEGANYEIGIAKYS----ELAKGQMSG  438

Query  560  LAKECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTA  619
                   K++ D T  K ++G H +G  A E+     VAM +  +   F + V  +PT A
Sbjct  439  STAGGMLKILFDPTTLK-LLGVHAIGEGATEIIHIGQVAMAMGCSVTYFRDAVFNYPTLA  497

Query  620  EIF  622
            E +
Sbjct  498  EAY  500

>PYAR_16840
Length=536

 Score = 107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 129/513 (25%), Positives = 216/513 (42%), Gaps = 65/513 (13%)

Query  153  TSSSDETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNV  212
            TSS       +DLVVIG G     C+ E+++ G++V V+D        +  G+GG CV+ 
Sbjct  27   TSSLKRHVAAYDLVVIGSGPSATQCAVESARHGKRVAVVD--------TRGGVGGVCVHT  78

Query  213  GCIPKKLMHQSSIIGELLHKDAEQ----FGWTVSNASFDWTKLVSSVQDYIHGLNFKYRI  268
            G IP K   ++     +LH    +    +G + S  +     ++  V+  +       + 
Sbjct  79   GTIPSKTFREA-----VLHLSGYRHHGFYGKSYSMKTVTIDDILYRVKRVVDSEVDVIKA  133

Query  269  DLRDKKVKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRA-----VIAVGGRP--KPLS  321
             L+  ++ Y   L  F++ H +++ ++    G    +  R      +IA G RP   PL 
Sbjct  134  QLKAARIDYLPGLARFENEHEISIQSDITAGGQDASSVSRVQADKFLIACGTRPAHNPLV  193

Query  322  CPGWEHAISSDDIFSKA--EAPGKTLVVGASYVALECAGFLKGQ-GFDVTIM-----VRS  373
                +  + SD I S A  E P   +VVGA  + +E A  L    G  VT++     VR+
Sbjct  194  PVDGKVILDSDQILSGALRELPRSLIVVGAGVIGMEYASMLNVVPGHSVTVIDGRNDVRN  253

Query  374  IL------------------LRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKLPNGQ  415
            +L                  +  F  D    + +Y     G  F+       +EK   G 
Sbjct  254  LLTSRDMSLRPQGICPFLWQILSFCDDEIVSMLKYEMRVKGARFLLGETIEKVEKTATG-  312

Query  416  LKVTHTHGEGIY-DTVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDVTNE-QTSTPHIYA  473
            +KV  T G+    D +L   GR      LNL A G+  N K G + V    QT  PHIYA
Sbjct  313  VKVFLTSGKVTSGDALLYTVGRQASTDGLNLEAVGLGRN-KRGLLTVNKAYQTEKPHIYA  371

Query  474  IGDVIDAPELTPVAIQAGKLLARRLFGNG---TALMDYTKICTAVFTPVEYGCCGLSEED  530
            +GD I AP L   +++ G+L A  ++      T+ ++       ++T  E    G +E+ 
Sbjct  372  VGDCIGAPSLASTSMEQGRLAACHMWEKRELVTSQLENGNYPYGIYTIPEISMVGKTEQQ  431

Query  531  AIASAGRDNIQVYHQNFTPLEWSLSHERPLAKECYAKL-IVDTTQQKRVVGFHYLGPNAG  589
              +   + N ++    ++ L      +  ++   +  L I+      RV G H +G  A 
Sbjct  432  LTSE--KVNYEIGLAKYSELA-----KGQMSGGAFGMLKILFDPDTLRVHGVHAIGEGAT  484

Query  590  EVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIF  622
            E+     VA+ +  +   F + V  +PT AE +
Sbjct  485  EIIHIGQVAIAMGCSLTYFRDAVFNYPTLAEAY  517

>PHYCA_504445
Length=548

 Score = 106 bits (265),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 133/528 (25%), Positives = 223/528 (42%), Gaps = 56/528 (11%)

Query  136  SAPSTGAPSAANAHVSDTSSSDETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVK  195
            +A ST AP A N  ++D          +DL+VIG G  G  C+ +++K G+ V ++D   
Sbjct  20   AAFSTEAP-AENKPLTDALRELRASEHFDLIVIGSGPAGQKCAIDSAKSGKSVAIID---  75

Query  196  PSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGELLHKDAEQFGWTVSNASFDWTKLVSSV  255
                     +GG CV+ G +P K   ++++        A   G    +  F    ++  V
Sbjct  76   -----KRDMMGGVCVHTGTVPSKTFREAALHLTGYRHKAFYNGHGGPSKRFGVEDILQRV  130

Query  256  QDYIHGLNFKYRIDLRDKKVKYENMLGTF---KDAHTLTLTNE-------AKKKGPTDVT  305
            +          R  L    V+  N    F    +     L+NE       A++    D+ 
Sbjct  131  RKVEDAETDITRHQLMRNGVQLINGTARFLPGNNHMVAVLSNESYETATDAQRHSSADIC  190

Query  306  FR-----RAVIAVGGRP--KPLSCPGWEHAISSDDIF--SKAEAPGKTLVVGASYVALEC  356
             R     + ++ VG RP  +P      E    SD +        P + ++VGA  V +E 
Sbjct  191  KRVLTADKFLVCVGTRPARRPDIPFDGETIFDSDQLLWGKVKTVPRRLIIVGAGVVGMEY  250

Query  357  AGFLKG-QGFDVTIM-VRSILLRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKLPNG  414
            A  +    G DVT++  R  +L   D++++  +  Y   ++G  F+      S+EK   G
Sbjct  251  ASMMTIIPGTDVTVIDGRQEILNMADKEVSEALC-YSMAQTGTRFLTGETIKSVEKTAKG  309

Query  415  QLKVTHTHGEGIY-DTVLNATGRSPDVQMLNLPAAGVTLNP-KSGRIDVTNE-QTSTPHI  471
            ++ V    G+ +  D +L   GR  +V+ LNL A G  L P K GRI V N  QT+ PHI
Sbjct  310  EVFVHLESGKTVVGDGLLYTVGRQGNVEGLNLEAVG--LEPDKRGRIKVDNNFQTAVPHI  367

Query  472  YAIGDVIDAPELTPVAIQAGKL----------LARRLFGNGTALMDYTKICTAVFTPVEY  521
            YA GD+I  P L   +++ G+L          L  +   +   + D  ++ T + +  E 
Sbjct  368  YAAGDIIGFPGLASTSMEQGRLASVHMRTSKTLNTKELSDDKKMDDPDRVRTRMRSG-EV  426

Query  522  GCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAK-------ECYAKLIVDTTQ  574
               G+     I+  G++  Q+  +   P E   +    LA+         + K+I    +
Sbjct  427  FPFGIYTVPEISMVGKNEQQLTKEQ-VPYEVGKARYEELARGQMLGGVPGFLKIIF-CPE  484

Query  575  QKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIF  622
              +++G H +G  A E+     V M      + F N V  +PT AE +
Sbjct  485  TLKILGVHAIGEGATEIIHIGQVVMSTGGDLEYFRNAVFNYPTLAEAY  532

>PPTG_09121
Length=520

 Score = 106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 136/538 (25%), Positives = 225/538 (42%), Gaps = 81/538 (15%)

Query  127  LAFFRARTQSAP-------STGAPSAANAHVSDTSSSDETQYDWDLVVIGGGSGGLACSK  179
            + F  A T+SAP       ST  P  A                +DLVVIG G     C+ 
Sbjct  4    VGFLTAATRSAPLLRGRLFSTIKPQVAA---------------YDLVVIGSGPSATQCAL  48

Query  180  EASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGELLHKDAEQ---  236
            E++K G++V ++D            LGG CV+ G IP K   ++     +LH    +   
Sbjct  49   ESAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFREA-----VLHLSGYRHHG  95

Query  237  -FGWTVSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYENMLGTFKDAHTLTLT--  293
             +G + S  +     ++  VQ  +       R  L+  +V        F++ H +++   
Sbjct  96   FYGKSYSMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDVVPGFARFENEHEISIVRD  155

Query  294  -NEAKKKGP------------TDVTFRRAVIAVGGRP--KPLSCPGWEHAISSDDIFSKA  338
             N+ KKK              + +   + +IA G RP   PL     +  I SD I S+ 
Sbjct  156  DNDQKKKNGAVSGSSSNLDSLSRIRADKFLIACGTRPAHNPLIPIDGKVVIDSDQILSRD  215

Query  339  --EAPGKTLVVGASYVALECAGFLKG-QGFDVTIMV-RSILLRGFDQDIARRIGEYMENE  394
              + P   +V+GA  + +E A  +    G  VT++  R  +L   D +I   +   M++ 
Sbjct  216  MHQLPRSLIVLGAGVIGMEYASMVNVVPGHTVTVVDGRPDILSFCDSEIISNLTYEMQSN  275

Query  395  SGIAFIKESVPTSIEKLPNGQLKVTHTHGEGI-YDTVLNATGRSPDVQMLNLPAAGVTLN  453
                 + E+V     +  + ++KV    G+ +  D +L   GR      LNL A G++ N
Sbjct  276  GARFLLGETVKKV--ETTDKRVKVFFNSGKVLSADALLYTVGRQAATDGLNLEAVGLSRN  333

Query  454  PKSGRIDVT-NEQTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLFGNGTALMDYTKIC  512
             + G I+V  N QT  PHIYA GD I AP L   +++ G+L +  ++     L   +++ 
Sbjct  334  HR-GLINVNKNYQTDQPHIYAAGDCIGAPALASTSMEQGRLASCHMWNPDEELAATSQLE  392

Query  513  TAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAKECYA------  566
               +    YG   + E   I+  G+   Q+  ++    E  ++    LAK          
Sbjct  393  NGNY---PYGIYTIPE---ISMVGQTEQQLT-KDCVNYEIGIAKYSELAKGQMMGAMAGG  445

Query  567  --KLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIF  622
              K++ D    K V G H +G  A E+     VAM +  +   F + V  +PT AE +
Sbjct  446  TLKILFDPDTLK-VFGVHAIGEGATEIIHIGQVAMAMDCSLTYFRDAVFNYPTLAEAY  502

>PHALS_10055
Length=516

 Score = 106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 128/488 (26%), Positives = 215/488 (44%), Gaps = 47/488 (10%)

Query  162  DWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMH  221
            ++DL+VIG G     C+ E++K G++V ++D            LGG CV+ G IP K   
Sbjct  31   NYDLLVIGSGPSATQCAIESAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFR  82

Query  222  QSSI-IGELLH-----KDAEQFGWTVSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKV  275
            ++ + +    H     K       T+ +  +   ++VSS +D +       R+D+     
Sbjct  83   EAVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDVIPGFA  142

Query  276  KYENM--LGTFKDAHTLTLTNEAKKKGPTDVTFRRA---VIAVGGRP--KPLSCPGWEHA  328
            ++EN   +   +D  T T   E        ++  +A   +IA G RP   PL     +  
Sbjct  143  RFENEHEISILRDVDTQT-KKEISASSVDSLSRAKADKFLIACGTRPAHNPLIPIDGKVV  201

Query  329  ISSDDIFSKAE--APGKTLVVGASYVALECAGFLKG-QGFDVTIM-VRSILLRGFDQDIA  384
            I SD I S+     P   +V+GA  + +E A  +    G  VT++  R  +L   D +I 
Sbjct  202  IDSDQILSRDMHLLPRSLIVMGAGVIGMEYASMVNVVPGHSVTVVDSRPDILPFCDLEII  261

Query  385  RRIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHTHGEGI-YDTVLNATGRSPDVQML  443
              +   M++      + E+V   +E   N Q+KV    G+ +  D +L   GR      L
Sbjct  262  SNLTYEMQSNGARFLLGETVK-KVETTKN-QVKVFFNSGKVLSADALLYTVGRQAATDGL  319

Query  444  NLPAAGVTLNPKSGRIDVT-NEQTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLFGNG  502
            NL A G++ N + G I+V  N QT  PHIYA GD I AP L   +++ G+L +  ++   
Sbjct  320  NLEAVGLSRNHR-GLINVNKNYQTDRPHIYAAGDCIGAPALASTSMEQGRLASCHMWKPN  378

Query  503  TALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAK  562
              L   +++ +  +    YG   + E   I+  G+   Q+  +N    E  ++    LAK
Sbjct  379  EELAATSQLESGNY---PYGIYTIPE---ISMVGQTEQQLT-KNCINYEIGIAKYSELAK  431

Query  563  ECYA--------KLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGI  614
                        K++ D  +   ++G H +G  A E      VAM +  +   F + V  
Sbjct  432  GQMMGAMAGGTLKILFD-PETLSLLGVHAIGEGATETIHIGQVAMAMGCSLTYFRDAVFN  490

Query  615  HPTTAEIF  622
            +PT AE +
Sbjct  491  YPTLAEAY  498

>PYAR_20075
Length=469

 Score = 105 bits (261),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 114/440 (26%), Positives = 180/440 (41%), Gaps = 49/440 (11%)

Query  194  VKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGELLHKDAEQFGWTVSNASFDWTKLVS  253
            +K + + S   LGGTC+NVGCIP K +  S+ +      D +++G  VS+   D+  ++ 
Sbjct  54   LKTACIESRGSLGGTCLNVGCIPSKALLHSTHLFHTAQHDFKKYGIEVSDVQMDFGGMMK  113

Query  254  SVQDYIHGLNFKYRIDLRDKKVKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAV  313
            S +  +  L        +  KV Y    G    A+ + +                     
Sbjct  114  SKEKAVKTLTAGIESLFKKNKVTYIKGFGKIVAANEVAVALNDNN---------------  158

Query  314  GGRPKPLSCPGWEHAISSDDIFSKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIM-VR  372
                      G E  + S    +  +AP   +V+G   + LE     K  G  VT++   
Sbjct  159  ----------GNETIVDSTGALALKKAPEHLVVIGGGVIGLELGSVYKRLGSKVTVVEYA  208

Query  373  SILLRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHT-----HGEGI-  426
              +  G D ++ +   + ++ +      K  V  S     NG  KVT T      GE   
Sbjct  209  DRVCPGLDLELGKEFAKLLKKQGLDLQFKTKVTAS---QVNGD-KVTLTVEPAAGGEATT  264

Query  427  --YDTVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDVTNE-QTSTPHIYAIGDVIDAPEL  483
               DTVL ATGR P    L L   G+  + K GRI V    +T  P IYAIGDVI  P L
Sbjct  265  IEADTVLVATGRRPFTNGLGLEQMGIQTD-KMGRIQVDEHFRTQIPSIYAIGDVIAGPML  323

Query  484  TPVAIQAGKLLARRLFGNGTALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVY  543
               A + G      + G     ++Y  I   ++T  E    G +EE       ++    Y
Sbjct  324  AHKAEEEGIACVENIAGL-HGHVNYNAIPGVIYTHPEVASVGKTEEQL-----KEEGIAY  377

Query  544  HQNFTPLEWSLSHERPLAK-ECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLH  602
            +    P+  + S  R + + + + K++ D T  K ++G H +  NAGE+     + ++  
Sbjct  378  NVGKFPM-MANSRARAVGEGDGFVKVLADKTTDK-ILGIHIIASNAGEMISEGVLGIEYG  435

Query  603  ATYDDFVNTVGIHPTTAEIF  622
            A  +D   T   HPT +E F
Sbjct  436  AASEDIGRTCHAHPTLSEAF  455

>PHYCA_123621
Length=495

 Score = 103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 118/457 (26%), Positives = 196/457 (43%), Gaps = 35/457 (8%)

Query  180  EASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKK-LMHQSSIIGELLHKDAEQFG  238
            +A++LG K   ++        S   LGGTC+NVGCIP K L+H + ++    H D + +G
Sbjct  46   KAAQLGMKTACIE--------SRGKLGGTCLNVGCIPSKALLHSTHLLHTAQH-DFKSYG  96

Query  239  WTVSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYENMLGTFKDAHTLTLTNEAKK  298
                    ++ +++ + +  +  L        +  KV Y    G       +++      
Sbjct  97   IDAPEVKANFPQMMKAKEKAVTTLTGGIESLFKKNKVTYIKGFGKVSAQGEVSVALN-DN  155

Query  299  KGPTDVTFRRAVIAVGGRPKPLSCPGWEHA----ISSDDIFSKAEAPGKTLVVGASYVAL  354
            KG   V  +  +IA G    PL     ++A    I S    S    P   +VVGA  + L
Sbjct  156  KGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKIIDSTGALSLTRVPEHLVVVGAGVIGL  215

Query  355  ECAGFLKGQGFDVTIM-VRSILLRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKLPN  413
            E     K  G  VT++        G D+   +   + ++ + G+ F K S   +  ++  
Sbjct  216  ELGSVYKRLGSKVTVVEYLDAACPGMDKGAVKEFTKLLKKQ-GLDF-KFSTKVTASEVNG  273

Query  414  GQLKVTHTHGEG------IYDTVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDVTNE-QT  466
              +K+T    +G        DTVL ATGR      L L   G+  + K GRI+V +  +T
Sbjct  274  DVVKLTTEPSKGGDASSIECDTVLVATGRRAFTAGLGLEQMGIQTD-KLGRIEVDDAFRT  332

Query  467  STPHIYAIGDVIDAPELTPVAIQAGKLLARRLFGNGTALMDYTKICTAVFTPVEYGCCGL  526
              P I+AIGDVI    L   A + G      + G     ++Y  I   ++T  E+   G 
Sbjct  333  QVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAGK-HGHVNYGAIPGVIYTFPEFASVGK  391

Query  527  SEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAK-ECYAKLIVDTTQQKRVVGFHYLG  585
            +EE+  A     N+  +     P+  + S  R +A+ +   K++ D    K ++G H + 
Sbjct  392  TEEELKAEGVEYNVGKF-----PM-MANSRARTVAEADGLVKVLADKKTDK-LLGVHIIA  444

Query  586  PNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIF  622
             NAGE+     + ++  A  +D   T   HPT +E F
Sbjct  445  SNAGEMISEGVIGIEYGAASEDLARTCHAHPTLSEAF  481

>PHYKE_9680
Length=498

 Score = 103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 112/442 (25%), Positives = 194/442 (44%), Gaps = 29/442 (7%)

Query  194  VKPSPVGSTWGLGGTCVNVGCIPKK-LMHQSSIIGELLHKDAEQFGWTVSNASFDWTKLV  252
            +K + + S   LGGTC+NVGCIP K L+H + ++    H D + +G        ++ +++
Sbjct  55   LKTACIESRGKLGGTCLNVGCIPSKALLHSTHLLHTAQH-DFKSYGIDAPGVKANFPQMM  113

Query  253  SSVQDYIHGLNFKYRIDLRDKKVKYENMLG--TFKDAHTLTLTNEAKKKGPTDVTFRRAV  310
             + +  +  L     +  +  KV Y    G  + +   ++ LT+    KG   V  +  +
Sbjct  114  KAKEKAVKTLTGGIEMLFKKNKVTYIKGFGKVSAQGEVSVALTD---NKGNETVKAKNII  170

Query  311  IAVGGRPKPL-SCPGWEHA---ISSDDIFSKAEAPGKTLVVGASYVALECAGFLKGQGFD  366
            IA G    PL   P    A   I S         P   +VVGA  + LE     K  G  
Sbjct  171  IATGSEVTPLPPVPVDNEAGKIIDSTGALVLKRVPEHLVVVGAGVIGLELGSVYKRLGSK  230

Query  367  VTIM-VRSILLRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHTHGEG  425
            VT++  +     G D++  +   + ++ + G+ F K     +  ++    +K+T    +G
Sbjct  231  VTVVEFQDAACPGMDKECVKEFTKLLKKQ-GLDF-KFGTKVTASEVNGDVVKLTTEAAKG  288

Query  426  ------IYDTVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDVTNE-QTSTPHIYAIGDVI  478
                    DTVL ATGR      L L   G+  + K GR++V +  +T  P I+AIGDVI
Sbjct  289  GDEASIECDTVLVATGRRAYTAGLGLEQMGIQTD-KLGRVEVDDAFRTQVPGIFAIGDVI  347

Query  479  DAPELTPVAIQAGKLLARRLFGNGTALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRD  538
                L   A + G      + G     ++Y  I   ++T  E+   G +EE+  A     
Sbjct  348  KGAMLAHKAEEEGIACVENIAGK-HGHVNYGAIPGVIYTFPEFASVGKTEEELKAEGIEY  406

Query  539  NIQVYHQNFTPLEWSLSHERPLAKECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVA  598
            N+  +     P+  + S  R +A+      ++   +  +++G H +  NAGE+     +A
Sbjct  407  NVGKF-----PM-MANSRARTVAEADGLVKVLSDKKTDKMLGVHIIASNAGEMIAEGVIA  460

Query  599  MKLHATYDDFVNTVGIHPTTAE  620
            ++  A+ +D   T   HPT +E
Sbjct  461  LEYGASSEDIARTCHAHPTLSE  482

>PYVX_23499
Length=519

 Score = 103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 138/530 (26%), Positives = 228/530 (43%), Gaps = 85/530 (16%)

Query  150  VSDTSSSDETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTC  209
            +S+T    +    +DL+V+G G  G  C+ +++K G+ V ++D            LGG C
Sbjct  2    LSETLRELKASEHFDLIVVGSGPAGQKCAIDSAKHGKSVAIIDKRDM--------LGGVC  53

Query  210  VNVGCIPKKLMHQSSI-IGELLHK----------------DAEQFGWTVSNASFDWTK--  250
            V+ G +P K   ++++ +    H+                D  Q    V  A  D T+  
Sbjct  54   VHTGTVPSKTFREATLHLTGYRHRAFYDSASVSSRRLEIDDILQRVHKVEGAETDITRHQ  113

Query  251  LVSSVQDYIHGLNFKYRIDLRDKKVKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFR---  307
            L+ +  + IHG   ++   L D+K    NM+    +A   T T+ AK+    D+  R   
Sbjct  114  LMRNNVELIHG-TARF---LPDEK---RNMVAVLSNAKYDTPTD-AKRHTSADICKRVLT  165

Query  308  --RAVIAVGGRP-KPLSCPGWEHAI-SSDDIF--SKAEAPGKTLVVGASYVALECAGFLK  361
              + +I VG RP +    P     I  SD +       AP + +VVGA  + +E A  + 
Sbjct  166  ADKFLICVGTRPARREDIPFDGKTIFDSDQLLWGGVKAAPRRLIVVGAGVIGMEYASMMS  225

Query  362  G-QGFDVTIMV-RSILLRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKLPNGQLKVT  419
               G +VT++  R  +L   D++++  +  Y   ++G  F  E     +EK  NG++   
Sbjct  226  IIPGTEVTVIDGRKEILDMADKEVSESLC-YSMRQTGTRFYTEESIKKVEKRENGEVVAH  284

Query  420  HTHGEGIY-DTVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDVTNE-QTSTPHIYAIGDV  477
               G+ I  D +L   GR  +   LNL A G+  + K G ++V ++ QT  PHIYA GD 
Sbjct  285  LNSGKVIVGDGLLYTLGRQGNTDGLNLQAVGLETD-KRGFLNVNDDFQTEVPHIYAAGDC  343

Query  478  IDAPELTPVAIQAGKLLARRL----------------FGNGTALMDYTKICTAVFTPVEY  521
            I  P L   +++ G+L +  +                 G     + +      VF    +
Sbjct  344  IGYPALASTSMEQGRLASVHMRTESPTNKVGEEASDELGGDANRIRWRMRSGEVFP---F  400

Query  522  GCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAK-------ECYAKLIV--DT  572
            G   + E   I+  G++  Q+  +N  P E  L+    LAK         + K+I   DT
Sbjct  401  GIYTIPE---ISMVGKNEQQLTKEN-VPYEVGLARYEELAKGQMLGGVPGFLKIIFCPDT  456

Query  573  TQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIF  622
                +V+G H +G  A E+     V M    T + F N V  +PT AE +
Sbjct  457  L---KVLGVHAIGEGATEIIHIGQVVMSTGGTIEYFRNAVFNYPTLAEAY  503

>PHYSO_556052
Length=500

 Score = 103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 118/444 (27%), Positives = 193/444 (43%), Gaps = 29/444 (7%)

Query  194  VKPSPVGSTWGLGGTCVNVGCIPKK-LMHQSSIIGELLHKDAEQFGWTVSNASFDWTKLV  252
            +K + + S   LGGTC+NVGCIP K L+H + ++    H D + +G        ++ +++
Sbjct  57   LKTACIESRGKLGGTCLNVGCIPSKALLHSTHLLHTAQH-DFKSYGIDAPEVKANFPQMM  115

Query  253  SSVQDYIHGLNFKYRIDLRDKKVKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIA  312
             + +  +  L        +  KV Y    G       +++      KG   V  +  +IA
Sbjct  116  KAKEKAVKTLTGGIESLFKKNKVTYIKGFGKVSAQGEVSVALN-DNKGNETVKAKNIIIA  174

Query  313  VGGRPKPL-SCPGWEHA---ISSDDIFSKAEAPGKTLVVGASYVALECAGFLKGQGFDVT  368
             G    PL   P    A   I S    S    P   +VVGA  + LE     K  G  VT
Sbjct  175  TGSEVTPLPPVPVDNEAGKIIDSTGALSLKRVPEHLVVVGAGVIGLELGSVYKRLGSKVT  234

Query  369  IM-VRSILLRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKLPNGQ-LKVTHTHGEG-  425
            ++  +     G D++  +   + ++ + G+ F   +  T+ E   NG  +K+T    +G 
Sbjct  235  VVEFQDAACPGMDKESVKEFTKLLKKQ-GLEFQFGTKVTASE--VNGDVVKLTTEPSKGG  291

Query  426  -----IYDTVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDVTNE-QTSTPHIYAIGDVID  479
                   DTVL ATGR      L L   G+  + K GRI+V +  +T  P I+AIGDVI 
Sbjct  292  DASTIECDTVLVATGRRAFTAGLGLEQMGIQTD-KLGRIEVDDAFRTQVPGIFAIGDVIK  350

Query  480  APELTPVAIQAGKLLARRLFGNGTALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDN  539
               L   A + G      + G     ++Y  I   ++T  E+   G +EE+  A     N
Sbjct  351  GAMLAHKAEEEGVACVENIAGK-HGHVNYGAIPGVIYTFPEFASVGKTEEELKAEGIEYN  409

Query  540  IQVYHQNFTPLEWSLSHERPLAK-ECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVA  598
            +  +     P+  + S  R +A+ +   K++ D    K ++G H +  NAGE+     + 
Sbjct  410  VGKF-----PM-MANSRARTVAESDGLVKVLADKKTDK-LLGVHIIASNAGEMIAEGVIG  462

Query  599  MKLHATYDDFVNTVGIHPTTAEIF  622
            ++  A  +D   T   HPT +E F
Sbjct  463  IEYGAASEDLARTCHAHPTLSEAF  486

>SPRG_12054
Length=558

 Score = 103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 145/551 (26%), Positives = 233/551 (42%), Gaps = 81/551 (15%)

Query  131  RARTQSAP--STGAPSAANAHVSDTSSSDETQYD------WDLVVIGGGSGGLACSKEAS  182
            R+R  + P    G  + A A   D SS      +      +DLVVIG G  G  C+ +++
Sbjct  9    RSRRAAVPVLRAGLSTEAEAKADDASSFTNILRNLRASEHFDLVVIGSGPSGQKCAIDSA  68

Query  183  KLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGELLHKDAEQFGWTVS  242
            K G+KV ++D             GG CV+ G IP K   ++     +LH  A +      
Sbjct  69   KHGKKVAIIDKKDMH--------GGVCVHTGTIPSKTFREA-----VLHLTAHRHKGFYG  115

Query  243  NASFDWTKLVSSVQDYIHGLNF--KYRIDL-RDKKVKYENML--GTFK-----DAHTLTL  292
            NA    +    S+QD +  +       +DL R++ ++    L  GT +     D  T+ +
Sbjct  116  NAYSATSGKRMSIQDILDRVQKVESAEMDLTRNQLLRNGIYLINGTARFLPDADKKTVAV  175

Query  293  TNEAKKKGPTD-------------VTFRRAVIAVGGRPK--PLSCPGWEHAISSDDIF--  335
             +       TD             +T  + +I+VG RP   P      E    SD +   
Sbjct  176  LSNDSYTEATDGQRHSDANICKRVLTADKFLISVGTRPARHPNMDFDGELIFDSDQLLWG  235

Query  336  SKAEAPGKTLVVGASYVALECAGFLKG-QGFDVTIM-VRSILLRGFDQDIARRIGEYMEN  393
            +    P + +VVGA  + +E A  +    G  VT++  R  +L   D++++  +  Y   
Sbjct  236  ALTNVPKRLIVVGAGVIGMEYAAMISIIPGTQVTVIDGRKEILEMADKEVSDALC-YSMR  294

Query  394  ESGIAFIKESVPTSIEKLPNGQLKVTHTHGEGIY--DTVLNATGRSPDVQMLNLPAAGVT  451
            + G  F+ E     +EK  + +  V H     I   D +L   GR  +V  L+L A G+ 
Sbjct  295  QRGTRFLTEETIDFVEKRLDEKEVVVHLKSGKIIVGDALLYTQGRQGNVTGLDLEAVGLE  354

Query  452  LNPKSGRIDVTNE-QTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLF------GNGTA  504
             N + G ++V N  QTS PHIYA GD I  P L  V+++ G+L +  +        N T 
Sbjct  355  ANNR-GYLEVNNNFQTSVPHIYAAGDCIGYPALASVSMEQGRLASVHMRTSEPTNKNRTD  413

Query  505  LMDY------TKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHER  558
            L  Y      T++ +    P  +G   + E   I+  G+   Q+  +N  P E  ++   
Sbjct  414  LDPYETSHFRTRMRSGEVFP--FGIYTVPE---ISMVGKSEQQLTKEN-VPYEVGVARYE  467

Query  559  PLAK-------ECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNT  611
             LAK         + K+I   +  K ++G H +G  A E+     V M    T + F N 
Sbjct  468  ELAKGQMLGGTPGFLKIIFCPSTLK-LLGVHAIGEGATEIIHIGQVVMSTGGTLEYFRNA  526

Query  612  VGIHPTTAEIF  622
            V  +PT AE +
Sbjct  527  VFNYPTLAEAY  537

>PITG_15359
Length=496

 Score = 101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 132/487 (27%), Positives = 215/487 (44%), Gaps = 37/487 (8%)

Query  151  SDTSSSDETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCV  210
            S T+ +  +  D+D+VVIGGG GG   + +A++LG K   ++        S   LGGTC+
Sbjct  18   SVTARAFSSSSDYDVVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGKLGGTCL  69

Query  211  NVGCIPKK-LMHQSSIIGELLHKDAEQFGWTVSNASFDWTKLVSSVQDYIHGLNFKYRID  269
            NVGCIP K L+H + ++    H D + +G        ++ +++ S +  +  L       
Sbjct  70   NVGCIPSKALLHSTHLLHTAQH-DFKSYGIDAPEVKANFPQMMKSKEKAVKTLTGGIESL  128

Query  270  LRDKKVKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHA-  328
             +  KV Y    G       +++      KG   V  +  +IA G    PL     ++A 
Sbjct  129  FKKNKVTYIKGHGKISAQGEISVALN-DNKGNETVKAKNIIIATGSEVTPLPPVPVDNAA  187

Query  329  ---ISSDDIFSKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIM-VRSILLRGFDQDIA  384
               I S         P   +VVGA  + LE     K  G  VT++        G D++  
Sbjct  188  GKIIDSTGALELKRVPEHLVVVGAGVIGLELGSVYKRLGAKVTVVEFLDAACPGSDKEAV  247

Query  385  RRIGEYMENESGIAFIKESVPTSIEKLPNGQ-LKVTHTHGEG------IYDTVLNATGRS  437
            +   + ++ + G+ F   +  T+ E   NG  +K+T    +G        DTVL ATGR 
Sbjct  248  KEFTKLLKKQ-GLDFQFNTKVTASE--VNGDVVKLTTEPSKGGDASSIECDTVLVATGRR  304

Query  438  PDVQMLNLPAAGVTLNPKSGRIDVTNE-QTSTPHIYAIGDVIDAPELTPVAIQAGKLLAR  496
                 L L   G+  + K GRI+V +  +T  P I+AIGDVI    L   A + G     
Sbjct  305  AFTSGLGLEQMGIQTD-KLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACVE  363

Query  497  RLFGNGTALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSH  556
             + G     ++Y  I   ++T  E+   G +EE+  A     N+  +     P+  + S 
Sbjct  364  NIAGK-HGHVNYGAIPGVIYTFPEFASVGKTEEELKAEGIEYNVGKF-----PM-MANSR  416

Query  557  ERPLAK-ECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIH  615
             R +A+ +   K++ D    K ++G H +  NAGE+     + ++  A  +D   T   H
Sbjct  417  ARTIAEADGLVKVLADKKTDK-LLGVHIIAGNAGEMIAEGVIGIEYGAASEDLARTCHAH  475

Query  616  PTTAEIF  622
            PT +E F
Sbjct  476  PTLSEAF  482

>SDRG_05060
Length=559

 Score = 101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 136/511 (27%), Positives = 220/511 (43%), Gaps = 73/511 (14%)

Query  163  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  222
            +DLVVIG G  G  C+ +++K G+KV ++D             GG CV+ G IP K   +
Sbjct  50   FDLVVIGSGPSGQKCAIDSAKHGKKVAIIDKKDMH--------GGVCVHTGTIPSKTFRE  101

Query  223  SSIIGELLHKDAEQFGWTVSNASFDWTKLVSSVQDYIHGLNF--KYRIDL-RDKKVKYEN  279
            +     +LH  A +      NA    +    S+QD +  +       +DL R++ ++   
Sbjct  102  A-----VLHLTAHRHKGFYGNAYSATSGKRMSIQDILDRVQKVESAEMDLTRNQLLRNGI  156

Query  280  ML--GTFK-----DAHTLTLTNEAKKKGPTD-------------VTFRRAVIAVGGRPK-  318
             L  GT +     D  T+ + +       TD             +T  + +I+VG RP  
Sbjct  157  YLINGTARFLPDADKKTVAVLSNDSYTEATDGQRHSDANICKRVLTADKFLISVGTRPAR  216

Query  319  -PLSCPGWEHAISSDDIF--SKAEAPGKTLVVGASYVALECAGFLKG-QGFDVTIMV-RS  373
             P      E    SD +   +    P + +VVGA  + +E A  +    G  VT++  R 
Sbjct  217  HPNMDFDGELIFDSDQLLWGALTNVPKRLIVVGAGVIGMEYAAMISIIPGTQVTVIDGRK  276

Query  374  ILLRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHTHGEGIY--DTVL  431
             +L   D++++  +  Y   + G  F+ E     +EK  + +  V H     I   D +L
Sbjct  277  EILEMADKEVSDALC-YSMRQRGTRFLTEETIDFVEKRLDEKEVVVHLKSGKIIVGDALL  335

Query  432  NATGRSPDVQMLNLPAAGVTLNPKSGRIDVTNE-QTSTPHIYAIGDVIDAPELTPVAIQA  490
               GR  +V  L+L A G+  N + G ++V N  QTS PHIYA GD I  P L  V+++ 
Sbjct  336  YTQGRQGNVTGLDLEAVGLEANNR-GYLEVNNNFQTSVPHIYAAGDCIGYPALASVSMEQ  394

Query  491  GKLLARRLF------GNGTALMDY------TKICTAVFTPVEYGCCGLSEEDAIASAGRD  538
            G+L +  +        N T L  Y      T++ +    P  +G   + E   I+  G+ 
Sbjct  395  GRLASVHMRTSEPTNKNRTDLDPYETSHFRTRMRSGEVFP--FGIYTVPE---ISMVGKS  449

Query  539  NIQVYHQNFTPLEWSLSHERPLAK-------ECYAKLIVDTTQQKRVVGFHYLGPNAGEV  591
              Q+  +N  P E  ++    LAK         + K+I   +  K ++G H +G  A E+
Sbjct  450  EQQLTKEN-VPYEVGVARYEELAKGQMLGGTPGFLKIIFCPSTLK-LLGVHAIGEGATEI  507

Query  592  TQAIGVAMKLHATYDDFVNTVGIHPTTAEIF  622
                 V M    T + F N V  +PT AE +
Sbjct  508  IHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  538

>SPRG_09825
Length=492

 Score = 100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 136/491 (28%), Positives = 209/491 (43%), Gaps = 61/491 (12%)

Query  159  TQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKK  218
            T  D+DLVV+GGG GG   + +A++LG        +K + V S   LGGTC+NVGCIP K
Sbjct  22   TGSDYDLVVVGGGPGGYVAAIKAAQLG--------LKTACVESRGTLGGTCLNVGCIPSK  73

Query  219  LMHQSSIIGELLHKDAEQFGWTVSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYE  278
             +  ++        D +  G  V     D+ KL++S    +  L        +  KV Y 
Sbjct  74   ALLSATHKYHAAQHDFKNVGIEVDGLRIDFAKLMASKDKSVKILTGGIEGLFKKNKVDYI  133

Query  279  NMLGTFKDAHTLTLT-NEAKKKGPTDVTFRRAVIAVGGRPKPL-SCPGWEHA---ISSDD  333
               G     + +++  NE    G   V+ +  +IA G    PL   P    A   I S  
Sbjct  134  KGFGKIVAKNQVSVALNEG---GNKTVSTKNILIATGSEVTPLPPVPVDNEAGKIIDSTG  190

Query  334  IFSKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGEYMEN  393
              S    P   +V+G   + LE        G  +T++           + A +I   M+ 
Sbjct  191  ALSLKRIPEHLVVIGGGVIGLEMGSVYGRLGAKITVV-----------EYADKICPTMDF  239

Query  394  ESGIAFIKESVPTSIEKLPNGQL--KVTHTHGEGIY------------------DTVLNA  433
            E+G  F K      +    N QL  KVT +  EG                    DTVL A
Sbjct  240  ETGREFQKLLKKQGM----NFQLGQKVTASKVEGDKVTLTVEPAAGGEATTIECDTVLVA  295

Query  434  TGRSPDVQMLNLPAAGVTLNPKSGRI--DVTNEQTSTPHIYAIGDVIDAPELTPVAIQAG  491
            TGR P  + L L   G+  + K GRI  D++N +T+  +I+AIGD I+   L   A + G
Sbjct  296  TGRRPFTKGLGLEEMGIQTD-KFGRIQVDLSNFKTNVDNIFAIGDCIEGAMLAHKAEEEG  354

Query  492  KLLARRLFGNGTALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLE  551
                  + G G   ++Y  I   V+T  E    G +EE+  A+    N+  Y+    P+ 
Sbjct  355  ISCVESIAG-GHGHVNYNAIPGVVYTFPEVASVGKTEEELKAA----NV-AYNVGKFPM-  407

Query  552  WSLSHERPLAKECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNT  611
             + S  R + +      I+      +++G H +  NAGE+     + ++  A+ +D   T
Sbjct  408  MANSRARTVGETDGFVKILAAKDDDKILGIHIIASNAGEMISEGVLGLEYGASAEDIGRT  467

Query  612  VGIHPTTAEIF  622
               HPT +E F
Sbjct  468  CHAHPTLSEAF  478

>PYIW_20257
Length=503

 Score = 100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 133/504 (26%), Positives = 211/504 (42%), Gaps = 84/504 (17%)

Query  150  VSDTSSSDETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTC  209
            +SD     +    +DL+VIG G  G  C+ + +K G+ V V+D            LGG C
Sbjct  37   LSDMLRELKASEHFDLIVIGSGPAGQKCAIDHAKHGKTVAVID--------KRDMLGGVC  88

Query  210  VNVGCIPKKLMHQSSIIGELLHKDAEQFGWTVSNASFDWTKLVSSVQDYIHGLNFKYRID  269
            ++ G +P K   +++     LH  A                       Y H  +F     
Sbjct  89   IHTGTVPSKTFREAT-----LHLTA-----------------------YRH-RSFYEGQS  119

Query  270  LRDKKVKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRA-VIAVGGRP--KPLSCPGWE  326
               K+   E++L   K  H     +   ++ P +    +A +IAVG RP  +P      E
Sbjct  120  TPAKRFGIEDILQRVKKLH-----DRHGRQTPLERRHLQAFLIAVGTRPARRPDIPFDGE  174

Query  327  HAISSDDIF--SKAEAPGKTLVVGASYVALECAGFLKG-QGFDVTIM-VRSILLRGFDQD  382
                SD +        P + +VVGA  + +E A  +    G +VTI+  R  +L   D++
Sbjct  175  TIFDSDQLLWGGVKSVPKRLIVVGAGVIGMEYASMMSIIPGMEVTIVDGRREILDMADRE  234

Query  383  IARRIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHTHGEGIY-DTVLNATGRSPDVQ  441
            ++  +  Y   ++G  F  E    S+EK  NG++ V    G+ +  D +L   GR  + +
Sbjct  235  VSEALC-YSMRQTGARFFVEETIKSVEKADNGEVIVHLNSGKTLVGDGLLYTLGRQGNTE  293

Query  442  MLNLPAAGVTLNPKSGRIDVTNE-QTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLF-  499
             LNL A G+  + K G I+V ++ QT+ PHIYA GD I  P L   +++ G+L +  +  
Sbjct  294  GLNLEAIGLKAD-KRGLIEVDDDFQTAVPHIYAAGDCIGFPALASTSMEQGRLASVHMRT  352

Query  500  -------------GNGTALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQN  546
                             A M        VF    +G   + E   I+  G++  Q+  Q 
Sbjct  353  AKPTNKKGDSETESTDPAFMRTRMRSGEVFP---FGIYTVPE---ISMVGKNEQQLTSQC  406

Query  547  FTPLEWSLSHERPLAK-------ECYAKLIV-DTTQQKRVVGFHYLGPNAGEVTQAIGVA  598
              P E  ++    LAK         + K+I   TT Q  V+G H +G  A E+     V 
Sbjct  407  I-PYEVGVARYEELAKGQMLGGVPGFLKIIFCPTTLQ--VLGVHAIGEGATEIIHIGQVV  463

Query  599  MKLHATYDDFVNTVGIHPTTAEIF  622
            M    T + F N V  +PT AE +
Sbjct  464  MSTGGTIEYFRNAVFNYPTLAEAY  487

>PHYCA_555180
Length=521

 Score = 100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 124/495 (25%), Positives = 208/495 (42%), Gaps = 57/495 (12%)

Query  163  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  222
            +DLVVIG G     C+ E++K G++V ++D            LGG CV+ G IP K   +
Sbjct  31   YDLVVIGSGPSATQCALESAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFRE  82

Query  223  SSIIGELLHKDAEQ----FGWTVSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYE  278
            +     +LH    +    +G + S  +     ++  VQ  +       R  L+  +V   
Sbjct  83   A-----VLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDVI  137

Query  279  NMLGTFKDAHTLTLTNE---AKKKGP---------------TDVTFRRAVIAVGGRP--K  318
                 F++ H +++  +    KK G                + V   + +IA G RP   
Sbjct  138  PGFARFENQHEISIIRDDADVKKNGAVGANASGSSCNLDSLSRVHADKFLIACGTRPAHN  197

Query  319  PLSCPGWEHAISSDDIFSKA--EAPGKTLVVGASYVALECAGFLKG-QGFDVTIM-VRSI  374
            PL     +  I SD I S+   + P   +V+GA  + +E A  +    G  VT++  R  
Sbjct  198  PLVPIDGKVIIDSDQILSRDMHQLPRSLIVMGAGVIGMEYASMVNVVPGHSVTVVDGRPD  257

Query  375  LLRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHTHGEGI-YDTVLNA  433
            +L   D++I   +   M++      + E+V   +E     ++KV    G+ +  D +L  
Sbjct  258  ILSFCDREIISNLTYEMQSNGARFLLGETVK-KVE--VTDRVKVFFDSGKVLSADALLYT  314

Query  434  TGRSPDVQMLNLPAAGVTLNPKSGRIDVT-NEQTSTPHIYAIGDVIDAPELTPVAIQAGK  492
             GR      LNL A G++ N + G I+V  N QT  PHIYA GD I AP L   +++ G+
Sbjct  315  VGRQAATDGLNLEAVGLSRNHR-GLINVNKNYQTDQPHIYAAGDCIGAPALASTSMEQGR  373

Query  493  LLARRLFGNGTALMDYTKICT-----AVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNF  547
            L +  ++     L   +++        ++T  E    G +E+    +     I V   + 
Sbjct  374  LASCHMWNPDEELAVTSQLENGNYPYGIYTIPEISMVGQTEQQLTKACINYEIGVAKYS-  432

Query  548  TPLEWSLSHERPLAKECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDD  607
               E +             K++ D    K V G H +G  A E+     VAM +  +   
Sbjct  433  ---ELAKGQMMGAMAGGTLKILFDPDTLK-VFGVHAIGEGATEIIHIGQVAMAMDCSLTY  488

Query  608  FVNTVGIHPTTAEIF  622
            F + V  +PT AE +
Sbjct  489  FRDAVFNYPTLAEAY  503

>PYAP_19280
Length=512

 Score = 100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 126/489 (26%), Positives = 213/489 (44%), Gaps = 54/489 (11%)

Query  163  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  222
            +DLVVIG G     C+ E+++ G++V V+D  K S VG      G CV+ G IP K   +
Sbjct  30   YDLVVIGSGPSATQCAVESARHGKRVAVVD--KGSSVG------GVCVHTGTIPSKTFRE  81

Query  223  SSIIGELLHKDAEQ----FGWTVSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYE  278
            +     +LH    +    +G + S  +     ++  V+  +       +  L+  +V Y 
Sbjct  82   A-----VLHLSGYRHHGFYGKSYSMKTVTIDDILYRVKRVVDSEVDVIKAQLKAARVDYI  136

Query  279  NMLGTFKDAHTLTLTNEAKK---------KGPTDVTFRRAVIAVGGRP--KPLSCPGWEH  327
                 F++ H +++  E  +         +  T +   + +IA G RP   PL     + 
Sbjct  137  PGFARFENDHEISIVREPTETNPEEEEPARLATRLQADKFLIACGTRPAHSPLVPIDGKV  196

Query  328  AISSDDIFSK--AEAPGKTLVVGASYVALECAGFLKGQ-GFDVTIM-VRSILLRGFDQDI  383
               SD I S    E P   +VVGA  + +E A  L    G  VT++  R  +L   D ++
Sbjct  197  VFDSDQILSGDIRELPRSLIVVGAGVIGMEYASMLNVVPGHSVTVIDGRQDILSFCDNEV  256

Query  384  ARRIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHTHGEGI-YDTVLNATGRSPDVQM  442
               +   M  +     + ES+   +EK   G +KV    G+    D +L   GR  +   
Sbjct  257  VSMLQHEMRVKGARFLLGESIQ-KVEKTAKG-VKVLLNSGKVTSADALLYTVGRQANTDG  314

Query  443  LNLPAAGVTLNPKSGRIDVTNE-QTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLF-G  500
            LN+ A G++ N + G ++V    QT   HIYA+GD I AP L   +++ G+L A  ++ G
Sbjct  315  LNIEAVGLSRNQR-GLLNVNKSYQTDKAHIYAVGDCIGAPALASTSMEQGRLAACHMWDG  373

Query  501  N---GTALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSL---  554
            N    T+ ++       ++T  E    G +E+   A   + N ++    ++ L       
Sbjct  374  NCDIATSQLENGNYPYGIYTIPEISMVGKTEQQLTAE--KVNYEIGIAKYSELAKGQMGG  431

Query  555  -SHERPLAKECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVG  613
             SH   L      K++ D    K + G H +G  A E+     VA+ +  +   F + V 
Sbjct  432  GSHNGIL------KILFDPDTLK-LHGVHAIGEGATEIIHIGQVAIAMGCSLTYFRDAVF  484

Query  614  IHPTTAEIF  622
             +PT AE +
Sbjct  485  NYPTLAEAY  493

>SDRG_06945
Length=492

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 134/492 (27%), Positives = 208/492 (42%), Gaps = 63/492 (13%)

Query  159  TQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKK  218
            T  D+DLVV+GGG GG   + +A++LG        +K + V S   LGGTC+NVGCIP K
Sbjct  22   TGSDYDLVVVGGGPGGYVAAIKAAQLG--------LKTACVESRGTLGGTCLNVGCIPSK  73

Query  219  LMHQSSIIGELLHKDAEQFGWTVSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYE  278
             +  ++        D +  G  V     D+ KL++S    +  L        +  K+ Y 
Sbjct  74   ALLSATHKYHAAQHDFKNVGIEVDGLRIDFAKLMASKDKSVKILTGGIEGLFKKNKIDYI  133

Query  279  NMLGTF--KDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPL-SCPGWEHA---ISSD  332
               G    K+  ++ L +   K     V+ +  +IA G    PL   P    A   I S 
Sbjct  134  KGFGKIVAKNQVSVALNDGGNKT----VSTKNILIATGSEVTPLPPVPVDNEAGKIIDST  189

Query  333  DIFSKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGEYME  392
               S    P   +V+G   + LE        G  +T++           + A +I   M+
Sbjct  190  GALSLKRIPEHLVVIGGGVIGLEMGSVYGRLGAKITVV-----------EYADKICPTMD  238

Query  393  NESGIAFIKESVPTSIEKLPNGQL--KVTHTHGEGIY------------------DTVLN  432
             E+G  F K      +    N QL  KVT +  EG                    DTVL 
Sbjct  239  FETGREFQKLLKKQGM----NFQLGQKVTASKVEGDKVTLTVEPAAGGEATTIECDTVLV  294

Query  433  ATGRSPDVQMLNLPAAGVTLNPKSGRI--DVTNEQTSTPHIYAIGDVIDAPELTPVAIQA  490
            ATGR P  + L L   G+  + K GRI  D++N +T+  +I+AIGD I+   L   A + 
Sbjct  295  ATGRRPFTKGLGLEEMGIQTD-KFGRIQVDLSNFKTNVDNIFAIGDCIEGAMLAHKAEEE  353

Query  491  GKLLARRLFGNGTALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPL  550
            G      + G G   ++Y  I   V+T  E    G +EE+  A+    N+  +     P+
Sbjct  354  GISCVESIAG-GHGHVNYNAIPGVVYTFPEVASVGKTEEELKAAGVAYNVGKF-----PM  407

Query  551  EWSLSHERPLAKECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVN  610
              + S  R + +      I+      +++G H +  NAGE+     + ++  A+ +D   
Sbjct  408  -MANSRARTVGETDGFVKILAAKDDDKILGIHIIASNAGEMISEGVLGLEYGASAEDIGR  466

Query  611  TVGIHPTTAEIF  622
            T   HPT +E F
Sbjct  467  TCHAHPTLSEAF  478

>H310_07641
Length=548

 Score = 99.4 bits (246),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 139/540 (26%), Positives = 226/540 (42%), Gaps = 82/540 (15%)

Query  134  TQSAPSTGAPSAANAHVSDTSSSDETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDY  193
            T+S PS  +    N   S+          +DLVVIG G  G  C+ +++K G+KV ++D 
Sbjct  21   TESKPSDFSEVLRNLRASE---------HFDLVVIGSGPAGQKCAIDSAKHGKKVAIIDK  71

Query  194  VKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGELLHKDAEQ---FGWTVSNASFDWTK  250
                        GG CV+ G IP K   ++     +LH  A +   F      AS    +
Sbjct  72   KDMH--------GGVCVHTGTIPSKTFREA-----VLHLTAHRHKGFYGNAYTASTTGKR  118

Query  251  L-VSSVQDYIHGLNFKYRIDLRDKKVKYENML---GTFK-----DAHTLTLTNEAKKKGP  301
            L +  + D +  +  +   DL   ++    ++   GT +     D  T+ + +       
Sbjct  119  LSLEEILDRVKKVE-EAETDLTRNQLTRNGIILINGTARFLQTEDKKTIAVLSNDSYTEK  177

Query  302  TD-------------VTFRRAVIAVGGRPKPLSCPGWEH----AISSDDIF--SKAEAPG  342
            TD             +T  + +IAVG RP     P  E+       SD +        P 
Sbjct  178  TDAQRHNDANICKRVLTADKVLIAVGTRPA--RHPDLEYDGRLIFDSDQLLWGGVDIVPK  235

Query  343  KTLVVGASYVALECAGFLKG-QGFDVTIMV-RSILLRGFDQDIARRIGEYMENESGIAFI  400
            + +VVGA  + +E A  +    G  VT++  R  +L   D++++  +  YM  + G  F+
Sbjct  236  RLIVVGAGVIGMEYASMISIIPGTQVTVIDGRKEILDMADKEVSDALCYYMR-QRGSRFL  294

Query  401  KESVPTSIEKLPNGQLKVTHTHGEGIY-DTVLNATGRSPDVQMLNLPAAGVTLNPKSGRI  459
             E     +E   + ++ V  T G+ I  D +L   GR  +V  L+L A G++ N K G +
Sbjct  295  TEESILKVETKDDSEVVVHLTSGKVIMGDALLYTQGRQGNVAGLDLEAVGLSAN-KRGIL  353

Query  460  DVTNE-QTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLFGNGTALMDYTKICTAVFTP  518
            +V N  QT+ PHIYA GD I  P L   +++ G+L +  +    +   +  +    V  P
Sbjct  354  EVNNNFQTAVPHIYAAGDCIGYPALASTSMEQGRLASVHM--RTSEPTNKLRPDAEVHDP  411

Query  519  V---------EYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAK-------  562
                      E    G+     I+  G+   Q+  +N  P E  ++    LAK       
Sbjct  412  AHPRTRMRSGEVFPFGIYTVPEISMVGKSEQQLSKENI-PYEVGIARYEELAKGQMLGGM  470

Query  563  ECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIF  622
              + KLI   T  K ++G H +G  A E+     V M    T + F N V  +PT AE +
Sbjct  471  PGFLKLIFCPTTLK-LLGVHAIGEGATEIIHIGQVVMSTGGTMEYFRNAVFNYPTLAEAY  529

>PYAP_19148
Length=535

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 134/518 (26%), Positives = 218/518 (42%), Gaps = 79/518 (15%)

Query  163  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  222
            +DL+VIG G  G  C+ + +K G+ V ++D             GG CV+ G +P K   +
Sbjct  11   FDLIVIGSGPAGQKCAIDHAKHGKSVAIIDKKDMH--------GGVCVHTGTVPSKTFRE  62

Query  223  SSIIGELLH--------------KDAEQFGW--------TVSNASFDWTK--LVSSVQDY  258
            +     +LH              K  ++FG          V NA  D T+  L+ +  + 
Sbjct  63   A-----ILHLTAHRHRSFYDGASKPKKRFGIEDILQRVRKVENAETDITRHQLLRNGIEL  117

Query  259  IHGLNFKYRIDLRDKKVKY--ENMLGTFKDAHTLTLTNEAKKKGPTD-------VTFRRA  309
            I+G   ++  D   K V     +   T  D    T  +  K+ G          +T  + 
Sbjct  118  ING-TARFLPDPSKKMVAVLSNDSYETATDTKRHTSADICKRTGADSSILLISVLTADKF  176

Query  310  VIAVGGRP-KPLSCPGWEHAI-SSDDIF--SKAEAPGKTLVVGASYVALECAGFLKG-QG  364
            ++AVG RP +    P     I  SD I        P + +VVGA  + +E A  +    G
Sbjct  177  LVAVGTRPARRADIPFDGKTIFDSDQILWGGVDAVPKRLIVVGAGVIGMEYASMMSIIPG  236

Query  365  FDVTIMV-RSILLRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHTHG  423
             +VT++  R  +L   D+++A  + +Y   ++G  F  +    ++EK  NG++ V    G
Sbjct  237  SEVTVIDGRKEILDMADKEVAEAL-KYAMRQTGTRFYTDETINTVEKAANGEVIVKLNSG  295

Query  424  EGIY-DTVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDVT-NEQTSTPHIYAIGDVIDAP  481
            + I  D +L   GR  +   LNL A G+  + K G + V  N +TS PHIYA GD I  P
Sbjct  296  KTIVGDGLLYTVGRQGNTDGLNLAAVGLEAD-KRGLLKVDDNFRTSVPHIYAAGDCIGYP  354

Query  482  ELTPVAIQAGKL----------LARRLFGNGTALMDYTKICTAVFTPVEYGCCGLSEEDA  531
             L   +++ G+L          + ++   N  +   Y +          +G   + E   
Sbjct  355  ALASTSMEQGRLASVHMRSEKPVNKKRADNEPSDPSYQRTRMRSGEVFPFGIYTVPE---  411

Query  532  IASAGRDNIQVYHQNFTPLEWSLSHERPLAK-------ECYAKLIVDTTQQKRVVGFHYL  584
            I+  G+   Q+  +N  P E  ++    LAK         + K IV   +  +V+G H +
Sbjct  412  ISMVGKSEQQLTRENI-PYEVGVARYEELAKGQMLGGVPGFLK-IVFCPKSLQVLGVHAI  469

Query  585  GPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIF  622
            G  A E+     V M    T + F N V  +PT AE +
Sbjct  470  GEGATEIIHIGQVVMSTGGTIEYFRNAVFNYPTLAEAY  507

>PYIW_24688
Length=259

 Score = 92.8 bits (229),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 80/253 (32%), Positives = 121/253 (48%), Gaps = 35/253 (14%)

Query  175  LACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGELLHKDA  234
            +A ++ A+  G KVLV++  +    G   GLGGTCV+ GC+PKK+M  ++   E L++ A
Sbjct  19   MASARRAATFGAKVLVVE--RGRKYGGA-GLGGTCVHYGCVPKKIMFNAATHVEHLNRAA  75

Query  235  EQFGWTVSNA------SFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYENMLGTFKDAH  288
            + +  T + A       FDW  + +    YI  LN  Y  +L + +V         +   
Sbjct  76   D-YSITTNGAHKYQFGDFDWANMKTKRDAYILRLNGIYERNLGNAQVD------LVEGVA  128

Query  289  TLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAISSDDIFSKAEA-PGKTLVV  347
             L   N+ +  G    T +  ++AVGG+P               D F K EA P K  VV
Sbjct  129  KLVAKNQVEVDGVV-YTGKHILVAVGGKP---------------DGFFKLEAQPKKVAVV  172

Query  348  GASYVALECAGFLKGQGFDVTIMVR-SILLRGFDQDIARRIGEYMENESGIAFIKESVPT  406
            GA Y+A+E AG       D ++  R   +LR FD  +   I E  E ++GI F++ S   
Sbjct  173  GAGYIAIEIAGIFNTLKSDTSLFCRFDHVLRTFDPIVRDLINEEGE-KAGINFVRNSRIE  231

Query  407  SIEKLPNGQLKVT  419
             IEK  +G L +T
Sbjct  232  RIEKQADGSLTIT  244

>HYAP_04149
Length=564

 Score = 97.1 bits (240),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 142/553 (26%), Positives = 239/553 (43%), Gaps = 80/553 (14%)

Query  128  AFFRARTQSAPSTGAPSAANAHVSDTSSSDETQYDWDLVVIGGGSGGLACSKEASKLGQK  187
            A  RA   S  ++    A    +++T         +DL+VIG G  G  C+ +++K G  
Sbjct  18   ALSRAVASSRSNSPNLEANKQLLTETLRELRASEHFDLIVIGSGPAGQKCAIDSAKHGYS  77

Query  188  VLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGELLHKDAEQFGWTVSNASFD  247
            V ++D            LGG CV+ G +P K   +++     LH    +      N    
Sbjct  78   VAIVD--------KRDMLGGVCVHTGTVPSKTFREAA-----LHLTGYRH-RAFYNGQAG  123

Query  248  WTKLVSSVQDYIHGLNF--KYRIDLRDKKVKYEN---MLGTFK----DAHTL-TLTNE--  295
             +K V  V+D +  +N   K   D+   ++       + GT +    ++H +  L+NE  
Sbjct  124  PSKRVG-VEDILQRVNKVEKAETDITRHQLMRNGVQLITGTARFMPGNSHMIAVLSNESY  182

Query  296  -----AKKKGPTDVTFR-----RAVIAVGGRP-KPLSCP-GWEHAISSDDIF-SKAEA-P  341
                 AK+    ++  R       ++ VG RP +    P   E    SD +   K +A P
Sbjct  183  ETATDAKRHSSANICKRVLTADNFLVCVGTRPARRADIPFDGETIFDSDQLLWGKVKAVP  242

Query  342  GKTLVVGASYVALECAGFLKG-QGFDVTIMV-RSILLRGFDQDIARRIGEYMENESGIAF  399
             + +VVGA  V +E A  +    G DVT++  R  +L   D++++  +  Y   ++G  F
Sbjct  243  RRLIVVGAGVVGMEYASMMSIIPGTDVTVIDGRKEILEMADKEVSEALC-YSMAQTGTRF  301

Query  400  IKESVPTSIEKLPNGQLKVTHTHGEGIY-DTVLNATGRSPDVQMLNLPAAGVTLNPKSGR  458
            + + V  S+EK   G++ V    G+ +  D +L   GR  +V+ LNL A G+  + K GR
Sbjct  302  LVDEVIKSVEKSAKGEVGVHLESGKTVVGDGLLYTVGRQGNVEGLNLEAVGLAPD-KRGR  360

Query  459  IDVTNE-QTSTPHIYA---------IGDVIDAPELTPVAIQAGKLLARRLFGNGTALMDY  508
            I V N  QT+ PH+YA          GD+I  P L   +++ G+L +  +    T+   Y
Sbjct  361  IIVDNNFQTAVPHMYAQSRLIADQNAGDIIGFPALASTSMEQGRLASVHMR---TSKSFY  417

Query  509  TKICT---------AVFTPVEYGCC---GLSEEDAIASAGRDNIQVYHQNFTPLEWSLSH  556
            TK  +          V T +  G     G+     I+  G++  Q+  +   P E  ++ 
Sbjct  418  TKEISDDKKMDDPDRVRTRMRSGEVFPFGIYTVPEISMVGKNEQQLTREQ-VPYEVGIAR  476

Query  557  ERPLAK-------ECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFV  609
               LAK         + K+I    +  +++G H +G  A E+     V M    T + F 
Sbjct  477  YEELAKGQMLGGVPGFLKIIF-CPKTLKLLGVHAIGEGATEIIHIGQVVMSTDGTLEYFR  535

Query  610  NTVGIHPTTAEIF  622
            N V  +PT AE +
Sbjct  536  NAVFNYPTLAEAY  548

>PHYSO_489418
Length=471

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 118/456 (26%), Positives = 194/456 (43%), Gaps = 41/456 (9%)

Query  205  LGGTCVNVGCIPKKLMHQSSIIGELLHKDAEQFGWTVSNASFDWTKLVSSVQDYIHGLNF  264
            +GG CV+ G +P K   ++++        A   G    +  F    ++  V+        
Sbjct  2    MGGVCVHTGTVPSKTFREAALHLTGYRHKAFYNGQAGPSKRFGVEDILQRVKKVEDAETD  61

Query  265  KYRIDLRDKKVKYENMLGTF---KDAHTLTLTNE-------AKKKGPTDVTFR-----RA  309
              R  L    V+  N    F    +     L+NE       AK+    D+  R     + 
Sbjct  62   ITRHQLMRNGVQLINGTARFLPGNNHMVAVLSNESYETATDAKRHTSADICKRVLTADKF  121

Query  310  VIAVGGRP--KPLSCPGWEHAISSDDIF--SKAEAPGKTLVVGASYVALECAGFLKG-QG  364
            ++ VG RP  +P      E    SD +        P + +VVGA  V +E A  +    G
Sbjct  122  LVCVGTRPARRPDIPFDGETIFDSDQLLWGKVKTVPRRLIVVGAGVVGMEYASMMTIIPG  181

Query  365  FDVTIM-VRSILLRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHTHG  423
             DVT++  R  +L   D++++  +  Y   ++G  F+      S+EK P G++ V    G
Sbjct  182  TDVTVIDGRQEILNMADKEVSEALC-YSMAQTGTRFLVGETIKSVEKTPKGEVFVHLESG  240

Query  424  EGIY-DTVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDVTNE-QTSTPHIYAIGDVIDAP  481
            + +  D +L   GR  +V+ LNL A G+  + K GRI V N  QT+ PHIYA GD+I  P
Sbjct  241  KTVVGDGLLYTVGRQGNVEGLNLEAVGLVPD-KRGRIKVDNNFQTAVPHIYAAGDIIGFP  299

Query  482  ELTPVAIQAGKLLARRLFG----NGTALMDYTKI--CTAVFTPVEYGCC---GLSEEDAI  532
             L   +++ G+L +  +      N   L D  K+     V T +  G     G+     I
Sbjct  300  GLASTSMEQGRLASVHMRTSKPLNNKELSDDKKMDDPDRVRTRMRSGEVFPFGIYTVPEI  359

Query  533  ASAGRDNIQVYHQNFTPLEWSLSHERPLAK-ECYAKL-----IVDTTQQKRVVGFHYLGP  586
            +  G++  Q+  +   P E  ++    LA+ +    L     I+   +  +++G H +G 
Sbjct  360  SMVGKNEQQLTKEQ-VPYEVGMARYEELARGQMLGGLPGFLKIIFCPETLKILGVHAIGE  418

Query  587  NAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIF  622
             A E+     V M    T + F N V  +PT AE +
Sbjct  419  GATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  454

>PHYKE_2864
Length=486

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 122/492 (25%), Positives = 202/492 (41%), Gaps = 89/492 (18%)

Query  163  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  222
            +DLVVIG G     C+ E++K G++V ++D            LGG CV+ G IP K   +
Sbjct  34   YDLVVIGSGPSATQCALESAKQGKRVAIVD--------KKTSLGGVCVHTGTIPSKTFRE  85

Query  223  SSIIGELLHKDAEQ----FGWTVSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYE  278
            +     +LH    +    +G + S  +     ++  VQ  +       R  L+  +V   
Sbjct  86   A-----VLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSETDVVRAQLKAARVDVI  140

Query  279  NMLGTFKDAHTLTLTNEAKKK----------GPTDVTFRRA---VIAVGGRP--KPLSCP  323
                 F++ H +++     +K          G   ++  RA   +IA G RP   PL   
Sbjct  141  PGFARFENEHEISIVRGEDEKSKAVGASASNGLDSLSRVRADKFLIACGTRPAHNPLVPI  200

Query  324  GWEHAISSDDIFSKA--EAPGKTLVVGASYVALECAGFLKG-QGFDVTIMVRSILLRGFD  380
              +  I SD I S+   + P   +VVGA  + +E A  +    G  VT++          
Sbjct  201  DGKVIIDSDQILSRDMHQLPRSLIVVGAGVIGMEYASMVNVVPGHSVTVV----------  250

Query  381  QDIARRIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHTHGEGI-YDTVLNATGRSPD  439
                                 +  P + +K    ++KV    G+ +  D +L   GR   
Sbjct  251  ---------------------DGRPDTTDK----RVKVFFNSGKVLSADALLYTVGRQAS  285

Query  440  VQMLNLPAAGVTLNPKSGRIDVT-NEQTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRL  498
               LNL A G++ N + G I+V  N QT  PHIYA GD I AP L   +++ G+L +  +
Sbjct  286  TDGLNLEAVGLSRNHR-GLINVNKNYQTDQPHIYAAGDCIGAPALASTSMEQGRLASCHM  344

Query  499  FGNGTALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHER  558
            +     L   +++ +  +    YG   + E   I+  G+   Q+  ++    E  ++   
Sbjct  345  WNPDEELAATSQLESGNY---PYGIYTIPE---ISMVGQTEQQLT-KDCVNYEIGIAKYS  397

Query  559  PLAKECYA--------KLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVN  610
             LAK            K++ D    K V G H +G  A E+     VAM +  +   F +
Sbjct  398  ELAKGQMMGAMAGGTLKILFDPDTLK-VFGVHAIGEGATEIIHIGQVAMAMGCSLTYFRD  456

Query  611  TVGIHPTTAEIF  622
             V  +PT AE +
Sbjct  457  AVFNYPTLAEAY  468

>PHALS_09942
Length=496

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 114/457 (25%), Positives = 193/457 (42%), Gaps = 35/457 (8%)

Query  180  EASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKK-LMHQSSIIGELLHKDAEQFG  238
            +A++LG K   ++        S   LGGTC+NVGCIP K L+H + ++    H + + +G
Sbjct  47   KAAQLGMKTACIE--------SRGKLGGTCLNVGCIPSKALLHSTHLLHTAQH-EFKNYG  97

Query  239  WTVSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYENMLGTFKDAHTLTLTNEAKK  298
                  + ++ +++ +    +  L        +  KV Y    G       +++      
Sbjct  98   IDAPEVTANFPQMMKAKDKAVKTLTSGIESLFKKNKVTYIKGSGKISAQGEVSVALH-DH  156

Query  299  KGPTDVTFRRAVIAVGGRPKPLSCPGWEHA----ISSDDIFSKAEAPGKTLVVGASYVAL  354
            KG   V  +  +IA G    PL     ++A    + S         P   +VVGA  + L
Sbjct  157  KGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKIVDSTGALELKRIPDHLVVVGAGVIGL  216

Query  355  ECAGFLKGQGFDVTIM-VRSILLRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKLPN  413
            E     K  G  VT++        G D+   +   + ++ + G+ F K     +  ++  
Sbjct  217  ELGSVYKRLGAKVTVVEYLDDACTGMDKGSVKDFIKLLKKQ-GLEF-KFGTKVTASEING  274

Query  414  GQLKVTHTHGEG------IYDTVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDVTNE-QT  466
              +K+T    +G        DTVL ATGR      L L   G+  + K GRI+V    +T
Sbjct  275  DVVKLTTEPSQGGDAASIECDTVLVATGRRAFTAGLGLEQMGIQTD-KFGRIEVDEAFRT  333

Query  467  STPHIYAIGDVIDAPELTPVAIQAGKLLARRLFGNGTALMDYTKICTAVFTPVEYGCCGL  526
              P I+AIGDVI    L   A + G   A  + G     ++Y  I   ++T  E+   G 
Sbjct  334  QVPGIFAIGDVIKGAMLAHKAEEEGIACAEIIAGK-HGHVNYGAIPGVIYTFPEFASVGK  392

Query  527  SEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAK-ECYAKLIVDTTQQKRVVGFHYLG  585
            +EE+  A     N+  +     P+  + S  R + + +   K++ D    K ++G H + 
Sbjct  393  TEEELKAEGIEYNVGKF-----PM-MANSRARTVGESDGMVKVLADKKTDK-LLGVHIIA  445

Query  586  PNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIF  622
             NAGE+     + ++  A  +D   T   HPT +E F
Sbjct  446  SNAGEMISEGVIGIEYGAASEDVARTSHAHPTLSEAF  482

>PITG_01778
Length=470

 Score = 92.8 bits (229),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 120/460 (26%), Positives = 201/460 (44%), Gaps = 49/460 (11%)

Query  205  LGGTCVNVGCIPKKLMHQSSI-IGELLHKD--AEQFGWTVSNASFDWTKLVSSVQDYIHG  261
            LGG CV+ G +P K   ++++ +    HK     Q G +      D  + V  V+D    
Sbjct  2    LGGVCVHTGTVPSKTFREAALHLTGYRHKAFYNGQAGPSRRFGVEDILQRVRKVEDAETD  61

Query  262  LN----FKYRIDLRDKKVKY----ENMLGTFKDAHTLTLTNEAKKKGPTDVTFR-----R  308
            +      +  + L +   ++    +NM+    +    T T +AK+    D+  R     +
Sbjct  62   ITRHQLLRNGVQLINGTARFLTGNKNMVAVLSNESYETAT-DAKRHTSADICKRVLTADK  120

Query  309  AVIAVGGRP--KPLSCPGWEHAISSDDIF--SKAEAPGKTLVVGASYVALECAGFLKG-Q  363
             ++ VG RP  +P      E    SD +   +    P + ++VGA  V +E A  +    
Sbjct  121  FLVCVGTRPARRPDIPFDGETIFDSDQLLWGNVKSVPRRLIIVGAGVVGMEYASMMTIIP  180

Query  364  GFDVTIM-VRSILLRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHTH  422
            G DVT++  R  +L   D+ ++  +  Y   ++G  F+      S+EK P G++      
Sbjct  181  GTDVTVIDGRQEILNMADKQVSEALC-YSMAQTGTRFLTGETIKSVEKSPKGEVFAHLES  239

Query  423  GEGIY-DTVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDVTNE-QTSTPHIYAIGDVIDA  480
            G+ +  D +L   GR  +V+ LNL A G+  + K GRI V N  QT+ PHIYA GD+I  
Sbjct  240  GKTVVGDGLLYTVGRQGNVEGLNLEAVGLAPD-KRGRIKVDNNFQTAVPHIYAAGDIIGF  298

Query  481  PELTPVAIQAGKLLARRLFG----NGTALMDYTKI--CTAVFTPVEYGCC---GLSEEDA  531
            P L   +++ G+L +  +      N   L D  K+     V T +  G     G+     
Sbjct  299  PGLASTSMEQGRLASVHMRTSKPLNDLELSDDKKMDDPDRVRTRMRSGEVFPFGIYTVPE  358

Query  532  IASAGRDNIQVYHQNFTPLEWSLSHERPLAK-------ECYAKLIV--DTTQQKRVVGFH  582
            I+  G++  Q+  +   P E  ++    LA+         + K+I   DT    ++ G H
Sbjct  359  ISMVGKNEQQLTKEQ-VPYEVGVARYEELARGQMLGGVPGFLKIIFCPDTL---KIFGVH  414

Query  583  YLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIF  622
             +G  A E+     V M    T + F N V  +PT AE +
Sbjct  415  AIGEGATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  454

>PYU1_G001737
Length=133

 Score = 85.9 bits (211),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 59/99 (60%), Gaps = 3/99 (3%)

Query  33   STINYHVVGWKQCPYYVKAASVVSSMQHLFPSQVKATIHEHPNKESFANWLNESQTEFAR  92
            S   YH+ GW+ C ++ KA  V S+MQ L+P  ++ T+HE  ++++F  WL+ S+ +FA 
Sbjct  34   SGTTYHIAGWRGCSFFQKACDVGSAMQVLYPDHLQFTVHEFADRDAFRAWLDVSKDDFAT  93

Query  93   QFDNDARPLKHKSSPFCYLEQDDTPKFVGGCDDTLAFFR  131
             F   +  L H SSPF +    +  +FVGGCD  LA  R
Sbjct  94   HFGATSPALTHTSSPFVW---SNAGEFVGGCDALLATIR  129

>SPRG_04114
Length=376

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 101/370 (27%), Positives = 168/370 (45%), Gaps = 39/370 (11%)

Query  267  RIDLRDKKVKYENMLGTFKDAHTLTLTNEAKKKG----PTDVTFRRAVIAVGGRP--KPL  320
            R+DL     ++EN              NE   +G    PT +  ++ ++A G RP   PL
Sbjct  12   RVDLVPGLARFEN-------------ENEVSVEGDDGQPTRLRGKKFLVACGTRPAHSPL  58

Query  321  SCPGWEHAISSDDIFS--KAEAPGKTLVVGASYVALECAGFLKGQ-GFDVTIM-VRSILL  376
                 +  + SD I +    + P   +VVGA  + +E A  L    G +VT++  R+ +L
Sbjct  59   VPCDGKIILDSDQILNHDTTKLPKSWIVVGAGVIGMEYASMLNVLPGINVTVVDGRAEIL  118

Query  377  RGFDQDIARRIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHTHGEGIY-DTVLNATG  435
               D +I   +   M ++     + ES+  S+E   NG +KV    G+ ++ + +L   G
Sbjct  119  SFCDDEIVSSLKMEMRHKGARFLLGESI-KSVEHFKNG-VKVEFNSGKAMFAEALLYCVG  176

Query  436  RSPDVQMLNLPAAGVTLNPKSGRIDVTNE-QTSTPHIYAIGDVIDAPELTPVAIQAGKLL  494
            R  +   LNL A G++ N + G I V  + QTS PHIYA GD I AP L   +++ G+L 
Sbjct  177  RQANTDGLNLEAVGLSKNHR-GLITVNEQYQTSHPHIYAAGDCIGAPSLASTSMEQGRLA  235

Query  495  ARRLFGNG---TALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPL-  550
            A  ++ +    T+ ++       ++T  E    G +E+         N  V    F+ L 
Sbjct  236  ACDMWSDKDQTTSQLESGNYPYGIYTIPEISMVGKTEQQLTKEGA--NYAVGLAKFSELA  293

Query  551  EWSLSHERPLAKECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVN  610
            +  +S +     E   KL+ D    + ++G H +G  A E+     VAM ++     F +
Sbjct  294  KGQMSGD----IEGILKLLFDPVSLQ-LLGVHAIGHGATEIIHIGQVAMAMNCKITYFRD  348

Query  611  TVGIHPTTAE  620
             V  +PT AE
Sbjct  349  AVFNYPTLAE  358

>H257_07450
Length=567

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 134/532 (25%), Positives = 212/532 (40%), Gaps = 94/532 (18%)

Query  163  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  222
            +DLVVIG G  G  C+ +++K G+KV ++D             GG CV+ G IP K   +
Sbjct  39   FDLVVIGSGPAGQKCAIDSAKHGKKVAIIDKKDMH--------GGVCVHTGTIPSKTFRE  90

Query  223  SSIIGELLHKDAEQFGWTVSNA--------SFDWTKLVSSVQDYIHGLNFKYRIDLRDKK  274
            +     +LH  A +      NA             +++  V+          R  L    
Sbjct  91   A-----VLHLTAHRHKGFYGNAYTASTTGKRLSLEEILDRVKKVEDAETDLTRNQLTRNG  145

Query  275  VKYENMLGTF---KDAHTLTLTNEAKKKGPTD-------------VTFRRAVIAVGGRP-  317
            +   N    F   +D  T+ + +       TD             +T  + +IAVG RP 
Sbjct  146  IILINGTARFLPTEDKKTIAVLSNDSYTEKTDAQRHNDANICKRVLTADKVLIAVGTRPA  205

Query  318  -KPLSCPGWEHAISSDDIF--SKAEAPGKTLVVGASYVALECAGFLKG-QGFDVTIM-VR  372
             +P           SD +        P + +VVGA  + +E A  +    G  VT++  R
Sbjct  206  RRPDLDYDGRLIFDSDQLLWGGVDIVPKRLIVVGAGVIGMEYASMISIIPGTQVTVIDGR  265

Query  373  SILLRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHTHGEGIY-DTVL  431
              +L   D++++  +  YM  + G  F+ E     +E   N ++ V  T G+ I  D +L
Sbjct  266  KEILDMADKEVSDALCYYMR-KRGSRFLTEESIVKVETKDNSEVLVYLTSGKVIVGDALL  324

Query  432  NATGRSPDVQMLNLPAAGVTLNPKSGRIDVTNE-QTSTPHIYAIGDVIDAPELTPVAIQA  490
               GR  +V  L+L A G+  N K G +DV N  QT  PHIYA GD I  P L   +++ 
Sbjct  325  YTQGRQGNVAGLDLEAVGLAAN-KRGVLDVNNNFQTDVPHIYAAGDCIGYPALASTSMEQ  383

Query  491  GKLLA---------RRLFGNGTA---LMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRD  538
            G+L +          +L  +  A       T++ +    P  +G   + E   I+  G+ 
Sbjct  384  GRLASVHMRTSEPTNKLRPDAEAHDPAHPRTRMRSGEVFP--FGIYTVPE---ISMVGKS  438

Query  539  NIQVYHQNFTPLEWSLSHERPLAK-------ECYAKLIVDTTQQKRVVGFHYLGPNAGEV  591
              Q+  +N  P E  ++    LAK         + KLI   T  K ++G H +G  A E+
Sbjct  439  EQQLSRENI-PYEVGIARYEELAKGQMMGGMPGFLKLIFCPTTLK-LLGVHAIGEGATEI  496

Query  592  TQAIGVAMK---------------------LHATYDDFVNTVGIHPTTAEIF  622
                 V M                      +  T + F N V  +PT AE +
Sbjct  497  IHIGQVVMSTGTLIGRLSPTPSLQHVVVGCVGGTMEYFRNAVFNYPTLAEAY  548

>PHYKE_9807
Length=557

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 135/540 (25%), Positives = 215/540 (40%), Gaps = 87/540 (16%)

Query  139  STGAPSAANAHVSDTSSSDETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSP  198
            ST AP   +  V DT         +DL+VIG G  G  C+ +++K G+ V ++D      
Sbjct  33   STEAPVEKSVLV-DTLRELRASEHFDLIVIGSGPAGQKCAIDSAKHGKSVAIVD------  85

Query  199  VGSTWGLGGTCVNVGCIPKKL-MH------------QSSIIGELLHKDAEQFGWTVSNAS  245
                  LGG CV+ G   ++  MH               I   +  +D  Q    V  A 
Sbjct  86   --KRDMLGGVCVHTGTTFREAAMHLTGYRHRAFYNGHGGISKRIGVEDILQRVKKVEAAE  143

Query  246  FDWTK---------LVSSVQDYIHGLNFKYRIDLRDKKVKYENMLGTFKDAHTLTLTNEA  296
             D T+         L+S    ++ G +               +ML    +    T T+ A
Sbjct  144  TDITRHQLQRNGVQLISGTARFLAGDS---------------HMLAVLSNEEYETATD-A  187

Query  297  KKKGPTDVTFR-----RAVIAVGGRPK--PLSCPGWEHAISSDDIF--SKAEAPGKTLVV  347
            K+    D+  R     + ++ VG RP   P      E    SD +        P + ++V
Sbjct  188  KRHTEADICKRVLTADKFLVCVGTRPARHPDIPFDGETIFDSDQLLWGKVKMVPRRLIIV  247

Query  348  GASYVALECAGFLKG-QGFDVTIM-VRSILLRGFDQDIARRIGEYMENESGIAFIKESVP  405
            G   V +E A  +    G DVT++  R  +L   D++++  +  Y   ++G  F+     
Sbjct  248  GGGVVGMEYASMMTIIPGTDVTVIDGRKEILNMADKEVSEALC-YSMAQTGTRFLVGETI  306

Query  406  TSIEKLPNGQLKVTHTHGEGIY-DTVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDVTNE  464
              +EK   G++ V    G+ +  D +L   GR  +V+ L+L + G+  + K GRI V N 
Sbjct  307  KKVEKNSKGEVLVRLDSGKTVVGDGLLYTVGRQGNVEGLHLESVGIHPD-KRGRIKVDNN  365

Query  465  -QTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLFGNGTA------------LMDYTKI  511
             QT  PHIYA GD+I  P L   +++ G+L +  +                  LMD    
Sbjct  366  FQTEVPHIYAAGDIIGFPGLASTSMEQGRLASVHMRTASPVATKPSKELPDDKLMDDPDR  425

Query  512  CTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAK-------EC  564
                    E    G+     I+  G+ N Q   Q   P E  ++    LA+         
Sbjct  426  MRTRMRSGEVFPFGIYTVPEISMVGK-NEQQLTQEQVPYEVGMARYEELARGQMLGGVPG  484

Query  565  YAKLIV--DTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIF  622
            + K+I   +T Q   ++G H +G  A E+     V M    T + F N V  +PT AE +
Sbjct  485  FLKIIFCPNTLQ---ILGVHAIGEGATEIIHIGQVVMSTGGTLEYFRNAVMNYPTLAEAY  541

>CCI39993
Length=550

 Score = 87.4 bits (215),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 129/530 (24%), Positives = 217/530 (41%), Gaps = 75/530 (14%)

Query  143  PSAANAHVSDTSSSDETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGST  202
            PS     ++D     +    +DL+VIG G  G  C+ +++K G+ V ++D  +       
Sbjct  25   PSPKTTALTDMLRDLKASEHYDLIVIGSGPAGQKCAIDSAKHGKSVAIIDKNEMH-----  79

Query  203  WGLGGTCVNVGCIPKKLMHQSSIIGELLHKDA--------------EQFGW--------T  240
               GG CV+ G +P K   ++     +LH  A              ++FG          
Sbjct  80   ---GGVCVHTGTVPSKTFREA-----ILHLTAHRHRNFYTGLSSPKKRFGIEDILTRVRK  131

Query  241  VSNASFDWTK--LVSSVQDYIHGLNFKYRIDLRDKKVKYENMLGTFKDAHTLTLTNEAKK  298
            V NA  D T+  LV +  + I+G   ++  D   K + Y+  +   K         E   
Sbjct  132  VENAETDITRHQLVRNNVELING-TARFLPDPSKKMLYYQ--IAHLKQQRMEIAIFELIF  188

Query  299  KGPTDVTFRRAVIAVGGRPKPLSCPGW--EHAISSDDIF--SKAEAPGKTLVVGASYVAL  354
                 +T  + +IAVG RP       +  +    SD I        P + +VVGA  + +
Sbjct  189  VNGKILTADKFLIAVGTRPARRDDIVFDGQMIFDSDQILWGGVKSVPKRLIVVGAGVIGM  248

Query  355  ECAGFLKG-QGFDVTIM-VRSILLRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKLP  412
            E A  +    G  VT++  R  +L   D+++   +  Y   ++G  F  E     +E   
Sbjct  249  EYASMMSIIPGAQVTVIDGRKEILEMADREVVEAL-TYAMRQTGSRFYMEETIKCVELSN  307

Query  413  NGQLKVTHTHGEGIY-DTVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDVT-NEQTSTPH  470
              ++ +    G+ I  D +L   GR  + + L+L A G+  + K G I V  N QTS PH
Sbjct  308  KDEVIIHLNSGKTIVGDGLLYTVGRQGNTEGLDLSAIGLQTD-KRGLIKVNENFQTSVPH  366

Query  471  IYAIGDVIDAPELTPVAIQAGKL----LARRLFGNGTALMD-------YTKICTAVFTPV  519
            IYA GD    P L   +++ G+L    +   +  N +   +        T++ +  F P 
Sbjct  367  IYAAGDCTGFPALASTSMEQGRLASVHMRTSMPTNTSGHAEPTDPQHMRTRMRSGDFFP-  425

Query  520  EYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAK-------ECYAKLIVDT  572
             +G   + E   I+  G++  Q+  +     E  ++    LAK         + K+I   
Sbjct  426  -FGIYTVPE---ISMVGKNEYQLTKEGIA-YEVGVARYEELAKGQMLGGVPGFLKIIFCP  480

Query  573  TQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIF  622
            T    ++G H +G  A E+     V M    T + F N V  +PT AE +
Sbjct  481  TTLN-ILGVHAIGEGATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  529

>CCA14030
Length=560

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 125/532 (23%), Positives = 220/532 (41%), Gaps = 71/532 (13%)

Query  139  STGAPSAANAHVSDTSSSDETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSP  198
            S    S   A ++D     +    +DL+V+G G  G  C+ +++K G+ V ++D  +   
Sbjct  31   SKSVSSPKTAVLTDMLRDLKASEHYDLIVVGSGPAGQKCAIDSAKHGKSVAIIDKNEMH-  89

Query  199  VGSTWGLGGTCVNVGCIPKKLMHQSSIIGELLHKDAEQF-----GWTVSNASFDWTKLVS  253
                   GG CV+ G +P K   ++     +LH  A +      G +     F    +++
Sbjct  90   -------GGVCVHTGTVPSKTFREA-----ILHLTAHRHRNFYTGMSSPKKRFGIEDILT  137

Query  254  SVQ-------DYIHGLNFKYRIDLRDKKVKY-----ENMLGTFKDAHTLTLTNEAKKKGP  301
             V+       D       +  ++L +   ++     +NM+    ++   T T+  +    
Sbjct  138  RVRKVENAETDITRHQLVRNNVELINGTARFLPDPSKNMVAVLSNSSYETATDGNRHFRA  197

Query  302  TD----VTFRRAVIAVGGRPKPLSCPGWEHAI--SSDDIF--SKAEAPGKTLVVGASYVA  353
                  +T  + +IAVG RP       ++  +   SD I        P + +VVGA  + 
Sbjct  198  NICQRILTADKFLIAVGTRPARRDDVVFDGQMIFDSDQILWGGVKSVPKRLIVVGAGVIG  257

Query  354  LECAGFLKG-QGFDVTIM-VRSILLRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKL  411
            +E A  +    G  VT++  R  +L   D+++   +  Y   ++G  F  E     +E L
Sbjct  258  MEYASMMSIIPGAQVTVIDGRKEILEMADREVVEAL-TYAMRQTGSRFYMEETIKCVE-L  315

Query  412  PNGQLKVTHTH-GEGIY-DTVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDVT-NEQTST  468
             N    +TH + G+ +  D +L   GR  + + L+L A G+  + K G I V  N QTS 
Sbjct  316  SNKDEVITHLNSGKTVVGDGLLYTVGRQGNTEGLDLSAIGLETD-KRGLIKVNENFQTSV  374

Query  469  PHIYAIGDVIDAPELTPVAIQAGKL----LARRLFGNGTALMD-------YTKICTAVFT  517
            PHIYA GD    P L   +++ G+L    +   +  N T   +        T++ +  F 
Sbjct  375  PHIYAAGDCTGFPALASTSMEQGRLASVHMRTSMPTNTTGHAEPTDPQHMRTRMRSGDFF  434

Query  518  PVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAK-------ECYAKLIV  570
            P      G+     I+  G++  Q+  +     E  ++    LAK         + K+I 
Sbjct  435  PF-----GIYTVPEISMVGKNEHQLTKEGIA-YEVGVARYEELAKGQMLGGVPGFLKIIF  488

Query  571  DTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIF  622
              T    ++G H +G  A E+     V M    T + F N V  +PT AE +
Sbjct  489  CPTTLN-ILGVHAIGEGATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  539

>PYAR_16664
Length=577

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 104/381 (27%), Positives = 166/381 (44%), Gaps = 61/381 (16%)

Query  163  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLM--  220
            +DL+VIG G  G  C+ + +K G+ V ++D            +GG C++ G +P K    
Sbjct  64   FDLIVIGSGPAGQKCAIDHAKHGKSVAIID--------KRDMVGGVCIHTGTVPSKTFRE  115

Query  221  ---------HQSSIIGELLHK------DAEQFGWTVSNASFDWTK--LVSSVQDYIHG--  261
                     H+S   GE   K      D  Q    V +A  D T+  L+ +  + I+G  
Sbjct  116  AILHLTAHRHRSFYDGESEPKKRFGIEDVLQRVRKVESAETDITRHQLLRNGIELINGTA  175

Query  262  -----------LNFKYRIDLRDKKVKY-----ENMLGTFKDAHTLTLTNEAKKKGPTDVT  305
                       +  +  I+L +   ++       M+    +    T T+  K+    D+ 
Sbjct  176  RFXXXXCDRALILLRNGIELINGTARFLPDPSMKMVAVLSNDSYDTPTD-TKRHTSADIC  234

Query  306  FR-----RAVIAVGGRP-KPLSCPGWEHAI-SSDDIF--SKAEAPGKTLVVGASYVALEC  356
             R     + +IAVG RP +    P     I  SD I        P + +VVGA  + +E 
Sbjct  235  KRVLTADKFLIAVGTRPARREDIPFDGKTIFDSDQILWGGVDAVPKRLIVVGAGVIGMEY  294

Query  357  AGFLKG-QGFDVTIMV-RSILLRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKLPNG  414
            A  +    G +VT++  R  +L   D+++A  + +Y   +SG  F  +    S+EK  NG
Sbjct  295  ASMMSIIPGSEVTVIDGRKEILDMADKEVAEAL-KYAMRQSGTRFYTDETIKSVEKAANG  353

Query  415  QLKVTHTHGEGIY-DTVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDVT-NEQTSTPHIY  472
            ++ V    G+ I  D +L   GR      LNL A G+  + K G + V  N +TS PHIY
Sbjct  354  EVIVKLNSGKTIIGDGLLYTVGRQGSTDGLNLAAVGLETD-KRGLLQVDDNFRTSVPHIY  412

Query  473  AIGDVIDAPELTPVAIQAGKL  493
            A GD I  P L   +++ G+L
Sbjct  413  AAGDCIGYPALASTSMEQGRL  433

>H310_02523
Length=494

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 110/449 (24%), Positives = 180/449 (40%), Gaps = 39/449 (9%)

Query  194  VKPSPVGSTWGLGGTCVNVGCIPKK-LMHQSSIIGELLHKDAEQFGWTVSNASFDWTKLV  252
            +K + V +   LGGTC+NVGCIP K L+H + +     H D +  G  V N S D+ +L+
Sbjct  51   LKTACVEARGTLGGTCLNVGCIPSKALLHGTHLYHAAQH-DFKSVGIKVDNVSIDFNQLM  109

Query  253  SSVQDYIHGLNFKYRIDLRDKKVKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIA  312
             S +  +  L        +  KV Y    G       L++       G   +  +  +IA
Sbjct  110  KSKEKTVKILTGGIEGLFKKNKVDYVKGFGKIVAKGQLSVA--LNGGGNQTLHTKNILIA  167

Query  313  VGGR-----PKPLSCPGWEHAISSDDIFSKAEAPGKTLVVGASYVALECAGFLKGQGFDV  367
             G       P P+   G +  + S    S    P   +VVG   + LE        G  +
Sbjct  168  TGSEVTPLPPVPVDNEGGK-IVDSTGALSLKRIPNHLVVVGGGVIGLEMGSVYGRLGSKI  226

Query  368  TIM-VRSILLRGFDQDIARRIGEYMENESGIAFI-----------KESVPTSIEKLPNGQ  415
            T++     +    D ++ +   + +  + G+ F             ++V  ++E    G 
Sbjct  227  TVVEYADKICPTMDHELTKEFQKLLTKQ-GMTFKLGQKVTASKVDGDTVTLTVEPAAGGD  285

Query  416  LKVTHTHGEGIYDTVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDV--TNEQTSTPHIYA  473
                        D VL ATGR P    L L   G+  + + GRI V  +N QT+   IYA
Sbjct  286  ATTIEA------DCVLVATGRRPYTAGLGLEDMGIQTD-RFGRIKVNLSNFQTNVDGIYA  338

Query  474  IGDVIDAPELTPVAIQAGKLLARRLFGNGTALMDYTKICTAVFTPVEYGCCGLSEEDAIA  533
            IGDVI+   L   A + G  +   + G     ++Y  I   ++T  E    G +EE+  A
Sbjct  339  IGDVIEGAMLAHKAEEEGIAVVETIAGK-HGHVNYDAIPGVIYTFPEVASVGKTEEELKA  397

Query  534  SAGRDNIQVYHQNFTPLEWSLSHERPLAKECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQ  593
            +    N+  +         ++       K   AK         +++G H +  NAGE+  
Sbjct  398  ANVAYNVGKFPMMANSRARAVGETDGFVKVLAAK------DDDKILGIHIIASNAGEMIS  451

Query  594  AIGVAMKLHATYDDFVNTVGIHPTTAEIF  622
               + ++  A+ +D   T   HPT +E F
Sbjct  452  EGVLGIEYGASAEDIGRTCHAHPTLSEAF  480

>PITG_19065
Length=416

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 106/412 (26%), Positives = 179/412 (43%), Gaps = 47/412 (11%)

Query  240  TVSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYENMLGTFKDAHTLTLT-NEAKK  298
            T+ +  +   ++VSS +D +       R  L+  +V        F++ H +++  +E  K
Sbjct  5    TIEDILYRVQRVVSSEEDVV-------RAQLKAARVDVVPGFARFENEHEISIVRDEDDK  57

Query  299  KGPTDVTFRRAV------------IAVGGRP--KPLSCPGWEHAISSDDIFSKA--EAPG  342
            K  + VT R  V            IA G RP   PL     +  I SD I S+   + P 
Sbjct  58   KKNSSVTGRSNVDSLSRIKADKFLIACGTRPAHNPLIPIDGKVVIDSDQILSRDMHQLPR  117

Query  343  KTLVVGASYVALECAGFLKG-QGFDVTIMV-RSILLRGFDQDIARRIGEYMENESGIAFI  400
              +V+GA  + +E A  +    G  VT++  R  +L   D++I   +   M++      +
Sbjct  118  SLIVLGAGVIGMEYASMVNVVPGHTVTVVDGRPDILSFCDREIISNLTYEMQSNGARFLL  177

Query  401  KESVPTSIEKLPNGQLKVTHTHGEGI-YDTVLNATGRSPDVQMLNLPAAGVTLNPKSGRI  459
             E+V     +  + ++KV    G+ +  D +L   GR      LNL A G++ N + G I
Sbjct  178  GETVKKV--ETTDKRVKVFFNSGKALSADALLYTVGRQAATDGLNLEAVGLSRNHR-GLI  234

Query  460  DVT-NEQTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLFGNGTALMDYTKICTAVFTP  518
            +V  N QT  PHIYA GD I AP L   +++ G+L +  ++     L   +++    +  
Sbjct  235  NVNKNYQTDQPHIYAAGDCIGAPALASTSMEQGRLASCHMWNPDEELAATSQLENGNYP-  293

Query  519  VEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAKECYA--------KLIV  570
              YG   + E   I+  G+   Q+  ++    E  ++    LAK            K++ 
Sbjct  294  --YGIYTIPE---ISMVGQTEQQLT-KDCVNYEIGIAKYSELAKGQMMGAMAGGTLKILF  347

Query  571  DTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIF  622
            D    K V G H +G  A E+     VAM +  +   F + V  +PT AE +
Sbjct  348  DPDTLK-VFGVHAIGEGATEIIHIGQVAMAMGCSLTYFRDAVFNYPTLAEAY  398

>H257_16541
Length=494

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 111/444 (25%), Positives = 181/444 (41%), Gaps = 29/444 (7%)

Query  194  VKPSPVGSTWGLGGTCVNVGCIPKK-LMHQSSIIGELLHKDAEQFGWTVSNASFDWTKLV  252
            +K + + S   LGGTC+NVGCIP K L+H + +     H + +  G  V N S D+ +L+
Sbjct  51   LKTACIESRGSLGGTCLNVGCIPSKALLHGTHLYHSAQH-NFKSVGIKVDNVSIDFDQLM  109

Query  253  SSVQDYIHGLNFKYRIDLRDKKVKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIA  312
             S    +  L        +  KV Y    G       +++   A   G   V  +  +IA
Sbjct  110  KSKDKTVKILTGGIEGLFKKNKVDYIKGYGKVVAKGQVSVALNA--GGNQTVNTKNILIA  167

Query  313  VGGR-----PKPLSCPGWEHAISSDDIFSKAEAPGKTLVVGASYVALECAGFLKGQGFDV  367
             G       P P+   G +  I S    +    P   +VVG   + LE        G  +
Sbjct  168  TGSEVTPLPPVPVDNEGGK-IIDSTGALALKRVPKHLVVVGGGVIGLEMGSVYGRLGSKI  226

Query  368  TIM-VRSILLRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKLPNGQLKVT---HTHG  423
            T++     +    D ++ +   + +  + G+ F K     +  K+    + +T      G
Sbjct  227  TVVEYADKICPTMDHEVTKEFQKLLTKQ-GMTF-KLGQKVTASKVDGDVVTLTVEPAAGG  284

Query  424  EGI---YDTVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDV--TNEQTSTPHIYAIGDVI  478
            E      D VL ATGR P    L L   G+  + K GRI V  +N QT+   I+AIGDVI
Sbjct  285  EATTIEADCVLVATGRRPFTAGLGLEEMGIQTD-KFGRIKVNLSNFQTNVDGIFAIGDVI  343

Query  479  DAPELTPVAIQAGKLLARRLFGNGTALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRD  538
            +   L   A + G  +   + G     ++Y  I   ++T  E    G +EE+   +    
Sbjct  344  EGAMLAHKAEEEGIAVVETIAGK-HGHVNYDAIPGVIYTFPEVASVGKTEEELKTANVAY  402

Query  539  NIQVYHQNFTPLEWSLSHERPLAKECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVA  598
            N+  +         ++       K   AK         +++G H +  NAGE+     + 
Sbjct  403  NVGKFPMMANSRARAVGETDGFVKVLAAK------DDDKILGIHIIASNAGEMISEGVLG  456

Query  599  MKLHATYDDFVNTVGIHPTTAEIF  622
            ++  A+ +D   T   HPT +E F
Sbjct  457  IEYGASAEDIGRTCHAHPTLSEAF  480

>HYAP_08069
Length=255

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/214 (29%), Positives = 101/214 (47%), Gaps = 15/214 (7%)

Query  162  DWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKK-LM  220
            D+DLVVIGGG GG   + +A++LG        +K + V S   LGGTC+NVGCIP K L+
Sbjct  34   DYDLVVIGGGPGGYVAAIKAAQLG--------LKTACVESRGKLGGTCLNVGCIPSKALL  85

Query  221  HQSSIIGELLHKDAEQFGWTVSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYENM  280
            H + ++    H + + +G    N + ++ +++ + +  +  L           KV Y   
Sbjct  86   HSTHLLHTAQH-EFKSYGIDAPNVTANFPQMMKAKEKAVRTLTAGIESLFSKNKVTYIKG  144

Query  281  LGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPL-SCPGWEHA---ISSDDIFS  336
            +G       +++T  A ++G   +T +  ++A G    PL   P    A   + S    +
Sbjct  145  VGKLAAKGQVSVT-LADRQGNGTLTAKNIILATGSEVTPLPPVPVDNDAGKIVDSTGALA  203

Query  337  KAEAPGKTLVVGASYVALECAGFLKGQGFDVTIM  370
                P   +VVGA  + LE     K  G  VT++
Sbjct  204  LTRVPEHLVVVGAGVIGLELGSVYKRLGAKVTVV  237

>PYIR_21896
Length=518

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 125/506 (25%), Positives = 204/506 (40%), Gaps = 88/506 (17%)

Query  162  DWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMH  221
            ++DLVVIG G     C+ E++K G++V V+D         T+ +GG CV+ G IP K   
Sbjct  37   NYDLVVIGSGPSATQCAIESAKKGKRVAVVDK-------KTF-VGGVCVHTGTIPSKTFR  88

Query  222  QSSI-IGELLHKDAEQFGWTVSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYENM  280
            ++ + +    H       +++   + D               +  YR+    + V  E  
Sbjct  89   EAVLHLSGYRHHGFYGKSYSMKTVTID---------------DILYRVK---RVVNSEVD  130

Query  281  LGTFKDAHTLTLTNEAKKKGPTD------VTFRRA---VIAVGGRP--KPLSCPGWEHAI  329
            +   +D    T        G +D      V+  RA   +IA G RP   PL     +   
Sbjct  131  ISIVRD----TPDAAGGDAGDSDHDAANTVSRLRADKFLIACGTRPAHNPLVPIDGKVIF  186

Query  330  SSDDIFSK--AEAPGKTLVVGASYVALECAGFLKG-QGFDVTIM-VRSILLRGFDQDIAR  385
             SD I S    E P   +VVGA  + +E A  +    G  VT++  RS +L   D +I  
Sbjct  187  DSDQILSGDIRELPRSLIVVGAGVIGMEYASMMNVVPGHSVTVVDGRSEILSFCDDEIIS  246

Query  386  RIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHTHGEGIYDTVLNATGRSPDVQMLNL  445
             +   M ++     + E++   +EK  +G     ++      D +L   GR      LNL
Sbjct  247  NLTYEMRSKGARFLLGETIK-HVEKTESGVTVHFNSGKITSADALLYTVGRQAATDGLNL  305

Query  446  PAAGVTLNPKSGRIDVTNE-QTSTPHI------------------YAIGDVIDAPELTPV  486
             A  ++ NP+ G + V    QT+ PH+                  YA GD I AP L   
Sbjct  306  EAVDLSRNPR-GLLTVNKSYQTNQPHMPVLQMGFAHSISDENVCSYAAGDCIGAPSLAST  364

Query  487  AIQAGKLLARRLFGNGTALMDYTKICTAVFTPVEYGC--CGLSEEDAIASAGRDNIQVYH  544
            +++ G+L A  ++     L         V + +E G    G+     I+  G+   Q+  
Sbjct  365  SMEQGRLAACHMWDQEEQL---------VTSQLENGNYPYGIYTIPEISMVGKTEQQLTK  415

Query  545  QNFTPLEWSLSHERPLAKECYA--------KLIVDTTQQKRVVGFHYLGPNAGEVTQAIG  596
            +     E  ++    LAK   +        K++ D T  K + G H +G  A E+     
Sbjct  416  EGLN-FEIGIAKYSELAKGQMSGSTAGGMLKILFDPTTLK-LFGVHAIGEGATEIIHIGQ  473

Query  597  VAMKLHATYDDFVNTVGIHPTTAEIF  622
            VAM +  +   F + V  +PT AE +
Sbjct  474  VAMAMGCSITYFRDAVFNYPTLAEAY  499

>PPTG_13000
Length=387

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 92/338 (27%), Positives = 146/338 (43%), Gaps = 26/338 (8%)

Query  299  KGPTDVTFRRAVIAVGGRPKPLSCPGWEHA----ISSDDIFSKAEAPGKTLVVGASYVAL  354
            KG   V  +  +IA G    PL     ++A    I S         P   +VVGA  + L
Sbjct  48   KGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKIIDSTGALELKRVPEHLVVVGAGVIGL  107

Query  355  ECAGFLKGQGFDVTIM-VRSILLRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKLPN  413
            E     K  G  VT++        G D++  +   + ++ + G+ F   +  TS E   N
Sbjct  108  ELGSVYKRLGAKVTVVEFLDAACPGMDKEAVKEFTKLLKKQ-GLDFKFGTKVTSSE--VN  164

Query  414  GQL-KVTHTHGEG------IYDTVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDVTNE-Q  465
            G + K+T    +G        DTVL ATGR      L L   G+  + K GRI+V +  +
Sbjct  165  GDVVKLTTEPSKGGDASTIECDTVLVATGRRAFTAGLGLEQMGIQTD-KLGRIEVDDAFR  223

Query  466  TSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLFGNGTALMDYTKICTAVFTPVEYGCCG  525
            T  P I+AIGDVI    L   A + G      + G     ++Y  +   ++T  E+   G
Sbjct  224  TQVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAGK-HGHVNYGAVPGVIYTFPEFASVG  282

Query  526  LSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAK-ECYAKLIVDTTQQKRVVGFHYL  584
             +EE+  A     N+  +     P+  + S  R +A+ +   K++ D    K ++G H +
Sbjct  283  KTEEELKAEGIEYNVGKF-----PM-MANSRARTVAESDGLVKVLADKKTDK-LLGVHII  335

Query  585  GPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIF  622
              NAGE+     + ++  A  +D   T   HPT +E F
Sbjct  336  ASNAGEMIAEGVIGIEYGAASEDLARTCHAHPTLSEAF  373

>PHYSO_562795
Length=415

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 100/409 (24%), Positives = 174/409 (43%), Gaps = 42/409 (10%)

Query  240  TVSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYEN-----MLGTFKDAHTLTLTN  294
            T+ +  +   ++V S +D +       R+D+     ++E+     ++    DA   +  +
Sbjct  5    TIEDILYRVQRVVRSEEDVVRAQLKAARVDVIPGFARFESEHEISVVRDEADAKRSSSNS  64

Query  295  EAKKKGPTDVTFRRAVIAVGGRP--KPLSCPGWEHAISSDDIFSKA--EAPGKTLVVGAS  350
             +     + V   + +IA G RP   PL     +  I SD I S+   + P   +V+GA 
Sbjct  65   SSNLDSLSRVMADKFLIACGTRPAHNPLVPIDGKVIIDSDQILSRDMHQLPRSLIVMGAG  124

Query  351  YVALECAGFLKG-QGFDVTIMV-RSILLRGFDQDIARRIGEYMENESGIAFIKESVPTSI  408
             + +E A  +    G  VT++  R  +L   D++I   +   M++      + E+V   +
Sbjct  125  VIGMEYASMVNVVPGHSVTVVDGRPDILSFCDREIISNLTYEMQSNGARFLLGETVK-KV  183

Query  409  EKLPNGQLKVTHTHGEGI-YDTVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDVT-NEQT  466
            E   N ++KV    G+ +  D +L   GR      LNL A G++ N + G I+V  N QT
Sbjct  184  ETTEN-RVKVFFDSGKVLSADALLYTVGRQASTDGLNLEAVGLSRNHR-GLINVNQNYQT  241

Query  467  STPHIYAIGDVIDAPELTPVAIQAGKLLARRLFG-----NGTALMDYTKICTAVFTPVEY  521
              PHIYA GD I AP L   +++ G+L +  ++        T+ +D       ++T  E 
Sbjct  242  DQPHIYAAGDCIGAPALASTSMEQGRLASCHMWNPDEELKVTSQLDNGNYPYGIYTIPEI  301

Query  522  GCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAKECYA--------KLIVDTT  573
               G +E            Q   ++    E  ++    LAK            K++ D  
Sbjct  302  SMVGQTE------------QQLTKDCVNYEVGIAKYSELAKGQMMGAMAGGTLKILFDPD  349

Query  574  QQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIF  622
              K + G H +G  A E+     VAM +  +   F + V  +PT AE +
Sbjct  350  TLK-LFGVHAIGEGATEIIHIGQVAMAMGCSLTYFRDAVFNYPTLAEAY  397

>HYAP_13613
Length=423

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 57/234 (24%), Positives = 95/234 (41%), Gaps = 34/234 (15%)

Query  148  AHVSDTSSSDETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGG  207
            A ++ T S       +DLVVIG G     C+ +++K G++V ++D            LGG
Sbjct  18   ARLTSTQSQLSPVSSYDLVVIGSGPSATQCALDSAKQGKRVAIVD--------KKTRLGG  69

Query  208  TCVNVGCIPKKLMHQSSIIGELLHKDAEQ----FGWTVSNASFDWTKLVSSVQDYIHGLN  263
             CV+ G IP K   ++     +LH    +    +G + S  +     ++  VQ  +    
Sbjct  70   VCVHTGTIPSKTFREA-----VLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSEE  124

Query  264  FKYRIDLRDKKVKYENMLGTFKDAHTLTLTNEAKKK-------------GPTDVTFRRAV  310
               R  L+  +V        F+ AH +++  E   K               T V   + +
Sbjct  125  DVVRAQLKAARVDVIPGFARFESAHEISIVKEGAAKDKAETGQCSNNMDARTRVRADKFL  184

Query  311  IAVGGRP--KPLSCPGWEHAISSDDIFSKA--EAPGKTLVVGASYVALECAGFL  360
            +A G RP   PL     +  I SD I  +   + P   +VVGA  + +E A  +
Sbjct  185  VACGTRPAHNPLVPIDGKIVIDSDQILKRGMQQLPRSLIVVGAGVIGMEYASMI  238

>PPTG_24712
Length=67

 Score = 48.9 bits (115),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 43/62 (69%), Gaps = 3/62 (5%)

Query  163  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  222
            +D +VIGGGSGG+A ++ A+  G KVLV++  +        GLGGTCVN GC+PKK+M  
Sbjct  7    YDYMVIGGGSGGMASARRAATFGAKVLVVERGREF---DGMGLGGTCVNFGCVPKKVMFN  63

Query  223  SS  224
            ++
Sbjct  64   TA  65

>SPRG_04231
Length=90

 Score = 47.4 bits (111),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 30/52 (58%), Gaps = 0/52 (0%)

Query  574  QQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIFTTL  625
            + K VVG H  G  A E+ Q  GVA+K+ A   DF N V IHPT +E   T+
Sbjct  9    KDKTVVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  60

>PITG_19802
Length=185

 Score = 48.9 bits (115),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 43/157 (27%), Positives = 71/157 (45%), Gaps = 9/157 (6%)

Query  467  STPHIYAIGDVIDAPELTPVAIQAGKLLARRLFGNGTALMDYTKICTAVFTPVEYGCCGL  526
            S P I+AIGDVI    L   A + G      + G     ++Y  I   ++T  E+   G 
Sbjct  23   SVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAGK-HGHVNYGAIPGVIYTFPEFASVGK  81

Query  527  SEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAK-ECYAKLIVDTTQQKRVVGFHYLG  585
            +EE+  A     N+  +     P+  + S  R +A+ +   K++ D    K ++G H + 
Sbjct  82   TEEELKAEGIEYNVGKF-----PM-MANSRARTIAEADGLVKVLADKKTDK-LLGVHIIA  134

Query  586  PNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIF  622
             NAGE+     + ++  A  +D   T   HPT +E F
Sbjct  135  GNAGEMIAEGVIGIEYGAASEDLARTCHAHPTLSEAF  171

>PITG_18935
Length=480

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 80/171 (47%), Gaps = 11/171 (6%)

Query  151  SDTSSSDETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCV  210
            S T+ +  +  D+D+VVIGGG GG   + +A++LG K   ++        S   LGGTC+
Sbjct  18   SVTARALSSSSDYDVVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGKLGGTCL  69

Query  211  NVGCIPKK-LMHQSSIIGELLHKDAEQFGWTVSNASFDWTKLVSSVQDYIHGLNFKYRID  269
            NVGCIP K L+H + ++    H D + +G        ++ +++ S +  +  L     + 
Sbjct  70   NVGCIPSKALLHSTHLLHTAQH-DFKSYGIDAPEVKANFPQMMKSKEKAVKTLTGGIELL  128

Query  270  LRDKKVKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPL  320
             +  KV Y    G       +++      KG   V  +  +IA G    PL
Sbjct  129  FKKNKVTYIKGHGKISAQGEISVALN-DNKGNETVKAKNIIIATGSEVTPL  178

>SPRG_18643
Length=85

 Score = 38.1 bits (87),  Expect = 0.015, Method: Composition-based stats.
 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 8/70 (11%)

Query  131  RARTQSAP--STGAPSAANAHVSDTSS------SDETQYDWDLVVIGGGSGGLACSKEAS  182
            R+R  +AP    G  + A A   D SS      +      +DLVVIG G  G  C+ +++
Sbjct  9    RSRRAAAPMLRAGLSTEAEAKADDASSFTNILRNLRASEHFDLVVIGSGPSGQKCAIDSA  68

Query  183  KLGQKVLVLD  192
            K G+KV ++D
Sbjct  69   KHGKKVAIID  78

>PHYCA_524942
Length=1028

 Score = 41.6 bits (96),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 62/245 (25%), Positives = 98/245 (40%), Gaps = 24/245 (10%)

Query  278  ENMLGTFKDAHTLTLTNEAKK------KGPT----DVTFRRAVIAVGGRPKPLSCPGWEH  327
            EN +    +   L L    KK       G T    +V + R VIA G        PG + 
Sbjct  70   ENEIDLMTNVQALALDTANKKLLCQRLNGDTPMQFEVPYDRIVIATGASALVPRLPGTK-  128

Query  328  AISSDDIFSKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSI------LLRGFDQ  381
             +    ++         +  G     +E AG  K    D+ + VR I      + R  D 
Sbjct  129  -LRGVFVYRSIADLNNIIEHGEKQAKIEAAGAAKAV-HDLNVSVRIINRGTQLMSRQLDA  186

Query  382  DIARRIGEYMENESGIAFIKE-SVPTSIEKLPNGQLKVTHTHGEGIYD--TVLNATGRSP  438
            D A+ +   + N+ GI  + E S    I    NG   V  T+GE   D   ++ ATG  P
Sbjct  187  DGAKVLHNEIVNKFGIDVLYEKSTQEIIGSQENGVEAVQFTNGERFDDICMIIFATGIKP  246

Query  439  DVQMLNLPAAGVTLNPKSGRIDVTNEQTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRL  498
              ++ +  ++G+ L  + G +     + S P +YA+G+ I   +LT   +  G  +A  L
Sbjct  247  RDELAH--SSGLELGNRGGILINDFLECSVPDVYALGECISHRDLTYGLVAPGYEMADVL  304

Query  499  FGNGT  503
              N T
Sbjct  305  AKNFT  309

>PHALS_10960
Length=702

 Score = 41.2 bits (95),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 59/239 (25%), Positives = 101/239 (42%), Gaps = 39/239 (16%)

Query  241  VSNASFDWTKLVSSVQDYIHGLN-FKYRIDLRDKKVKYENMLGTFKDAHTLTLTNEAKKK  299
            V    F+  K++   +++   L  F+ ++ L    VK+    G   DA  LT  +     
Sbjct  408  VIGGQFNMAKIIPGKEEFHETLRYFQKQLKLNGVNVKH----GRRVDAADLTAGD-----  458

Query  300  GPTDVTFRRAVIAVGGRPKPLSCPGWEH--AISSDDIFSKAEAPGKTL-VVGASYVALEC  356
                  F + V+A G  P+PL  PG +H   +S  D+  K    G+ + ++GA  +  + 
Sbjct  459  ------FDKVVMASGVLPRPLKIPGADHPMVLSYMDVLKKKSKVGQRVAIIGAGGIGFDV  512

Query  357  AGFLKGQGFDVTIMVRSILLRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKLPNGQL  416
            A FL   G   +  V  +  R +  D    +        G+A IK SVP    ++   Q 
Sbjct  513  AEFLTHVGESTSSSV-EVFAREWGIDTTNSV------RGGVAGIKSSVPPPAREIYLMQR  565

Query  417  KVTHTHGEGIYDT---VLNATGRSPDVQML------NLPAAGVTLNPKSGR---IDVTN  463
            K T  HG+ +  T   +   + +  +V+M+       +  AG+    KSG+   +DV N
Sbjct  566  KSTK-HGKDLGKTTGWIHRLSLKHRNVKMIGGVSYDKVDDAGLHYTDKSGKKQILDVDN  623

>PITG_00703
Length=703

 Score = 39.3 bits (90),  Expect = 0.087, Method: Compositional matrix adjust.
 Identities = 55/221 (25%), Positives = 90/221 (41%), Gaps = 35/221 (16%)

Query  230  LHKDAEQFGWTVSNASFDWTKLVSSVQDYIHGLN-FKYRIDLRDKKVKYENMLGTFKDAH  288
            L   AE  G       F+  K +   +++   L  F+ ++ L+  KVK    LG   +A 
Sbjct  402  LFDQAEAIG-----GQFNMAKTIPGKEEFYETLRYFEKQLKLKGVKVK----LGQHVEAA  452

Query  289  TLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEH--AISSDDIF-SKAEAPGKTL  345
             LT              F + VIA G  P+ L  PG +H   +S  D+  +KA    K  
Sbjct  453  DLTTG-----------AFDKVVIATGVLPRALKIPGADHPKVLSYLDVLKNKAPVGNKVA  501

Query  346  VVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGEYMENESGIAFIKESVP  405
            ++GA  +  + A FL   G   +  V  +  R +  D    +        G+A +K S+P
Sbjct  502  IIGAGGIGFDVAEFLAHVGESTSSSV-DVFAREWGIDTTNSV------RGGVAGVKPSIP  554

Query  406  TSIEKLPNGQLKVTHTHGEGIYDT---VLNATGRSPDVQML  443
                 +   Q K T  HG+ +  T   +   + +  DV+M+
Sbjct  555  PPARDIYLMQRKSTK-HGKDLGKTTGWIHRLSLKHRDVKMI  594

>H310_04551
Length=723

 Score = 38.1 bits (87),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 60/238 (25%), Positives = 89/238 (37%), Gaps = 56/238 (24%)

Query  159  TQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKK  218
            TQ+   L V+G G  GLAC+  A+  G  V + D  K   +G  + L         IP K
Sbjct  376  TQHKLKLAVVGAGPAGLACASVAAMRGHDVTLFD--KHDEIGGQFNLAKK------IPGK  427

Query  219  LMHQSSIIGELLHKDAEQFGWTVSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYE  278
                     E  ++    FG  ++    D   ++  V           ++D  + KVK  
Sbjct  428  ---------EEFYETLRYFGTNLA----DLMNIMVIVAK---------QLDKHEVKVK--  463

Query  279  NMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWE---HAISSDDIF  335
              LG    A  L            D  F R V+A G  P+ L   G +     +S  D+ 
Sbjct  464  --LGHTVSAQDL-----------IDAKFDRVVMATGITPRKLKIEGADTSPKVVSYIDVL  510

Query  336  SKAEAPGKTL-VVGASYVALECAGFLKGQG----FDVTIMVRSILLRGFDQDIARRIG  388
            +     GK + VVGA  +  + A F    G     DV +  +     G D+ + RR G
Sbjct  511  NGTVTLGKRVAVVGAGGIGFDVAEFATHTGTSPSLDVDLYAKEW---GIDRTMTRRGG  565

>PHYCA_46557
Length=357

 Score = 37.7 bits (86),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 26/88 (30%), Positives = 37/88 (42%), Gaps = 11/88 (13%)

Query  80   ANW----LNESQTEFARQFDNDARPLKHKSSPFCYLEQDDTPKFVGGCDDTLAFFRARTQ  135
            ANW    +  + T  A   +       + S+PF  L   D P +V      +A+F    Q
Sbjct  119  ANWFPPHMRATSTSVAVNANAMGTAFVYLSAPFIVLSSTDVPYWVATVSWVIAYF--FFQ  176

Query  136  SAPSTGAPSAANAHVSDTSSSDETQYDW  163
            S P TG    A + +SD    DE  Y+W
Sbjct  177  SFPKTG---VAQSIISDVQLRDE--YEW  199

>PPTG_08060
Length=725

 Score = 38.1 bits (87),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 51/205 (25%), Positives = 85/205 (41%), Gaps = 30/205 (15%)

Query  246  FDWTKLVSSVQDYIHGLN-FKYRIDLRDKKVKYENMLGTFKDAHTLTLTNEAKKKGPTDV  304
            F+  K +   +++   L  F+ ++ L+   VK    LG   +A  LT             
Sbjct  435  FNMAKTIPGKEEFYETLRYFEKQLKLKGVNVK----LGQHVEAADLTTG-----------  479

Query  305  TFRRAVIAVGGRPKPLSCPGWEH--AISSDDIFS-KAEAPGKTLVVGASYVALECAGFLK  361
             F + VIA G  P+ L  PG +H   +S  D+   KA    K  ++GA  +  + A FL 
Sbjct  480  AFDKVVIATGVLPRTLKIPGADHPKVLSYIDVLKHKAPVGKKVAIIGAGGIGFDVAEFLS  539

Query  362  GQGFDVTIMVRSILLRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHT  421
              G   +  V  +  R +  D    +        G+A IK S+P    ++   Q K T  
Sbjct  540  HVGESTSSSV-DVFAREWGIDTTNSV------RGGVAGIKPSIPPQAREIYLMQRKSTK-  591

Query  422  HGEGIYDT---VLNATGRSPDVQML  443
            HG+ +  T   +   + +  DV+M+
Sbjct  592  HGKDLGKTTGWIHRLSLKHRDVKMI  616

>PYIW_27568
Length=128

 Score = 35.4 bits (80),  Expect = 0.29, Method: Composition-based stats.
 Identities = 19/56 (34%), Positives = 28/56 (50%), Gaps = 1/56 (2%)

Query  567  KLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIF  622
            K+I D    K ++G H +  NAGE+     + M+  A  +D   T   HPT +E F
Sbjct  60   KVIADKATDK-ILGVHIIASNAGEMISEGVLGMEYGAASEDIARTCHAHPTLSEAF  114

>PITG_13013
Length=1046

 Score = 37.4 bits (85),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 56/224 (25%), Positives = 92/224 (41%), Gaps = 25/224 (11%)

Query  303  DVTFRRAVIAVGGRPKPLSCPG--------WEHAISSDDIFSKAEAPGK----------T  344
            +V + R VIA G        PG        +      + I + AE   K           
Sbjct  108  EVPYDRVVIATGASALVPQLPGASLHGVFVYRSIADLNSIIAHAEKQAKLEATGSAKKYA  167

Query  345  LVVGASYVALECAGFLKGQGFDVTIMVRS--ILLRGFDQDIARRIGEYMENESGIAFIKE  402
            LV+G   + LE A  +      V I+ R   ++ R  D D A+ +   + N+ GI  + E
Sbjct  168  LVIGGGLLGLEAAKAVHDLKLSVRIIDRGTRLMSRQLDADGAKVLHNEIVNKFGIDVLYE  227

Query  403  -SVPTSIEKLPNGQLKVTHTHGEGIYDT--VLNATGRSPDVQMLNLPAAGVTLNPKSGRI  459
             S    I    +G   V  T+GE   +   V+ ATG  P  ++ +  ++G+ L  + G +
Sbjct  228  KSTQEIIGTEESGVEAVEFTNGERFDNVCMVIFATGIKPRDELAH--SSGLELAKRGGIL  285

Query  460  DVTNEQTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLFGNGT  503
                 + S P++Y IG+ I   ++T   +  G  +A  L  N T
Sbjct  286  INDYLECSEPYVYGIGECISHRDVTYGLVAPGYEMADTLAKNLT  329

>HYAP_03065
Length=701

 Score = 37.0 bits (84),  Expect = 0.45, Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 56/124 (45%), Gaps = 21/124 (17%)

Query  246  FDWTKLVSSVQDYIHGLN-FKYRIDLRDKKVKYENMLGTFKDAHTLTLTNEAKKKGPTDV  304
            F+  K+V   +++   L  F+ ++ LR   VK    LG   +A  L              
Sbjct  411  FNMAKIVPGKEEFYETLRYFEKQLKLRGVNVK----LGHRVEAAELM-----------SG  455

Query  305  TFRRAVIAVGGRPKPLSCPGWEH--AISSDDIFSKAEAP--GKTLVVGASYVALECAGFL  360
             F + VIA G  P+ L+ PG +H   +S  D+  K EAP   K  ++GA  +  + A FL
Sbjct  456  AFDKVVIATGVVPRSLTIPGADHPKVLSYIDVL-KNEAPVGQKVAIIGAGGIGFDVAEFL  514

Query  361  KGQG  364
              +G
Sbjct  515  THEG  518

>PHYSO_507629
Length=703

 Score = 37.0 bits (84),  Expect = 0.47, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 47/105 (45%), Gaps = 14/105 (13%)

Query  306  FRRAVIAVGGRPKPLSCPGWEH--AISSDDIF-SKAEAPGKTLVVGASYVALECAGFLKG  362
            F + VIA G  P+ L  PG +H   +S  D+  +KA    K  V+GA  +  + A F+  
Sbjct  459  FDKVVIATGVLPRELKIPGADHPKVLSYIDVLKNKAPVGKKVAVIGAGGIGFDVAEFITH  518

Query  363  QGFDVTIMVRSILLRGFDQDIARRIGEYMEN--ESGIAFIKESVP  405
             G   +  V +          AR  G  M N    G+A IK S+P
Sbjct  519  VGESTSSSVDA---------FAREWGIDMTNSVRGGVAGIKPSIP  554

>PYAP_15943
Length=139

 Score = 34.7 bits (78),  Expect = 0.55, Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (64%), Gaps = 0/33 (0%)

Query  160  QYDWDLVVIGGGSGGLACSKEASKLGQKVLVLD  192
            Q  WD VV+GGG  GL  +   +K G++V VL+
Sbjct  11   QRKWDAVVVGGGHNGLVAAAYLAKAGKRVCVLE  43

>CCI40989
Length=552

 Score = 36.6 bits (83),  Expect = 0.56, Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 34/75 (45%), Gaps = 8/75 (11%)

Query  163  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  222
            WD V+IGGG  GL  +   +K G++V VL+            +GG  V     P  L  +
Sbjct  14   WDAVIIGGGHNGLVAAAYLAKAGKQVCVLE--------KRHVIGGAAVTEEIFPGFLFSR  65

Query  223  SSIIGELLHKDAEQF  237
            +S +  L   D  ++
Sbjct  66   ASYVFSLFRPDIIEY  80

>SPRG_17626
Length=148

 Score = 34.3 bits (77),  Expect = 1.0, Method: Composition-based stats.
 Identities = 29/121 (24%), Positives = 53/121 (44%), Gaps = 6/121 (5%)

Query  502  GTALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLA  561
            G   ++Y  I   V+T  E    G +EE+  A+    N+  +     P+  + S  R + 
Sbjct  20   GHGHVNYNAIPGVVYTFPEVASVGKTEEELKAANVAYNVGKF-----PM-MANSRARTVG  73

Query  562  KECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEI  621
            +      I+      +++G H +  NAGE+     + ++  A+ +D   T   HPT +E 
Sbjct  74   ETDGFVKILAAKDDDKILGIHIIASNAGEMISEGVLGLEYGASAEDIGRTCHAHPTLSEA  133

Query  622  F  622
            F
Sbjct  134  F  134

>PYAR_15823
Length=705

 Score = 35.4 bits (80),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 73/298 (24%), Positives = 115/298 (39%), Gaps = 61/298 (20%)

Query  230  LHKDAEQFGWTVSNASFDWTKLVSSVQDYIHGLN-FKYRIDLRDKKVKYENMLGTFKDAH  288
            L++ A + G       F+  K++   +++   L  F  ++ L+  KVK    LG    A 
Sbjct  415  LYEQANEIG-----GQFNMAKVIPGKEEFHETLRYFGQQLKLKGVKVK----LGQRVSAD  465

Query  289  TLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEH--AISSDDIFSKAEAPGKTL-  345
             L               F R V+A G  P+ L  PG +H   +S  D+       GK + 
Sbjct  466  DLIAGG-----------FDRVVVATGVEPRELKIPGADHPKVVSYIDVLKHNAPVGKKVA  514

Query  346  VVGASYVALECAGFLKGQG----FDVTIMVRSILLRGFDQDIARRIGEYMENESGIAFIK  401
            VVGA  +  + + F+   G     D+ +  +     GFD     R         GIA +K
Sbjct  515  VVGAGGIGFDVSEFVTHHGKSPSLDINLFAKEW---GFDLTNTAR--------GGIAGVK  563

Query  402  ESVPTSIEKLPNGQLKVTHTHGEGIYDTVLNATG--RSPDVQMLNLPAAGVTLNPKSGRI  459
              +P    ++   Q K T  HG+ +  T    TG      ++  N+  AG+ +  K G+ 
Sbjct  564  PELPPVPRQVYLLQRKST-KHGKDLGKT----TGWIHRASLKSRNVDDAGLHITDKKGQE  618

Query  460  DVTNEQTSTPHIYAIGDVIDAPELTPV------------AIQAGKLLARRLFGNGTAL  505
             V +  T    I   G V       P+            A +AG+L A+R    GT L
Sbjct  619  KVLDVDTV---IVCAGQVPLRELEEPLKKAGITVFRIGGADEAGELDAKRAIDQGTRL  673

>SPRG_14085
Length=340

 Score = 35.0 bits (79),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 48/102 (47%), Gaps = 13/102 (13%)

Query  197  SPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGELLHKDAEQFGWTVSNASFDWTKLVSSVQ  256
            S VG+TW    T +++ C+  + M    +   L  +DA         ASF W+  ++ +Q
Sbjct  133  SLVGATWN---TPMDLQCV-MEYMDAGDLRDHLSRQDA---------ASFPWSAKITCLQ  179

Query  257  DYIHGLNFKYRIDLRDKKVKYENMLGTFKDAHTLTLTNEAKK  298
              +HGL + + + +  + +K  N+L   K  + L     AK+
Sbjct  180  AVVHGLGYLHSLSIIHRDLKSRNVLLDTKKGYKLVDFGIAKE  221

>HYAP_08068
Length=100

 Score = 32.7 bits (73),  Expect = 1.4, Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 1/56 (2%)

Query  567  KLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIF  622
            K++ D    K ++G H +  NAGE+     + ++  A  +D   T   HPT +E F
Sbjct  17   KVLADKKTDK-LLGVHIIASNAGEMISEGVIGIEYGAASEDLARTCHAHPTLSEAF  71

>PHYSO_317690
Length=1057

 Score = 35.4 bits (80),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 38/147 (26%), Positives = 65/147 (44%), Gaps = 11/147 (7%)

Query  366  DVTIMVRSI------LLRGFDQDIARRIGEYMENESGIAFI-KESVPTSIEKLPNGQLKV  418
            D+ + VR I      + R  D D A+ +   + N+ GI  +  +S    +    NG   V
Sbjct  193  DLKVAVRVINRGTQLMSRQLDADGAKVLHNEIVNKFGIDVLYDKSTQEILGSEENGVEAV  252

Query  419  THTHGEGIYDT--VLNATGRSPDVQMLNLPAAGVTLNPKSGRIDVTNEQTSTPHIYAIGD  476
              T+GE   D   ++ ATG  P  ++ +  ++G+ L  + G +     + S P +YA+G+
Sbjct  253  QFTNGERFDDVCMIIFATGIKPRDELAH--SSGLELAKRGGILINDYLECSAPSVYALGE  310

Query  477  VIDAPELTPVAIQAGKLLARRLFGNGT  503
             I     T   +  G  +A  L  N T
Sbjct  311  CISHRNFTYGLVAPGYEMADTLAKNFT  337

>H310_06296
Length=590

 Score = 35.0 bits (79),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 6/57 (11%)

Query  142  APSAANAHVSDTS------SSDETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLD  192
            AP A +  ++D        +S +   D D++VIG G GGL  +   +K G++VLVL+
Sbjct  36   APIAVDVTLTDDELVKQGFASKKVPDDLDVIVIGSGMGGLTVAAALAKEGKRVLVLE  92

>PYVX_21196
Length=604

 Score = 34.7 bits (78),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 66/144 (46%), Gaps = 14/144 (10%)

Query  306  FRRAVIAVGGRPKPLSCPGWEHA--ISSDDIF-SKAEAPGKTLVVGASYVALECAGFLKG  362
            F + V+A G  P+ L  PG +H+  +S  D+  +KA    K  V+GA  +  + + FL  
Sbjct  458  FDKVVMATGVLPRALKIPGSDHSKVLSYIDVLKNKAPVGEKVAVIGAGGIGFDVSEFLTH  517

Query  363  QGFDVTIMVRSILLRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHTH  422
            +G   ++ +  +  R +  D    +        G+A +  SVP    ++   Q K T  H
Sbjct  518  KGKSASLDI-DLFAREWGIDTTNSV------RGGVAGVTPSVPPPAREVFLMQRKTTK-H  569

Query  423  GEGIYDT---VLNATGRSPDVQML  443
            G+ +  T   +  ++ +  DV M+
Sbjct  570  GKDLGKTTGWIHRSSLKHRDVHMI  593

>PYU1_G004385
Length=562

 Score = 34.3 bits (77),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (65%), Gaps = 0/34 (0%)

Query  159  TQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLD  192
            T+  WD +V+GGG  GL  +   +K G++V VL+
Sbjct  9    TRKKWDAIVVGGGHNGLVAAAYLAKAGKQVCVLE  42

>H257_05020
Length=713

 Score = 34.3 bits (77),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 75/209 (36%), Gaps = 66/209 (32%)

Query  159  TQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKK  218
            TQY   + V+G G  GLAC+  A++ G  V + D  K   +G  + L         IP K
Sbjct  379  TQYPLKVAVVGAGPAGLACASVAAERGHDVTLYD--KHEEIGGQFNLAKQ------IPGK  430

Query  219  LMHQSSIIGELLHKDAEQFGWTVSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYE  278
                     E  ++    FG  +                  HG+  +             
Sbjct  431  ---------EEFYETLRYFGKQIKK----------------HGVKVQ-------------  452

Query  279  NMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAISSDDIFSKA  338
              LG + DA  L            D  F R V+A G  P+ L+  G   A SS  + S  
Sbjct  453  --LGQYVDAQHL-----------IDNQFDRVVMATGITPRKLTIEG---AASSPKVVSYV  496

Query  339  EAPGKTLVVGASYVALECAGFLKGQGFDV  367
            +     + +G   VA+  AG   G GFDV
Sbjct  497  DVLNGNVTLG-HRVAIVGAG---GIGFDV  521

>H257_05019
Length=713

 Score = 34.3 bits (77),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 75/209 (36%), Gaps = 66/209 (32%)

Query  159  TQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKK  218
            TQY   + V+G G  GLAC+  A++ G  V + D  K   +G  + L         IP K
Sbjct  379  TQYPLKVAVVGAGPAGLACASVAAERGHDVTLYD--KHEEIGGQFNLAKQ------IPGK  430

Query  219  LMHQSSIIGELLHKDAEQFGWTVSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYE  278
                     E  ++    FG  +                  HG+  +             
Sbjct  431  ---------EEFYETLRYFGKQIKK----------------HGVKVQ-------------  452

Query  279  NMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAISSDDIFSKA  338
              LG + DA  L            D  F R V+A G  P+ L+  G   A SS  + S  
Sbjct  453  --LGQYVDAQHL-----------IDNQFDRVVMATGITPRKLTIEG---AASSPKVVSYV  496

Query  339  EAPGKTLVVGASYVALECAGFLKGQGFDV  367
            +     + +G   VA+  AG   G GFDV
Sbjct  497  DVLNGNVTLG-HRVAIVGAG---GIGFDV  521

>PITG_02760
Length=165

 Score = 32.7 bits (73),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 0/30 (0%)

Query  163  WDLVVIGGGSGGLACSKEASKLGQKVLVLD  192
            WD +V+GGG  GL  +   +K G+ V VL+
Sbjct  12   WDAIVVGGGHNGLVAASYLAKAGKSVCVLE  41

>SDRG_06501
Length=623

 Score = 33.9 bits (76),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 23/35 (66%), Gaps = 0/35 (0%)

Query  158  ETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLD  192
            E   D D+++IGGG+ G A +   +K G+KVLV +
Sbjct  120  EANRDADVIIIGGGTTGCAMAMGLAKQGKKVLVFE  154

>SPRG_11641
Length=623

 Score = 33.9 bits (76),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 23/35 (66%), Gaps = 0/35 (0%)

Query  158  ETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLD  192
            E   D D+++IGGG+ G A +   +K G+KVLV +
Sbjct  120  EANRDADVIIIGGGTTGCAMAMGLAKQGKKVLVFE  154

>PHYKE_6590
Length=1054

 Score = 33.9 bits (76),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 34/131 (26%), Positives = 61/131 (47%), Gaps = 5/131 (4%)

Query  374  ILLRGFDQDIARRIGEYMENESGIAFIKE-SVPTSIEKLPNGQLKVTHTHGEGIYDT--V  430
            ++ R  D+D A+ +   + N+ GI  + E S    +    NG   V  T+GE   D   +
Sbjct  204  LMSRQLDEDGAKVLHNEIVNKFGIDVLYEKSTQGILGTKENGVEGVEFTNGETFDDVCMI  263

Query  431  LNATGRSPDVQMLNLPAAGVTLNPKSGRIDVTNEQTSTPHIYAIGDVIDAPELTPVAIQA  490
            + ATG  P  ++ +  ++G+ L  + G +     + ST ++YA+G+ I     T   +  
Sbjct  264  IFATGIKPRDELAH--SSGLELAKRGGILINDYLECSTSNVYALGECISHRNATYGLVAP  321

Query  491  GKLLARRLFGN  501
            G  +A  L  N
Sbjct  322  GYEMADTLAKN  332

>SDRG_02521
Length=503

 Score = 33.5 bits (75),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 22/92 (24%), Positives = 43/92 (47%), Gaps = 13/92 (14%)

Query  199  VGSTWGLGGTCVNVGCIPKKLMHQSSIIGELLHKDAEQFGWTVSNASFDWTKLVSSVQDY  258
            VG+TW    T +++ C+  + M    +   L  +DA         ASF W+  +  +Q  
Sbjct  296  VGATWN---TPMDLQCV-MEYMDAGDLRDHLNRQDA---------ASFPWSAKIVCLQAV  342

Query  259  IHGLNFKYRIDLRDKKVKYENMLGTFKDAHTL  290
            ++GL + + + +  + +K  N+L   K  + L
Sbjct  343  VYGLGYLHSLSIIHRDLKSRNVLLDTKKGYKL  374

>H257_04036
Length=1049

 Score = 33.9 bits (76),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 55/126 (44%), Gaps = 17/126 (13%)

Query  149  HVSDTSSSDETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGT  208
            HV+ + S        D+V+ GGG+G  +C  +  + G     ++++   P G+T  + G 
Sbjct  427  HVAASDSKMSRDKGADVVLFGGGAGAASCELQVPEPG----TVEFMVAMP-GTTCLINGL  481

Query  209  CVNVGCIPKKLMHQSSI------IGELLH------KDAEQFGWTVSNASFDWTKLVSSVQ  256
             + VG  P+ L H  ++      +  +++      +D        SN+  DW    + +Q
Sbjct  482  PLTVGAAPRPLAHGDTLTCGRRNVFRVVNPNAPSQEDDHDNQHVRSNSRKDWLDRGAVLQ  541

Query  257  DYIHGL  262
             Y H L
Sbjct  542  SYRHPL  547

>PYAR_16461
Length=526

 Score = 33.1 bits (74),  Expect = 5.4, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 25/43 (58%), Gaps = 2/43 (5%)

Query  163  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGL  205
            W  V++GG +  LAC+K++ KL  K+   DY K  PV   W L
Sbjct  331  WGEVILGGEAQMLACNKDSGKL--KIWSSDYPKEMPVCGRWIL  371

>H310_10842
Length=879

 Score = 33.5 bits (75),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 41/78 (53%), Gaps = 2/78 (3%)

Query  131  RARTQSAPSTGAPSAANAHVSDTSSSDE-TQYDWDLVVIGGGSGGLACSKEASKLGQKVL  189
            RAR   A + GA + A+  +S T+S  E      D+VVIGGGS G +      +LG   +
Sbjct  8    RARRIPATARGASNVASRCMSGTTSPREDLPSSADVVVIGGGSIGASTLYHLGRLGINAV  67

Query  190  VLDYVKPSPVGSTWGLGG  207
            +L+  + +  G+TW   G
Sbjct  68   LLEKDQMT-AGTTWHSAG  84

>PYVX_18330
Length=558

 Score = 33.1 bits (74),  Expect = 6.2, Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 20/30 (67%), Gaps = 0/30 (0%)

Query  163  WDLVVIGGGSGGLACSKEASKLGQKVLVLD  192
            WD +V+GGG  GL  +   +K G++V VL+
Sbjct  13   WDAIVVGGGHNGLVAASYLAKAGKQVCVLE  42

>PHYKE_5677
Length=211

 Score = 32.3 bits (72),  Expect = 6.3, Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 0/30 (0%)

Query  163  WDLVVIGGGSGGLACSKEASKLGQKVLVLD  192
            WD +V+GGG  GL  +   +K G+ V VL+
Sbjct  12   WDAIVVGGGHNGLVAAAYLAKAGKNVCVLE  41

>H310_07705
Length=546

 Score = 33.1 bits (74),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 30/68 (44%), Gaps = 8/68 (12%)

Query  163  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  222
            WD +V+GGG  GL  +   +K G+ V VL+            LGG  V    +P     +
Sbjct  12   WDAIVVGGGHNGLVAATYLAKAGKAVCVLE--------KRHVLGGAAVTEEIVPNFRFSR  63

Query  223  SSIIGELL  230
            +S +  L 
Sbjct  64   ASYVFSLF  71

>SPRG_08354
Length=550

 Score = 33.1 bits (74),  Expect = 6.6, Method: Compositional matrix adjust.
 Identities = 21/68 (31%), Positives = 30/68 (44%), Gaps = 8/68 (12%)

Query  163  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  222
            WD V++GGG  GL  +   +K G+ V VL+            LGG  V    IP     +
Sbjct  15   WDAVIVGGGHNGLVAATYLAKAGKSVCVLE--------KRHLLGGAAVTEEIIPNFHFSR  66

Query  223  SSIIGELL  230
            +S +  L 
Sbjct  67   ASYVFSLF  74

>SDRG_05159
Length=551

 Score = 32.7 bits (73),  Expect = 7.4, Method: Compositional matrix adjust.
 Identities = 21/68 (31%), Positives = 30/68 (44%), Gaps = 8/68 (12%)

Query  163  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  222
            WD V++GGG  GL  +   +K G+ V VL+            LGG  V    IP     +
Sbjct  15   WDAVIVGGGHNGLVAATYLAKAGKSVCVLE--------KRHLLGGAAVTEEIIPDFHFSR  66

Query  223  SSIIGELL  230
            +S +  L 
Sbjct  67   ASYVFSLF  74

>PYU1_G014369
Length=703

 Score = 32.7 bits (73),  Expect = 7.8, Method: Compositional matrix adjust.
 Identities = 38/148 (26%), Positives = 64/148 (43%), Gaps = 22/148 (15%)

Query  306  FRRAVIAVGGRPKPLSCPGWEHA--ISSDDIFSKAEAPGKTL-VVGASYVALECAGFL--  360
            F + VIA G  P+ L  PG +H+  +S  D+       GK + V+GA  +  + + FL  
Sbjct  459  FDKVVIATGVLPRDLKIPGGDHSKVLSYIDVLKHKAPVGKRVAVIGAGGIGFDVSEFLTH  518

Query  361  --KGQGFDVTIMVRSILLRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKLPNGQLKV  418
              K    DV +  +     G D   + R         G+  +K+ VP    ++   Q K 
Sbjct  519  IGKSASLDVNLFAKEW---GIDTSNSVR--------GGVQGVKQEVPAPEREVYLMQRKS  567

Query  419  THTHGEGIYDT---VLNATGRSPDVQML  443
            T  HG+ +  T   +   + +  DV+M+
Sbjct  568  TK-HGKDLGKTTGWIHRLSLKHRDVKMI  594

>SDRG_11610
Length=1317

 Score = 33.1 bits (74),  Expect = 8.1, Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 41/96 (43%), Gaps = 9/96 (9%)

Query  324   GWEHAISSDDIFSKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDI  383
              W+H     DI S  +A  + L+ GAS +A E A  +  Q    + +     L GFD   
Sbjct  1166  SWQHLALVLDIVSDDKASVRVLLDGASVLAKEIAVKMTSQSDSSSALQLGPRLVGFDMTE  1225

Query  384   AR---------RIGEYMENESGIAFIKESVPTSIEK  410
              R         +I +  EN  GIA  K+ +  +I +
Sbjct  1226  IRLWATSRSVEQINDMKENYLGIAETKKRIKVAIHQ  1261

>PYAR_18823
Length=545

 Score = 32.7 bits (73),  Expect = 8.9, Method: Compositional matrix adjust.
 Identities = 60/222 (27%), Positives = 90/222 (41%), Gaps = 45/222 (20%)

Query  128  AFFRARTQSAPSTGAPS---------AANAHVSDTSSSDETQYDWDLVVIGGGSGGLACS  178
            A+ R R  S PS   P          AA A  +D  S D +  ++ LV++G G  G    
Sbjct  18   AWTRLRVLSTPSALGPGKHAPILEQIAATAAQTDGESPDHSS-NYQLVIVGTGWAGYDLL  76

Query  179  KEASKLGQKV-LVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGELLHKDAEQF  237
             +  K  + + LVL               G  ++V  I K+ + +S     L  KD +  
Sbjct  77   TQCKKHRKDIELVL---------------GRPLDVVVISKRNV-RSGTSSYLSDKD-DSL  119

Query  238  GWTVSNASFDWTKLVSSVQDYIHGLNFKYRID-LRDKKVKYENMLGTFKDAHTLTLTNEA  296
            G    N  F +T L++S    +  L F+  I+ LRD + ++EN    F  A   T+  + 
Sbjct  120  G--SHNYHFLYTPLLASTT--VGTLEFRSIIEPLRDSEFRHEN---DFHVAAVKTIDAQN  172

Query  297  KKKGPT--------DVTFRRAVIAVGGRPKPLSCPGW-EHAI  329
            K+   T         V +   V+A G RP     PG  EHA 
Sbjct  173  KEVHVTGEVNGREYKVKYDALVVACGARPMTFGLPGVEEHAF  214

>PYIR_17441
Length=187

 Score = 31.6 bits (70),  Expect = 9.5, Method: Compositional matrix adjust.
 Identities = 15/49 (31%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query  363  QGFDVTIMVRSILLRGFDQDIARR-IGEYMENESGIAFIKESVPTSIEK  410
            Q F +   +R     G D+D AR+ + E+ +N S IA + +S  T++++
Sbjct  32   QNFGIDETLRRFFANGLDRDAARKLVNEWTKNASTIAAMAKSQRTAVQQ  80

Lambda      K        H        a         alpha
   0.317    0.133    0.400    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 50030615082

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40