Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
H257_084361475364264232800.0
H310_085901475364064530190.0
SPRG_141031475362860424600.0
SDRG_167201475362860424590.0
PYIR_134521475364561020980.0
PYAP_177619907562260719860.0
PHYCA_5561601475364963219810.0
PHYKE_83911475377863119790.0
PYIW_199721475360960719660.0
PITG_184521475385663019170.0
HYAP_070951475361361718220.0
PYAR_135699907549449018050.0
PHYSO_3489011475352652817810.0
PHALS_064811475364461717560.0
PHYRA_508551475348949017460.0
PYVX_181701475351054116990.0
SPRG_0407412408750949711083e-144
SDRG_1440812408752851011008e-143
SDRG_038221356704944756547e-77
PYAR_17512109045335066506e-76
SDRG_12187109044624796378e-75
SDRG_03823114284974756363e-74
PYAP_21882109045024826346e-74
SDRG_111311368074944746328e-74
H310_144471462305014596321e-73
SDRG_150451241574944746276e-73
PPTG_09787114284934846223e-72
SPRG_11769109044534796175e-72
PYIR_17506109045094896154e-71
PHYRA_72037114284934846144e-71
SPRG_05609114284964756145e-71
PITG_14083114284934846092e-70
PHYSO_254571109044894846083e-70
PHALS_08068109044974876074e-70
CCI11048114284964656041e-69
PHYSO_550665114284914846041e-69
PHYCA_504517114284934846013e-69
PHYKE_103271090612004936313e-69
PYIW_25301109045124836015e-69
H257_170371462304984605996e-69
HYAP_08763114284734655951e-68
CCA23647114284964655934e-68
PHALS_09136114284934795891e-67
PPTG_18033109045004855892e-67
PHYRA_71927109044854965846e-67
PYAP_234351008029514795982e-65
H257_09722114285184825622e-63
H310_11259114285194815605e-63
PHYKE_6836114284934875551e-62
PITG_13427109044634715452e-61
PHYCA_7619109044624725269e-59
PYVX_21517109044825035014e-55
HYAP_04843109044303924844e-53
PYIR_23431114284684624771e-51
PYAR_177141008024444764573e-49
PYVX_16175114284464654416e-47
CCA22989124014944713708e-37
CCI10477124014944703629e-36
PYAP_226451707615654753621e-34
PYU1_G014259109042442193193e-32
SPRG_199431356703432513264e-32
PYIR_20273124015054873354e-32
HYAP_12621124015014773257e-31
PYVX_21248124015024453212e-30
H257_01186151564964763026e-28
SDRG_14446151564954782982e-27
PHYRA_7388315665515032957e-27
PYAR_20075170764694382831e-25
H310_00561151564974802841e-25
CCI50816151568074822835e-25
PHYRA_47253151564814892786e-25
PYU1_G011605151565244942797e-25
PYVX_20512151565284882797e-25
CCA16670151565204842787e-25
PYIW_251901648732061852592e-24
PYIW_19795151565194832752e-24
PHYRA_72215124014994422724e-24
PPTG_09121151565204922724e-24
PHALS_10055151565164922691e-23
PYIR_1413215665134992691e-23
PHYSO_556052124015004432681e-23
PPTG_0093815665505022682e-23
PYAR_16840151565365042672e-23
PHYCA_123621124014954572662e-23
PITG_15359124014964572644e-23
PHALS_1202815665795042621e-22
PHYKE_9680124014984412573e-22
PHYCA_555180151565214962583e-22
SDRG_06945124014924842546e-22
PYU1_G00569915665505032557e-22
SPRG_09825124014924832521e-21
PYAP_19280151565124882493e-21
H310_0764115665485102494e-21
PYVX_2349915665195222484e-21
PHYCA_50444515665485002477e-21
PHALS_09942124014964562432e-20
SDRG_0506015665595212442e-20
SPRG_1205415665585212442e-20
PYIW_2025715665034852396e-20
HYAP_0414915665645122398e-20
H257_0745015665675452318e-19
PHYKE_2864151564864882281e-18
H310_02523124014944432271e-18
PYU1_G00173714753133952092e-18
PYAP_1914815665355182272e-18
PYIW_24688114282592572172e-18
PHYSO_48941815664714572243e-18
PITG_0177815664704602235e-18
CCA1403015665605162183e-17
SPRG_04114151563763672125e-17
PHYKE_980715665575162121e-16
H257_16541124014944432112e-16
CCI3999315665505182023e-15
PYIR_21896151565184991971e-14
HYAP_08069650262552141872e-14
PYAR_1666415665773831933e-14
PITG_19065151564164091904e-14
PPTG_13000124013873361879e-14
PHYSO_562795151564154081727e-12
HYAP_13613151564232191461e-08
PPTG_247122910367671185e-07
PITG_19802156311851571241e-06
SPRG_0423112415790521126e-06
PITG_18935150674801431131e-04
PHALS_10960634702180940.025
PHYCA_524942105671028289910.064
HYAP_080686502510056820.080
PYIW_2756812401128120830.12
CCI40989241655284870.17
SPRG_17626132408148117820.18
PITG_00703634703165860.22
PPTG_08060634725247860.24
H257_05020634713115850.34
H257_05019140360713115850.34
HYAP_03065634701140840.44
SPRG_186431333348530760.45
PYAR_15823634705296840.46
PHYRA_829085711305156810.77
PYAP_15943241513934751.5
PHYSO_507629634703180782.4
H310_0629614909759031772.5
PITG_02760241516536742.5
PYU1_G014369634703173763.4
SPRG_14085129749340102753.5
H257_040361250061049122764.2
CCA195191524837279754.3
PHYKE_5677241621134735.1
PHYKE_6590105671054108755.3
PYAR_16461469752643746.3
PYVX_18330241655830746.7
PYU1_G004385241656236746.8
PPTG_05518241655436737.6
SDRG_0650112817662331738.6
SPRG_1164112817662331738.9
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= H257_08436

Length=642
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

H257_08436                                                            1268       0.0   
H310_08590                                                            1167       0.0   
SPRG_14103                                                            952        0.0   
SDRG_16720                                                            951        0.0   
PYIR_13452                                                            812        0.0   
PYAP_17761                                                            769        0.0   
PHYCA_556160                                                          767        0.0   
PHYKE_8391                                                            766        0.0   
PYIW_19972                                                            761        0.0   
PITG_18452                                                            743        0.0   
HYAP_07095                                                            706        0.0   
PYAR_13569                                                            699        0.0   
PHYSO_348901                                                          690        0.0   
PHALS_06481                                                           681        0.0   
PHYRA_50855                                                           677        0.0   
PYVX_18170                                                            659        0.0   
SPRG_04074                                                            431        3e-144
SDRG_14408                                                            428        8e-143
SDRG_03822                                                            256        7e-77 
PYAR_17512                                                            254        6e-76 
SDRG_12187                                                            249        8e-75 
SDRG_03823                                                            249        3e-74 
PYAP_21882                                                            248        6e-74 
SDRG_11131                                                            248        8e-74 
H310_14447                                                            248        1e-73 
SDRG_15045                                                            246        6e-73 
PPTG_09787                                                            244        3e-72 
SPRG_11769                                                            242        5e-72 
PYIR_17506                                                            241        4e-71 
PHYRA_72037                                                           241        4e-71 
SPRG_05609                                                            241        5e-71 
PITG_14083                                                            239        2e-70 
PHYSO_254571                                                          238        3e-70 
PHALS_08068                                                           238        4e-70 
CCI11048                                                              237        1e-69 
PHYSO_550665                                                          237        1e-69 
PHYCA_504517                                                          236        3e-69 
PHYKE_10327                                                           247        3e-69 
PYIW_25301                                                            236        5e-69 
H257_17037                                                            235        6e-69 
HYAP_08763                                                            233        1e-68 
CCA23647                                                              233        4e-68 
PHALS_09136                                                           231        1e-67 
PPTG_18033                                                            231        2e-67 
PHYRA_71927                                                           229        6e-67 
PYAP_23435                                                            234        2e-65 
H257_09722                                                            221        2e-63 
H310_11259                                                            220        5e-63 
PHYKE_6836                                                            218        1e-62 
PITG_13427                                                            214        2e-61 
PHYCA_7619                                                            207        9e-59 
PYVX_21517                                                            197        4e-55 
HYAP_04843                                                            191        4e-53 
PYIR_23431                                                            188        1e-51 
PYAR_17714                                                            180        3e-49 
PYVX_16175                                                            174        6e-47 
CCA22989                                                              147        8e-37 
CCI10477                                                              144        9e-36 
PYAP_22645                                                            144        1e-34 
PYU1_G014259                                                          127        3e-32 
SPRG_19943                                                            130        4e-32 
PYIR_20273                                                            133        4e-32 
HYAP_12621                                                            129        7e-31 
PYVX_21248                                                            128        2e-30 
H257_01186                                                            120        6e-28 
SDRG_14446                                                            119        2e-27 
PHYRA_73883                                                           118        7e-27 
PYAR_20075                                                            113        1e-25 
H310_00561                                                            114        1e-25 
CCI50816                                                              113        5e-25 
PHYRA_47253                                                           111        6e-25 
PYU1_G011605                                                          112        7e-25 
PYVX_20512                                                            112        7e-25 
CCA16670                                                              111        7e-25 
PYIW_25190                                                            104        2e-24 
PYIW_19795                                                            110        2e-24 
PHYRA_72215                                                           109        4e-24 
PPTG_09121                                                            109        4e-24 
PHALS_10055                                                           108        1e-23 
PYIR_14132                                                            108        1e-23 
PHYSO_556052                                                          107        1e-23 
PPTG_00938                                                            107        2e-23 
PYAR_16840                                                            107        2e-23 
PHYCA_123621                                                          107        2e-23 
PITG_15359                                                            106        4e-23 
PHALS_12028                                                           105        1e-22 
PHYKE_9680                                                            103        3e-22 
PHYCA_555180                                                          103        3e-22 
SDRG_06945                                                            102        6e-22 
PYU1_G005699                                                          102        7e-22 
SPRG_09825                                                            101        1e-21 
PYAP_19280                                                            100        3e-21 
H310_07641                                                            100        4e-21 
PYVX_23499                                                            100        4e-21 
PHYCA_504445                                                          99.8       7e-21 
PHALS_09942                                                           98.2       2e-20 
SDRG_05060                                                            98.6       2e-20 
SPRG_12054                                                            98.6       2e-20 
PYIW_20257                                                            96.7       6e-20 
HYAP_04149                                                            96.7       8e-20 
H257_07450                                                            93.6       8e-19 
PHYKE_2864                                                            92.4       1e-18 
H310_02523                                                            92.0       1e-18 
PYU1_G001737                                                          85.1       2e-18 
PYAP_19148                                                            92.0       2e-18 
PYIW_24688                                                            88.2       2e-18 
PHYSO_489418                                                          90.9       3e-18 
PITG_01778                                                            90.5       5e-18 
CCA14030                                                              88.6       3e-17 
SPRG_04114                                                            86.3       5e-17 
PHYKE_9807                                                            86.3       1e-16 
H257_16541                                                            85.9       2e-16 
CCI39993                                                              82.4       3e-15 
PYIR_21896                                                            80.5       1e-14 
HYAP_08069                                                            76.6       2e-14 
PYAR_16664                                                            79.0       3e-14 
PITG_19065                                                            77.8       4e-14 
PPTG_13000                                                            76.6       9e-14 
PHYSO_562795                                                          70.9       7e-12 
HYAP_13613                                                            60.8       1e-08 
PPTG_24712                                                            50.1       5e-07 
PITG_19802                                                            52.4       1e-06 
SPRG_04231                                                            47.8       6e-06 
PITG_18935                                                            48.1       1e-04 
PHALS_10960                                                           40.8       0.025 
PHYCA_524942                                                          39.7       0.064 
HYAP_08068                                                            36.2       0.080 
PYIW_27568                                                            36.6       0.12  
CCI40989                                                              38.1       0.17  
SPRG_17626                                                            36.2       0.18  
PITG_00703                                                            37.7       0.22  
PPTG_08060                                                            37.7       0.24  
H257_05020                                                            37.4       0.34  
H257_05019                                                            37.4       0.34  
HYAP_03065                                                            37.0       0.44  
SPRG_18643                                                            33.9       0.45  
PYAR_15823                                                            37.0       0.46  
PHYRA_82908                                                           35.8       0.77  
PYAP_15943                                                            33.5       1.5   
PHYSO_507629                                                          34.7       2.4   
H310_06296                                                            34.3       2.5   
PITG_02760                                                            33.1       2.5   
PYU1_G014369                                                          33.9       3.4   
SPRG_14085                                                            33.5       3.5   
H257_04036                                                            33.9       4.2   
CCA19519                                                              33.5       4.3   
PHYKE_5677                                                            32.7       5.1   
PHYKE_6590                                                            33.5       5.3   
PYAR_16461                                                            33.1       6.3   
PYVX_18330                                                            33.1       6.7   
PYU1_G004385                                                          33.1       6.8   
PPTG_05518                                                            32.7       7.6   
SDRG_06501                                                            32.7       8.6   
SPRG_11641                                                            32.7       8.9   

>H257_08436
Length=642

 Score = 1268 bits (3280),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 642/642 (100%), Positives = 642/642 (100%), Gaps = 0/642 (0%)

Query  1    MHRHSFRISTCRRITSSLWTssapsrrqssssranmssVNYHVVGWKQCPYYVKAASVAS  60
            MHRHSFRISTCRRITSSLWTSSAPSRRQSSSSRANMSSVNYHVVGWKQCPYYVKAASVAS
Sbjct  1    MHRHSFRISTCRRITSSLWTSSAPSRRQSSSSRANMSSVNYHVVGWKQCPYYVKAASVAS  60

Query  61   SMQHLFPSQVKATIHEHPNKESFVNWLNESQTEFAHQFDNDARPLKHKSSPFCYLEQDDT  120
            SMQHLFPSQVKATIHEHPNKESFVNWLNESQTEFAHQFDNDARPLKHKSSPFCYLEQDDT
Sbjct  61   SMQHLFPSQVKATIHEHPNKESFVNWLNESQTEFAHQFDNDARPLKHKSSPFCYLEQDDT  120

Query  121  PKFVGGCDDTLAFFRARTQsapsapassasIHANDTSDADVKYDWDLVVIGGGSGGLACS  180
            PKFVGGCDDTLAFFRARTQSAPSAPASSASIHANDTSDADVKYDWDLVVIGGGSGGLACS
Sbjct  121  PKFVGGCDDTLAFFRARTQSAPSAPASSASIHANDTSDADVKYDWDLVVIGGGSGGLACS  180

Query  181  KEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGEILHKDADQFG  240
            KEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGEILHKDADQFG
Sbjct  181  KEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGEILHKDADQFG  240

Query  241  WSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYENMLGTFKDAHTLTLTNDAKK  300
            WSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYENMLGTFKDAHTLTLTNDAKK
Sbjct  241  WSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYENMLGTFKDAHTLTLTNDAKK  300

Query  301  KGPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDDIFSKPDAPGKTLVVGASYVALECAG  360
            KGPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDDIFSKPDAPGKTLVVGASYVALECAG
Sbjct  301  KGPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDDIFSKPDAPGKTLVVGASYVALECAG  360

Query  361  FLKGQGFDVTIMVRSILLRGFDQDIARRIGEYMESESGIAFIKESVPTSIVKLENGQFQV  420
            FLKGQGFDVTIMVRSILLRGFDQDIARRIGEYMESESGIAFIKESVPTSIVKLENGQFQV
Sbjct  361  FLKGQGFDVTIMVRSILLRGFDQDIARRIGEYMESESGIAFIKESVPTSIVKLENGQFQV  420

Query  421  THTTGQDVYDTILNATGRSPDVQKLNLDAAGVALNPKSGRIHVVNEQTSTPNIYALGDVI  480
            THTTGQDVYDTILNATGRSPDVQKLNLDAAGVALNPKSGRIHVVNEQTSTPNIYALGDVI
Sbjct  421  THTTGQDVYDTILNATGRSPDVQKLNLDAAGVALNPKSGRIHVVNEQTSTPNIYALGDVI  480

Query  481  DAPELTPVAIQAGKLLSRRLFGNGTTLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRE  540
            DAPELTPVAIQAGKLLSRRLFGNGTTLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRE
Sbjct  481  DAPELTPVAIQAGKLLSRRLFGNGTTLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRE  540

Query  541  NVEVYHQNFTPLEWSLSHDRPLAKECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIA  600
            NVEVYHQNFTPLEWSLSHDRPLAKECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIA
Sbjct  541  NVEVYHQNFTPLEWSLSHDRPLAKECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIA  600

Query  601  IKLNATYDDFINTVGIHPTTAEIFTTLEITKESGVDASASGC  642
            IKLNATYDDFINTVGIHPTTAEIFTTLEITKESGVDASASGC
Sbjct  601  IKLNATYDDFINTVGIHPTTAEIFTTLEITKESGVDASASGC  642

>H310_08590
Length=640

 Score = 1167 bits (3019),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 571/645 (89%), Positives = 606/645 (94%), Gaps = 8/645 (1%)

Query  1    MHRH-SFRISTCRRITSSLWTssapsrrqssssranmssVNYHVVGWKQCPYYVKAASVA  59
            MHRH SFRIST RR+TSS+WTS    R+ S  S      +NYHVVGWKQCPYYVKAASV 
Sbjct  1    MHRHASFRISTRRRVTSSVWTSPPLRRQSSKMST-----INYHVVGWKQCPYYVKAASVV  55

Query  60   SSMQHLFPSQVKATIHEHPNKESFVNWLNESQTEFAHQFDNDARPLKHKSSPFCYLEQDD  119
            SSMQHLFPSQVKATIHEHPNKESF NWLNESQTEFA QFDNDARPLKHKSSPFCYLEQDD
Sbjct  56   SSMQHLFPSQVKATIHEHPNKESFANWLNESQTEFARQFDNDARPLKHKSSPFCYLEQDD  115

Query  120  TPKFVGGCDDTLAFFRARTQsapsapa-ssasIHANDTSDAD-VKYDWDLVVIGGGSGGL  177
            TPKFVGGCDDTLAFFRARTQSAPS  A S+A+ H +DTS +D  +YDWDLVVIGGGSGGL
Sbjct  116  TPKFVGGCDDTLAFFRARTQSAPSTGAPSAANAHVSDTSSSDETQYDWDLVVIGGGSGGL  175

Query  178  ACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGEILHKDAD  237
            ACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGE+LHKDA+
Sbjct  176  ACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGELLHKDAE  235

Query  238  QFGWSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYENMLGTFKDAHTLTLTND  297
            QFGW+VSNA+FDW+KLVSSVQDYIHGLNFKYR+DLRDKKVKYENMLGTFKDAHTLTLTN+
Sbjct  236  QFGWTVSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYENMLGTFKDAHTLTLTNE  295

Query  298  AKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDDIFSKPDAPGKTLVVGASYVALE  357
            AKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHA+SSDDIFSK +APGKTLVVGASYVALE
Sbjct  296  AKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAISSDDIFSKAEAPGKTLVVGASYVALE  355

Query  358  CAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGEYMESESGIAFIKESVPTSIVKLENGQ  417
            CAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGEYME+ESGIAFIKESVPTSI KL NGQ
Sbjct  356  CAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKLPNGQ  415

Query  418  FQVTHTTGQDVYDTILNATGRSPDVQKLNLDAAGVALNPKSGRIHVVNEQTSTPNIYALG  477
             +VTHT G+ +YDT+LNATGRSPDVQ LNL AAGV LNPKSGRI V NEQTSTP+IYA+G
Sbjct  416  LKVTHTHGEGIYDTVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDVTNEQTSTPHIYAIG  475

Query  478  DVIDAPELTPVAIQAGKLLSRRLFGNGTTLMDYTKICTAVFTPVEYGCCGLSEEDAIASA  537
            DVIDAPELTPVAIQAGKLL+RRLFGNGT LMDYTKICTAVFTPVEYGCCGLSEEDAIASA
Sbjct  476  DVIDAPELTPVAIQAGKLLARRLFGNGTALMDYTKICTAVFTPVEYGCCGLSEEDAIASA  535

Query  538  GRENVEVYHQNFTPLEWSLSHDRPLAKECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAI  597
            GR+N++VYHQNFTPLEWSLSH+RPLAKECYAKLIVDTTQQKRV+GFHYLGPNAGEVTQAI
Sbjct  536  GRDNIQVYHQNFTPLEWSLSHERPLAKECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAI  595

Query  598  GIAIKLNATYDDFINTVGIHPTTAEIFTTLEITKESGVDASASGC  642
            G+A+KL+ATYDDF+NTVGIHPTTAEIFTTLEITKESG DASASGC
Sbjct  596  GVAMKLHATYDDFVNTVGIHPTTAEIFTTLEITKESGEDASASGC  640

>SPRG_14103
Length=628

 Score = 952 bits (2460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/604 (77%), Positives = 518/604 (86%), Gaps = 1/604 (0%)

Query  39   VNYHVVGWKQCPYYVKAASVASSMQHLFPSQVKATIHEHPNKESFVNWLNESQTEFAHQF  98
            VNYHVVGWK CPYY +AA+VASSMQ LFP QVKATIHEH  K+SF +WL  SQ  FA QF
Sbjct  26   VNYHVVGWKSCPYYERAANVASSMQTLFPGQVKATIHEHATKQSFNDWLEASQATFATQF  85

Query  99   DNDARPLKHKSSPFCYLEQDDTPKFVGGCDDTLAFFRARTQsapsapassasIHANDTSD  158
              DAR   H +SPFCYLE     KFVGGCDDTLAFFR+RTQSA +  A + ++HAND  D
Sbjct  86   VGDARATNHYTSPFCYLEDGAGTKFVGGCDDTLAFFRSRTQSAAAPSAPARNVHANDVDD  145

Query  159  ADVKYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIP  218
                YDWDLVVIGGGSGGLA SKEA+K GQKVLVLDYVKPSP GSTWGLGGTCVNVGCIP
Sbjct  146  G-ATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIP  204

Query  219  KKLMHQSSIIGEILHKDADQFGWSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVK  278
            KKLMHQS+I+GE+LHKDA+ FGW+V NATFDW+KLV+SVQDYIHGLNFKYRVDLRDKKVK
Sbjct  205  KKLMHQSAIMGELLHKDAEAFGWAVPNATFDWTKLVTSVQDYIHGLNFKYRVDLRDKKVK  264

Query  279  YENMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDDIFS  338
            YEN LGTFKDAHTLTLTN AK K P DVTFRRA+IAVGGRPK L CPG + A+SSDDIFS
Sbjct  265  YENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAISSDDIFS  324

Query  339  KPDAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGEYMESESG  398
            +P  PGKTLVVGASYVALECAGFLK QGFDVT+MVRSILLRGFD D+A RIG YME E+ 
Sbjct  325  RPTPPGKTLVVGASYVALECAGFLKAQGFDVTVMVRSILLRGFDTDMAARIGTYMEEEAK  384

Query  399  IAFIKESVPTSIVKLENGQFQVTHTTGQDVYDTILNATGRSPDVQKLNLDAAGVALNPKS  458
            I FIK +VPTSI +L NGQ +VTHT G+ +YDT+LNATGR+PDV  LNL AAGV LNPK+
Sbjct  385  IDFIKGAVPTSIEQLANGQLKVTHTFGEGIYDTVLNATGRNPDVSGLNLPAAGVGLNPKT  444

Query  459  GRIHVVNEQTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLFGNGTTLMDYTKICTAVF  518
            GRI V +EQTS P+IYA+GDVID PELTPVAIQAG+LL++RLF N  TLM Y K+CTAVF
Sbjct  445  GRIAVTHEQTSAPHIYAVGDVIDGPELTPVAIQAGRLLAKRLFDNSATLMAYDKVCTAVF  504

Query  519  TPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAKECYAKLIVDTTQQK  578
            TP+EYGCCGLSE+ AI + G +N+ VYHQ+FTPLEWSLSHDR LAKECY KLIVD TQ  
Sbjct  505  TPIEYGCCGLSEDAAIETIGADNLGVYHQSFTPLEWSLSHDRALAKECYCKLIVDRTQND  564

Query  579  RVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIFTTLEITKESGVDAS  638
            RV+GFHYLGPNAGEVTQA+GIA+KLNA+YDDF++TVGIHPTTAEIFTTLEITKESG+DAS
Sbjct  565  RVVGFHYLGPNAGEVTQAVGIAMKLNASYDDFVSTVGIHPTTAEIFTTLEITKESGLDAS  624

Query  639  ASGC  642
            A+GC
Sbjct  625  AAGC  628

>SDRG_16720
Length=628

 Score = 951 bits (2459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/604 (77%), Positives = 519/604 (86%), Gaps = 1/604 (0%)

Query  39   VNYHVVGWKQCPYYVKAASVASSMQHLFPSQVKATIHEHPNKESFVNWLNESQTEFAHQF  98
            VNYHVVGWK CPYY +AA+VA SMQ LFP QVKATIHEH  K+SF +WL  SQ+ FA QF
Sbjct  26   VNYHVVGWKSCPYYERAANVAVSMQTLFPGQVKATIHEHATKQSFNDWLETSQSTFATQF  85

Query  99   DNDARPLKHKSSPFCYLEQDDTPKFVGGCDDTLAFFRARTQsapsapassasIHANDTSD  158
              DAR   H +SPFCYLE     KFVGGCDDTLAFFR+RTQSA +  A + ++HAND  D
Sbjct  86   VGDARATNHYTSPFCYLEDGAGTKFVGGCDDTLAFFRSRTQSAAAPSAPARNVHANDVDD  145

Query  159  ADVKYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIP  218
                YDWDLVVIGGGSGGLA SKEA+K GQKVLVLDYVKPSP GSTWGLGGTCVNVGCIP
Sbjct  146  G-ATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIP  204

Query  219  KKLMHQSSIIGEILHKDADQFGWSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVK  278
            KKLMHQS+I+GE+LHKDA+ FGW+V NATFDW+KL++SVQDYIHGLNFKYRVDLRDKKVK
Sbjct  205  KKLMHQSAIMGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVK  264

Query  279  YENMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDDIFS  338
            YEN LGTFKDAHTLTLTN AK K P DVTFRRA+IAVGGRPK L CPG + A+SSDDIFS
Sbjct  265  YENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAISSDDIFS  324

Query  339  KPDAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGEYMESESG  398
            +P  PGKTLVVGASYVALECAGFLKGQGFDVT+MVRSILLRGFD D+A RIG YME E+ 
Sbjct  325  RPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVRSILLRGFDTDMAARIGTYMEEEAK  384

Query  399  IAFIKESVPTSIVKLENGQFQVTHTTGQDVYDTILNATGRSPDVQKLNLDAAGVALNPKS  458
            I FIK +VPTSI +L NGQ +VTHT G+ +YDT+LNATGR PDV  LNL AAGV LNPK+
Sbjct  385  INFIKGAVPTSIEQLPNGQLKVTHTFGEGIYDTVLNATGRYPDVSGLNLSAAGVGLNPKT  444

Query  459  GRIHVVNEQTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLFGNGTTLMDYTKICTAVF  518
            GRI V +EQTSTP+IYA+GDVID PELTPVAIQAG+LLS+RLF N  TLM Y K+CTAVF
Sbjct  445  GRIAVTHEQTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNSATLMAYDKVCTAVF  504

Query  519  TPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAKECYAKLIVDTTQQK  578
            TP+EYGCCGLSE+ A+ + G +N+ VYHQ+FTPLEWSLSHDR LAKECY KLIVD TQ  
Sbjct  505  TPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAKECYCKLIVDRTQND  564

Query  579  RVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIFTTLEITKESGVDAS  638
            RV+GFHYLGPNAGEVTQA+GIAIKLNA+Y+DF++TVGIHPTTAEIFTTLEITKESG+DAS
Sbjct  565  RVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIFTTLEITKESGLDAS  624

Query  639  ASGC  642
            A+GC
Sbjct  625  AAGC  628

>PYIR_13452
Length=645

 Score = 812 bits (2098),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/610 (65%), Positives = 469/610 (77%), Gaps = 12/610 (2%)

Query  40   NYHVVGWKQCPYYVKAASVASSMQHLFPSQVKATIHEHPNKESFVNWLNESQT--EFAHQ  97
             YHV GW+ C +Y KA+ V ++M+ L+P  V   +HE P++E+F  WL  S T  E    
Sbjct  41   KYHVAGWRGCGFYKKASDVVTAMRVLYPDVVDFELHEFPDREAFREWLAASSTIEELTEC  100

Query  98   FDNDARPLKHKSSPFCYLEQDDTPKFVGGCDDTLAFFRARTQsapsapassasIHANDTS  157
            F  D++ L HKSSPF +    +T  F+GGCDDTLA FR+   +  +  A+   + A    
Sbjct  101  FGADSKALTHKSSPFVWA---NTRGFIGGCDDTLALFRSGVSAPATLAATPTMVAAAPAP  157

Query  158  DADVKYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCI  217
              D KYD+DL+VIGGGSGGLACSKEASK G+KV VLDYVKPSPVG++WGLGGTCVNVGCI
Sbjct  158  ADDAKYDYDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCI  217

Query  218  PKKLMHQSSIIGEILHKDADQFGWSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKV  277
            PKKLMHQSS+IGE +HKDA  FGW+V   TFDWS+++ SV  YI  +NFKY+V+LRDKKV
Sbjct  218  PKKLMHQSSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKV  277

Query  278  KYENMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDDIF  337
            KYEN+LG+F DAHTL L +   KKG   VT R  VIAVGGRPKPLSC G + A+SSDDIF
Sbjct  278  KYENLLGSFVDAHTLELWH--PKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIF  335

Query  338  SKPDAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGEYMESES  397
             + +APGKTLVVGASYVALECAGF+KG G+DV IMVRSILLRGFDQD+A +IGE+ME+ES
Sbjct  336  WRKEAPGKTLVVGASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMANKIGEFMETES  395

Query  398  GIAFIKESVPTSIVKLENGQFQVTHT-----TGQDVYDTILNATGRSPDVQKLNLDAAGV  452
             I FI+ +VP SI KLE+GQ  V        T ++ +DT+LNATGR PDV KL LD  GV
Sbjct  396  KIEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLDKVGV  455

Query  453  ALNPKSGRIHVVNEQTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLFGNGTTLMDYTK  512
             LNPK+GRI V NEQTSTPNIYA+GDVIDAPELTPVAIQAG+LL+RRL+ N T LMDY K
Sbjct  456  KLNPKTGRIAVTNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRLYNNETALMDYDK  515

Query  513  ICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAKECYAKLIV  572
            +CTAVFTP+EYGCCGLSEE +I   G EN+E+YHQNFTPLEWSLS DR  A  CY K+I 
Sbjct  516  VCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSCYVKVIC  575

Query  573  DTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIFTTLEITKE  632
            DT + K V+GFHYLGPNAGEVTQAIG+A+KL  TYD  +N VGIHPTTAEIFTTLE+TK 
Sbjct  576  DTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTLEVTKS  635

Query  633  SGVDASASGC  642
            SG  A++ GC
Sbjct  636  SGESAASGGC  645

>PYAP_17761
Length=622

 Score = 769 bits (1986),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/607 (62%), Positives = 459/607 (76%), Gaps = 10/607 (2%)

Query  41   YHVVGWKQCPYYVKAASVASSMQHLFPSQVKATIHEHPNKESFVNWLNESQTEFAHQFDN  100
            Y+V GW  CP+Y KA  VA +MQ L+   V     E  ++++F  WL ES   FA  F  
Sbjct  21   YYVAGWATCPWYRKARDVAQAMQLLYSDAVAVEAVEFESRDAFKAWLAESNAAFAQAFGT  80

Query  101  DARPLKHKSSPFCYLEQDDTPKFVGGCDDTLAFFRARTQsapsapassasIHANDTSDAD  160
            D+  L H SSPF +    +   F+GGCD TLA FR+   + P A  S++        D  
Sbjct  81   DSPALTHTSSPFVW---SNARGFIGGCDATLAHFRSGVAARPLAGPSASPTMTPVAVDES  137

Query  161  VKYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKK  220
              YD+DLVVIGGGSGGLACSKEA+K G+KV VLDYVKPSP+G+TWGLGGTCVNVGCIPKK
Sbjct  138  KTYDYDLVVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPLGTTWGLGGTCVNVGCIPKK  197

Query  221  LMHQSSIIGEILHKDADQFGWSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYE  280
            LMHQS++IGE++HKDA  FGW++    F W++LV SV +YI G+NFKY+V+LRDKKVKYE
Sbjct  198  LMHQSALIGELMHKDAGAFGWNMGEQKFTWTQLVESVNNYIKGINFKYKVELRDKKVKYE  257

Query  281  NMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDDIFSKP  340
            N LG+F D HT+ L +   KKG   +T R  V+AVGGRP+ LSCPG EHA+SSDDIF + 
Sbjct  258  NFLGSFVDPHTIELWH--HKKGTKTITTRHVVVAVGGRPRQLSCPGGEHAISSDDIFWRK  315

Query  341  DAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGEYMESESGIA  400
              PGKTLVVGASYVALECAGFLKG G++V +MVRSILLRGFD+D+A RIG++M+ ES I 
Sbjct  316  TEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFDEDMANRIGDFMQDESKIE  375

Query  401  FIKESVPTSIVKLENGQFQVTHTTG-----QDVYDTILNATGRSPDVQKLNLDAAGVALN  455
            FI+ +VP SI KLENGQ  V   +      ++V+D++LNATGR PDV KLNLD AGV LN
Sbjct  376  FIRGAVPKSIEKLENGQLLVKWNSADGETVEEVFDSVLNATGRDPDVSKLNLDKAGVQLN  435

Query  456  PKSGRIHVVNEQTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLFGNGTTLMDYTKICT  515
            PK+GRI V NEQTSTPN++A+GDVIDAPELTPVAIQAG+LL+RRL+ N TTLMDY K+CT
Sbjct  436  PKTGRIAVTNEQTSTPNVFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYDKVCT  495

Query  516  AVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAKECYAKLIVDTT  575
            AVFTP+EYGCCGLSEE A    G +N+E+YHQ+F PLEWSLS DR  A  CY K+I D T
Sbjct  496  AVFTPIEYGCCGLSEEAAKDKYGEDNLEIYHQSFMPLEWSLSQDRVAANTCYVKVICDKT  555

Query  576  QQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIFTTLEITKESGV  635
            + K V+GFHYLGPNAGEVTQA+G+A+K+  TYD  +N VGIHPTTAE+FTTLE+TK SG 
Sbjct  556  RDKYVVGFHYLGPNAGEVTQAMGLAMKIGFTYDQMVNVVGIHPTTAEVFTTLEVTKSSGA  615

Query  636  DASASGC  642
             A+A GC
Sbjct  616  SAAAGGC  622

>PHYCA_556160
Length=649

 Score = 767 bits (1981),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/632 (61%), Positives = 466/632 (74%), Gaps = 34/632 (5%)

Query  41   YHVVGWKQCPYYVKAASVASSMQHLFPSQVKATIHEHPNKESFVNWLNESQTEFAHQFDN  100
            +H+ GWK CP +VKA  VA++MQ L+P +V   +H   ++E+F +WL+ESQ EFA  F  
Sbjct  22   FHIAGWKTCPSFVKAGEVATAMQMLYPDRVTFELHPFEDREAFKHWLSESQDEFATSFGV  81

Query  101  DARPLKHKSSPFCYLEQDDTPKFVGGCDDTLAFFRA---------------RTQsapsap  145
            D++  KH +SPF +    +   FVGGCDD L +FR+                T+    A 
Sbjct  82   DSKATKHVTSPFVW--SSNPTAFVGGCDDLLTYFRSGVGVGNPQGATPNGSPTEKTAEAD  139

Query  146  assasIHANDTSDADVK---YDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVG  202
               +     +TS AD +   YD+DLVVIGGGSGGLACSKEA+  GQKV VLDYVKPSP G
Sbjct  140  VPMSETSVEETSTADAEETNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQG  199

Query  203  STWGLGGTCVNVGCIPKKLMHQSSIIGEILHKDADQFGWSVSNA-----TFDWSKLVSSV  257
            ++WGLGGTCVNVGCIPKKLMHQSS+IGE++H D   FGW++S+      TF+W +LVS+V
Sbjct  200  TSWGLGGTCVNVGCIPKKLMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNV  259

Query  258  QDYIHGLNFKYRVDLRDKKVKYENMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGG  317
              YI  +NFKY+V+LR K VKYEN LG+F + HTL L +   +KG   +T R  VIAVGG
Sbjct  260  DGYIKSINFKYKVELRSKYVKYENFLGSFVNPHTLELWH--PRKGTKQITTRDVVIAVGG  317

Query  318  RPKPLSCPGWEHALSSDDIF-SKPDAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSI  376
            RPK L+CPG EHA+SSDDIF  K   PGKTLVVGASYVALECAGFLKG G+DV +MVRSI
Sbjct  318  RPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI  377

Query  377  LLRGFDQDIARRIGEYMESESGIAFIKESVPTSIVKLENGQFQVTHTTG-----QDVYDT  431
            LLRGFDQD+A +IGEYME +SGI FI+++VP SI KLENGQ  V  T+      ++ +DT
Sbjct  378  LLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDT  437

Query  432  ILNATGRSPDVQKLNLDAAGVALNPKSGRIHVVNEQTSTPNIYALGDVIDAPELTPVAIQ  491
            +LNATGR PDV KLNLD AGV LN KSGRI V NEQTSTPNIYA+GDVIDAPELTPVAIQ
Sbjct  438  VLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQ  497

Query  492  AGKLLSRRLFGNGTTLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTP  551
            AG+LLSRRL+ N T  MDY K+CTAVFTP+EYGCCG+SEED+    G +N+EVYH NF P
Sbjct  498  AGRLLSRRLYNNSTVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVP  557

Query  552  LEWSLSHD-RPLAKECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDF  610
            LEWSLS D R  A+ CY K+I D T+ K V+GFHYLGPNAGEVTQA+G+A+KL  TYD  
Sbjct  558  LEWSLSTDTRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQM  617

Query  611  INTVGIHPTTAEIFTTLEITKESGVDASASGC  642
            ++TVGIHPTTAE FTTLE+TK SG   +  GC
Sbjct  618  VDTVGIHPTTAESFTTLEVTKSSGGATTGGGC  649

>PHYKE_8391
Length=778

 Score = 766 bits (1979),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/631 (60%), Positives = 464/631 (74%), Gaps = 33/631 (5%)

Query  41   YHVVGWKQCPYYVKAASVASSMQHLFPSQVKATIHEHPNKESFVNWLNESQTEFAHQFDN  100
            +H+ GW+ CP + KA  VA++MQ L+P +V    H   ++++F  WL+ S+  F   F  
Sbjct  152  FHISGWRTCPSFTKAGEVAAAMQMLYPDKVSFETHAFEDRDAFKQWLSTSKDHFVMHFGA  211

Query  101  DARPLKHKSSPFCYLEQDDTPKFVGGCDDTLAFFRA--------------RTQsapsapa  146
            D++ + H +SPF +    +  KFVGGCDD LAFFR+              + ++A S   
Sbjct  212  DSKAVTHVTSPFVW--SSNPIKFVGGCDDLLAFFRSGVAVGSPQGADPAEKAEAAASIEV  269

Query  147  ssasIHANDTS----DADVKYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVG  202
            + +S+   +T     + +  YD+DLVVIGGGSGGLACSKEA+  GQKV VLDYVKPSP G
Sbjct  270  AESSMTVTETPAVPMEEETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQG  329

Query  203  STWGLGGTCVNVGCIPKKLMHQSSIIGEILHKDADQFGWSVSN-----ATFDWSKLVSSV  257
            ++WGLGGTCVNVGCIPKKLMHQSS+IGE +H D+  FGW+V++     ATFDW +LVS+V
Sbjct  330  TSWGLGGTCVNVGCIPKKLMHQSSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNV  389

Query  258  QDYIHGLNFKYRVDLRDKKVKYENMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGG  317
              YI  +NFKY+V+LR K VKYEN LG+F D HTL L +   +KG   +T R  V+AVGG
Sbjct  390  DSYIKSINFKYKVELRSKYVKYENFLGSFLDPHTLELWH--PRKGTKQITTRHVVVAVGG  447

Query  318  RPKPLSCPGWEHALSSDDIF-SKPDAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSI  376
            RPK L+CPG E+A+SSDDIF  K  APGKTLVVGASYVALECAGFLKG G+DV +MVRSI
Sbjct  448  RPKQLTCPGAEYAISSDDIFWMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI  507

Query  377  LLRGFDQDIARRIGEYMESESGIAFIKESVPTSIVKLENGQFQVTHTTGQD-----VYDT  431
            LLRGFDQD+A +IGEYME ++GI FI+++VP SI KLENGQ  V  TT  D      +DT
Sbjct  508  LLRGFDQDMANKIGEYMEVQAGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEETFDT  567

Query  432  ILNATGRSPDVQKLNLDAAGVALNPKSGRIHVVNEQTSTPNIYALGDVIDAPELTPVAIQ  491
            +LNATGR PDV KL LD AGV LN K+GRI   NEQTSTPNI+A+GDVIDAPELTPVAIQ
Sbjct  568  VLNATGRDPDVAKLGLDKAGVKLNEKTGRIWTKNEQTSTPNIFAIGDVIDAPELTPVAIQ  627

Query  492  AGKLLSRRLFGNGTTLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTP  551
            AG+ LSRRL+ N T  MDY K+CTAVFTP+EYGCCGLSEED+    G +NVEVYH+NF P
Sbjct  628  AGRFLSRRLYNNSTVQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVP  687

Query  552  LEWSLSHDRPLAKECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFI  611
            LEWSLS  R  ++ CY K+I DTT+ K V+GFHYLGPNAGEVTQA+G+A+KL  TYD  +
Sbjct  688  LEWSLSESRTSSESCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMV  747

Query  612  NTVGIHPTTAEIFTTLEITKESGVDASASGC  642
            +TVGIHPTTAE FTTLE+TK SG   +  GC
Sbjct  748  DTVGIHPTTAEAFTTLEVTKSSGATTTGGGC  778

>PYIW_19972
Length=609

 Score = 761 bits (1966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/607 (62%), Positives = 452/607 (74%), Gaps = 35/607 (6%)

Query  41   YHVVGWKQCPYYVKAASVASSMQHLFPSQVKATIHEHPNKESFVNWLNESQTEFAHQFDN  100
            YH+ GW+ C +Y KA+ V  +M+ L+P  V   IHE P++E+F  WL+ S  +FA  F  
Sbjct  33   YHIAGWRGCGFYKKASDVMQAMRVLYPDAVDCEIHEFPDREAFRAWLSASAADFAANFGA  92

Query  101  DARPLKHKSSPFCYLEQDDTPKFVGGCDDTLAFFRARTQsapsapassasIHANDTSDAD  160
            D++   H SSPF   ++  TP  V                            A    D +
Sbjct  93   DSKAATHTSSPFFGKDESPTPTMV----------------------------AAPVVDDN  124

Query  161  VKYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKK  220
            V YD+DL+VIGGGSGGLACSKEA+K G+KV VLDYVKPSP G+TWGLGGTCVNVGCIPKK
Sbjct  125  VTYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKK  184

Query  221  LMHQSSIIGEILHKDADQFGWSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYE  280
            LMHQSS+IGE +HKDA  FGWSV    FDW++++ SV  YI  +NFKY+V+LRDKKVKYE
Sbjct  185  LMHQSSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYE  244

Query  281  NMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDDIFSKP  340
            N+LG+F DAHTL L +   KKG   VT R  VIAVGGRPKPLSC G E A+SSDDIF + 
Sbjct  245  NLLGSFVDAHTLELWH--PKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDDIFWRK  302

Query  341  DAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGEYMESESGIA  400
            +APGKTLV+GASYVALECAGF+KG G+DV IMVRSILLRGFDQD+A +IGE+ME ES I 
Sbjct  303  EAPGKTLVIGASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMASKIGEFMEVESKIE  362

Query  401  FIKESVPTSIVKLENGQFQVTHTTG-----QDVYDTILNATGRSPDVQKLNLDAAGVALN  455
            FI+ +VP SI KLE+GQ  V   +      ++ +DT+LNATGR PDV KLNLD+ GV LN
Sbjct  363  FIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNLDSVGVQLN  422

Query  456  PKSGRIHVVNEQTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLFGNGTTLMDYTKICT  515
            PK+GRI V NEQTS PNI+A+GDVIDAPELTPVAIQAG++L+RRL+ N T LMDY K+CT
Sbjct  423  PKTGRIAVTNEQTSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYNNETALMDYDKVCT  482

Query  516  AVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAKECYAKLIVDTT  575
            AVFTP+EYGCCGLSEE +I   G + +E+YHQNFTPLEWSLS DR  A  CY K+I DTT
Sbjct  483  AVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAGSCYVKVICDTT  542

Query  576  QQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIFTTLEITKESGV  635
            + K V+GFHYLGPNAGEVTQAIG+A+KL  TYDD +N VGIHPTTAEIFTTLE+TK SG 
Sbjct  543  RNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIFTTLEVTKSSGE  602

Query  636  DASASGC  642
             A+A GC
Sbjct  603  SAAAGGC  609

>PITG_18452
Length=856

 Score = 743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/630 (60%), Positives = 458/630 (73%), Gaps = 40/630 (6%)

Query  40   NYHVVGWKQCPYYVKAASVASSMQHLFPSQVKATIHEHPNKESFVNWLNESQTEFAHQFD  99
             +++ GWK C  +VKA  VA++MQ L+P +V    H   ++ +F  WL+ SQ +    F 
Sbjct  21   TFYIAGWKSCTSFVKAREVAAAMQMLYPDRVAFETHPFEDRNAFKQWLSASQDDITAHFG  80

Query  100  NDARPLKHKSSPFCYLEQDDTPKFVGGCDDTLAFFRA-------------------RTQs  140
             D+R  KH +SPF +     +  FVGGCD+ LAFFR+                    +  
Sbjct  81   ADSRATKHVTSPFVW----SSTIFVGGCDELLAFFRSGIAVGKPQGVMPSEKQPTPSSAL  136

Query  141  apsapassasIHANDTSDA---DVKYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVK  197
            AP    S   + A  +S A   +  YD+DLVVIGGGSGGLACSKEA+  GQKV VLDYVK
Sbjct  137  APETDGSMPDVAAETSSTAAKEEASYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVK  196

Query  198  PSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGEILHKDADQFGWSVSNA-----TFDWSK  252
            PSP G++WGLGGTCVNVGCIPKKLMHQSS+IGE+LH D+  FGW+VS+       FDW +
Sbjct  197  PSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQ  256

Query  253  LVSSVQDYIHGLNFKYRVDLRDKKVKYENMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAV  312
            LV++V  YI G+NFKY+V+LR K VKYEN LG+F D HTL L +   +KG   +T R  V
Sbjct  257  LVTNVDGYIRGINFKYKVELRSKYVKYENFLGSFIDPHTLELWH--PRKGSKQITTRDVV  314

Query  313  IAVGGRPKPLSCPGWEHALSSDDIF-SKPDAPGKTLVVGASYVALECAGFLKGQGFDVTI  371
            IAVGGRP+ L+ PG EHA+SSDDIF  K   PGKTLVVGASYVALECAGFLKG G+DV +
Sbjct  315  IAVGGRPRELTIPGGEHAISSDDIFWMKTKEPGKTLVVGASYVALECAGFLKGMGYDVKV  374

Query  372  MVRSILLRGFDQDIARRIGEYMESESGIAFIKESVPTSIVKLENGQFQVTHTTG-----Q  426
            MVRSILLRGFDQD+A +IGEYME +SGI FI+++VP SI KLENGQ  V  T+      +
Sbjct  375  MVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCE  434

Query  427  DVYDTILNATGRSPDVQKLNLDAAGVALNPKSGRIHVVNEQTSTPNIYALGDVIDAPELT  486
            + +D++LNATGR PD+ KL+LD AGV LN K+GRI V +EQTSTPNIYA+GDVIDAPELT
Sbjct  435  EAFDSVLNATGRDPDIAKLDLDKAGVKLNEKTGRIWVKHEQTSTPNIYAIGDVIDAPELT  494

Query  487  PVAIQAGKLLSRRLFGNGTTLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYH  546
            PVAIQAG+LLSRRL+ N T  MDY K+CTAVFTP+EYGCCGLSEED+I   G++ +EVYH
Sbjct  495  PVAIQAGRLLSRRLYNNATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYH  554

Query  547  QNFTPLEWSLSHD-RPLAKECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNA  605
             NF PLEWSLS + R  A+ CY K+I D  + K V+GFHYLGPNAGEVTQA+G+A+KL  
Sbjct  555  TNFVPLEWSLSTETRAAAESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGF  614

Query  606  TYDDFINTVGIHPTTAEIFTTLEITKESGV  635
            TYD  ++TVGIHPTTAE FTTLE+TK SGV
Sbjct  615  TYDQMVDTVGIHPTTAESFTTLEVTKSSGV  644

>HYAP_07095
Length=613

 Score = 706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/617 (59%), Positives = 440/617 (71%), Gaps = 40/617 (6%)

Query  62   MQHLFPSQVKATIHEHPNKESFVNWLNESQTEFAHQFDNDARPLKHKSSPFCYLEQDDTP  121
            M  ++P +V    H   ++++F  WL+ S  +F  QF  D++   H +SPF ++    T 
Sbjct  1    MHVMYPGRVAFETHAFEDRDAFKQWLSTSYEDFVTQFGLDSKATTHVTSPFVWISNPTT-  59

Query  122  KFVGGCDDTLAFFRA-----RTQsapsapassasIHA----NDTSDA-------------  159
             FVGGCDD LA FR+       Q   S      ++      +DT+ A             
Sbjct  60   -FVGGCDDLLAVFRSGIAVGNIQDVASTREDGETLDGTAPMDDTASASELNESRTPPIVV  118

Query  160  --DVKYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCI  217
              D  YD+DLVVIGGGSGGLACSKEA+  G+KV VLDYVKPSP G++WGLGGTCVNVGCI
Sbjct  119  EDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCI  178

Query  218  PKKLMHQSSIIGEILHKDADQFGWSVSNA-----TFDWSKLVSSVQDYIHGLNFKYRVDL  272
            PKKLMHQSS+IGEILH D   FGW+V +      TFDW +LVS+V  YI  ++FKY+V+L
Sbjct  179  PKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVSSYIKSISFKYKVEL  238

Query  273  RDKKVKYENMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALS  332
            R K+VKYEN+LG+F D HTL L +   KKG  ++T R  VIAVGGRP+ L+C G E A+S
Sbjct  239  RSKQVKYENVLGSFVDPHTLKLWH--PKKGTKEITTRHVVIAVGGRPRQLACLGGELAVS  296

Query  333  SDDIF-SKPDAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGE  391
            SDDIF  K   PGKTLVVGASYVALECAGFLKG G+ V +MVRSILLRGFDQD+A +IGE
Sbjct  297  SDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGE  356

Query  392  YMESESGIAFIKESVPTSIVKLENGQFQVTHTTG-----QDVYDTILNATGRSPDVQKLN  446
            YME +SGI FI+++VP SI KL++GQ  V   T      ++ +DT+LNATGR PDV KL 
Sbjct  357  YMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLG  416

Query  447  LDAAGVALNPKSGRIHVVNEQTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLFGNGTT  506
            LD AGV LN K+GRI V NEQT+TPN+YA+GDVIDAPELTPVAIQAG+LLSRRL+  GT 
Sbjct  417  LDEAGVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTV  476

Query  507  LMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAKE-  565
             MDY KICTAVFTP+EYGCCGLSEED+    G ++VEVYH+NF PLEWSL+    +A E 
Sbjct  477  QMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAES  536

Query  566  CYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIFT  625
            CY K++ D T+   VLGFHYLGPNAGEVTQA+G+A+KL  TYD  ++TVGIHPTTAE FT
Sbjct  537  CYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHPTTAEAFT  596

Query  626  TLEITKESGVDASASGC  642
            TLE TK SG   +  GC
Sbjct  597  TLETTKSSGDSTTGGGC  613

>PYAR_13569
Length=494

 Score = 699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/490 (69%), Positives = 401/490 (82%), Gaps = 7/490 (1%)

Query  158  DADVKYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCI  217
            D +  YD+DLVVIGGGSGGLACSKEA+K G+KV+VLDYVKPSP+G+TWGLGGTCVNVGCI
Sbjct  7    DDEATYDYDLVVIGGGSGGLACSKEAAKHGKKVMVLDYVKPSPLGTTWGLGGTCVNVGCI  66

Query  218  PKKLMHQSSIIGEILHKDADQFGWSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKV  277
            PKKLMHQS+++GE++HKDA  FGW+    +F W++LV+SV +YI G+NFKY+V+LRDKKV
Sbjct  67   PKKLMHQSALLGELMHKDAPAFGWTTGAQSFTWTQLVASVNNYIKGINFKYKVELRDKKV  126

Query  278  KYENMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDDIF  337
            KYEN LG+F DAHT+ L +   KK    VT R  VIAVGGRP+ L+CPG EHA+SSDDIF
Sbjct  127  KYENFLGSFVDAHTIELWH--HKKPAKTVTTRHVVIAVGGRPRALTCPGGEHAISSDDIF  184

Query  338  SKPDAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGEYMESES  397
             +   PGKTLVVGASYVALECAGFLKG G+DV IMVRSILLRGFDQD+A RIG++M+ ES
Sbjct  185  WRKTEPGKTLVVGASYVALECAGFLKGMGYDVKIMVRSILLRGFDQDMANRIGDFMQDES  244

Query  398  GIAFIKESVPTSIVKLENGQFQVTHTTG-----QDVYDTILNATGRSPDVQKLNLDAAGV  452
             I FI+  VP SI K ENG+  V   +      ++++DT+LNATGR PDV KLNLD AGV
Sbjct  245  RIEFIRGVVPKSIEKQENGKLLVKWNSPDGDEVEELFDTVLNATGRDPDVTKLNLDKAGV  304

Query  453  ALNPKSGRIHVVNEQTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLFGNGTTLMDYTK  512
             LNPKSGRI   NEQTSTPNI+A+GDVIDAPELTPVAIQAG+LL+RRL+ N TTLMDY K
Sbjct  305  ELNPKSGRIAQTNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYDK  364

Query  513  ICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAKECYAKLIV  572
            ICTAVFTP+EYGCCGLSEEDA A  G EN+E+YHQ+F PLEWSLS +R  A  CY K+I 
Sbjct  365  ICTAVFTPIEYGCCGLSEEDAKAKYGEENLEIYHQSFMPLEWSLSEERVAAATCYVKVIC  424

Query  573  DTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIFTTLEITKE  632
            D T+ K V+GFHYLGPNAGEVTQA+G+A+K+  TYD  +N VGIHPTTAE+FTTLEITK 
Sbjct  425  DKTRDKHVVGFHYLGPNAGEVTQAMGLAMKVGFTYDQMVNVVGIHPTTAEVFTTLEITKS  484

Query  633  SGVDASASGC  642
            SG  A+A GC
Sbjct  485  SGASAAAGGC  494

>PHYSO_348901
Length=526

 Score = 690 bits (1781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/528 (65%), Positives = 406/528 (77%), Gaps = 18/528 (3%)

Query  131  LAFFRARTQsapsapassasIHANDT----SDADVKYDWDLVVIGGGSGGLACSKEASKL  186
            +A  R   Q +      +  IH   T     +A+  YD+DLVVIGGGSGGLACSKEA+  
Sbjct  1    MAKLRLSIQESALNTKKNMQIHDPSTPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASF  60

Query  187  GQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGEILHKDADQFGWSVSNA  246
            GQKV VLDYVKPSP G++WGLGGTCVNVGCIPKKLMHQSS+IGE++H D+  FGW++++A
Sbjct  61   GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASA  120

Query  247  -----TFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYENMLGTFKDAHTLTLTNDAKKK  301
                 TF W +LV++V  YI G+NFKY+V+LR K VKYEN LG+F DAHTL L +   +K
Sbjct  121  DGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYVKYENFLGSFVDAHTLELWH--PRK  178

Query  302  GPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDDIF-SKPDAPGKTLVVGASYVALECAG  360
            G   +T R  VIAVGGRPK L+CPG EHA+SSDDIF  K   PGKTLVVGASYVALECAG
Sbjct  179  GTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAG  238

Query  361  FLKGQGFDVTIMVRSILLRGFDQDIARRIGEYMESESGIAFIKESVPTSIVKLENGQFQV  420
            FLKG G+DV +MVRSILLRGFDQD+A +IGEYME +SGI FI+++VP SI KLENGQ  V
Sbjct  239  FLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLV  298

Query  421  THTTG-----QDVYDTILNATGRSPDVQKLNLDAAGVALNPKSGRIHVVNEQTSTPNIYA  475
              TT      ++ +DT+LNATGR PDV KL LD A V LN K+GRI V NEQTSTPNIYA
Sbjct  299  KWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNEQTSTPNIYA  358

Query  476  LGDVIDAPELTPVAIQAGKLLSRRLFGNGTTLMDYTKICTAVFTPVEYGCCGLSEEDAIA  535
            +GDVIDAPELTPVAIQAG+LLSRRL+ N T  MDY KICTAVFTP+EYGCCGLSEED+  
Sbjct  359  IGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKE  418

Query  536  SAGRENVEVYHQNFTPLEWSLSHD-RPLAKECYAKLIVDTTQQKRVLGFHYLGPNAGEVT  594
              G +N+EVYH+NF PLEWSLS + R  A+ CY K+I D T+ K V+GFHYLGPNAGEVT
Sbjct  419  RYGEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVT  478

Query  595  QAIGIAIKLNATYDDFINTVGIHPTTAEIFTTLEITKESGVDASASGC  642
            QA+G+A+KL  TYD  ++TVGIHPTTAE FTTLEITK SG   +  GC
Sbjct  479  QAMGLAMKLGFTYDQMVDTVGIHPTTAETFTTLEITKSSGGTTTGGGC  526

>PHALS_06481
Length=644

 Score = 681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/617 (56%), Positives = 438/617 (71%), Gaps = 19/617 (3%)

Query  41   YHVVGWKQCPYYVKAASVASSMQHLFPSQVKATIHEHPNKESFVNWLNESQTEFAHQFDN  100
            +++ GWK CP ++KA  + ++MQ L+P ++   I    ++E F  WL  SQ +FA  F  
Sbjct  32   FYLAGWKTCPSFIKAREIVAAMQMLYPDRLAFKILLFEDREKFRVWLKASQGDFAVSFGA  91

Query  101  DARPLKHKSSPFCYLEQDDTPKFVGGCDDTLAFFRARTQsapsapassasIHANDTSDAD  160
             ++ +KH +SPF +     T  FVGGCDD L FFR+           ++   A  +S A 
Sbjct  92   KSKAMKHVTSPFVWSSNPTT--FVGGCDDLLLFFRSGIAVGRPQGMHTSDEVAEISSTAV  149

Query  161  VK---YDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCI  217
             +   +D+DLVVIGGG GGLACSKEA+  GQKV VLDYVKPSP G+ WGLGGTCVNVGCI
Sbjct  150  QEKPIFDYDLVVIGGGLGGLACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCI  209

Query  218  PKKLMHQSSIIGEILHKDADQFGWSVSNA-----TFDWSKLVSSVQDYIHGLNFKYRVDL  272
            PKKL+HQSS+IGEI+  D+ +FGW   N       FDW +LV++V  YI  +NFKY+V L
Sbjct  210  PKKLIHQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKL  269

Query  273  RDKKVKYENMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALS  332
            R K VKYEN LG+F D HT+ L++   +KG   +T R  VIAVG RP+ L+CPG E+A+S
Sbjct  270  RSKNVKYENFLGSFVDPHTVKLSH--PRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVS  327

Query  333  SDDIF-SKPDAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGE  391
            SDDIF  K   PGKTLV+GASYVALECAGFLKG G++V +MVRSILLR FDQ++A +IGE
Sbjct  328  SDDIFWMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVRSILLRSFDQEMADKIGE  387

Query  392  YMESESGIAFIKESVPTSIVKLENGQFQVTHT-----TGQDVYDTILNATGRSPDVQKLN  446
            YME +SGI FI+++VP SI +LEN Q  V        T ++ ++T+LNATGR P+V  L 
Sbjct  388  YMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLG  447

Query  447  LDAAGVALNPKSGRIHVVNEQTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLFGNGTT  506
            LD AGV LN K+GRI V NEQTST NIYA+GDV+DAPELTPVAIQ+G+LLS+RL+ N + 
Sbjct  448  LDKAGVKLNEKTGRIMVKNEQTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNNSSV  507

Query  507  LMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHD-RPLAKE  565
             MDY K+CT VFTP+EYGCCGLSEE +    G +N+E+YH NF PLEWSLS + R  +  
Sbjct  508  QMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNS  567

Query  566  CYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIFT  625
            CY K++ D ++ K VLGFHYLGPNAGEV QA+G+A++L  TYD  +NTVGIHP TAE  T
Sbjct  568  CYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLT  627

Query  626  TLEITKESGVDASASGC  642
             LE+TK SG   +  GC
Sbjct  628  ILEVTKSSGGATTGGGC  644

>PHYRA_50855
Length=489

 Score = 677 bits (1746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/490 (69%), Positives = 388/490 (79%), Gaps = 12/490 (2%)

Query  163  YDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLM  222
            YD+DLVVIGGGSGGLACSKEA+  G+KV VLDYVKPSP G++WGLGGTCVNVGCIPKKLM
Sbjct  2    YDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  61

Query  223  HQSSIIGEILHKDADQFGWSV----SNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVK  278
            HQSS+IGE++H D+  FGW+V    S  TF+W +LVS+V  YI  +NFKY+V+LR K VK
Sbjct  62   HQSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVK  121

Query  279  YENMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDDIF-  337
            YEN LG+F D HTL L +   +KG   +T R  VIAVGGRPK LSCPG EHA+SSDDIF 
Sbjct  122  YENFLGSFVDPHTLELWH--HRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFW  179

Query  338  SKPDAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGEYMESES  397
             K   PGKTLVVGASYVALECAGFLKG G++V +MVRSILLRGFDQD+A +IGEYME +S
Sbjct  180  MKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFDQDMANKIGEYMEVQS  239

Query  398  GIAFIKESVPTSIVKLENGQFQVTHT-----TGQDVYDTILNATGRSPDVQKLNLDAAGV  452
            GI FI+++VP SI  LENGQ  V  T     + ++ +DT+LNATGR PDV KL LD AGV
Sbjct  240  GIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGV  299

Query  453  ALNPKSGRIHVVNEQTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLFGNGTTLMDYTK  512
             LN KSGRI V NEQTST NIYALGDVIDAPELTPVAIQAG+LLSRRL+ N T  MDY K
Sbjct  300  KLNEKSGRIWVKNEQTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYEK  359

Query  513  ICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAKECYAKLIV  572
            +CTAVFTP+EYGCCGLSEED+    G +NVEVYH NF PLEWSLS  R  A+ CY K+I 
Sbjct  360  VCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVIC  419

Query  573  DTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIFTTLEITKE  632
            D T+ K V+GFHYLGPNAGEVTQA+G+A+KL  TYD  ++TVGIHPTTAE FTTLE+TK 
Sbjct  420  DKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTKS  479

Query  633  SGVDASASGC  642
            SG   +  GC
Sbjct  480  SGGATTGGGC  489

>PYVX_18170
Length=510

 Score = 659 bits (1699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/541 (63%), Positives = 402/541 (74%), Gaps = 39/541 (7%)

Query  109  SSPFCYLEQDDTPKFVGGCDDTLAFFRARTQsapsapassasIHANDTSDADVKYDWDLV  168
            SSPF +    +   FVGGCD  L  FR++     +A        +   ++ +V       
Sbjct  2    SSPFVW--TSNPTAFVGGCDALLDRFRSQVPRPNAA--------SKPQANGEV-------  44

Query  169  VIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSII  228
                         EASK GQKVLVLDYVKPSP G+ WGLGGTCVNVGCIPKKLMHQS++I
Sbjct  45   -------------EASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALI  91

Query  229  GEILHKDADQFGWSVSNA-TFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYENMLGTFK  287
            GE++HKDA  FGW   NA  FDWS+L SSV  YI  LNFKY+VDLRDKKVKYEN LG F 
Sbjct  92   GEVMHKDAALFGWQFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFV  151

Query  288  DAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDDIFSKPDAPGKTL  347
            D HT+ L+N   +K    VT RR V+AVGGRP+ L CPG E +++SDDIF +  APGKTL
Sbjct  152  DPHTIELSN--PRKPSKTVTTRRVVVAVGGRPRLLPCPGGELSITSDDIFWRKTAPGKTL  209

Query  348  VVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGEYMESESGIAFIKESVP  407
            VVGASYVALECAGFLKGQG+DV +MVRSILLRGFDQD+A RIGEYME E+GI FI+E+VP
Sbjct  210  VVGASYVALECAGFLKGQGYDVKVMVRSILLRGFDQDMANRIGEYMEVEAGIEFIRETVP  269

Query  408  TSIVKLENGQFQVTHT-----TGQDVYDTILNATGRSPDVQKLNLDAAGVALNPKSGRIH  462
            +SI KLE+G+  V  T       ++ +DT+LNATGR+PDV KL LD AGV LNPK+GRI 
Sbjct  270  SSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRIL  329

Query  463  VVNEQTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLFGNGTTLMDYTKICTAVFTPVE  522
            V NEQTSTPNI+A+GDVIDAPELTPVAIQAG+LL+RRL+ N TTLMDY K+CTAVFTP+E
Sbjct  330  VTNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYEKVCTAVFTPIE  389

Query  523  YGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHD-RPLAKECYAKLIVDTTQQKRVL  581
            YGCCGLSEE++I   G +N+EVYHQNFTPLEW+LS D RP    CY K+I D T+   V+
Sbjct  390  YGCCGLSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVV  449

Query  582  GFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIFTTLEITKESGVDASASG  641
            GFHYLGPNAGEVTQAIG+A+KL  TY+  ++ VGIHPTTAE FTTLE+TK SG  A+   
Sbjct  450  GFHYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHPTTAETFTTLEVTKSSGASAAGGN  509

Query  642  C  642
            C
Sbjct  510  C  510

>SPRG_04074
Length=509

 Score = 431 bits (1108),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 248/497 (50%), Positives = 320/497 (64%), Gaps = 31/497 (6%)

Query  163  YDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLM  222
            +D+D VVIGGGSGG+A +KEA++LG KV + D+VKP+  G+ WGLGGTCVNVGC+PKK+M
Sbjct  4    FDYDFVVIGGGSGGMAAAKEAARLGAKVALFDFVKPTVHGTKWGLGGTCVNVGCVPKKIM  63

Query  223  HQSSIIGEILHKDADQFGWSV-SNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYEN  281
            H S I+G  LH DA   GW V      +W  LV +VQ ++  LNF YRV LR  KV+Y N
Sbjct  64   HYSGILGAGLH-DAAHLGWQVPEKVEHNWETLVEAVQAHVKKLNFSYRVGLRSNKVQYIN  122

Query  282  MLGTFKDAHTLTLTNDAKKKGPTD-VTFRRAVIAVGGRPK-PLSCPG-WEHALSSDDIFS  338
             L  F+D HTL+      K GPT  +T    +IA GGRP  P   PG  E+A++SDD+FS
Sbjct  123  ALARFEDPHTLSYQ---VKNGPTQTLTAAHILIATGGRPTVPKDIPGVAEYAITSDDLFS  179

Query  339  KPDAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGEYMESESG  398
               APGKTLVVG SY+ALECAGFL    +  T+ VRSILLRGFD+ +A +I + M ++ G
Sbjct  180  LSTAPGKTLVVGGSYIALECAGFLNELHYPTTVAVRSILLRGFDRQVAAKIQDIMVAQ-G  238

Query  399  IAFIKESVPTSIVKLE-NGQFQV------THTTGQDVYDTILNATGRSPDVQKLNLDAAG  451
            + F   ++PTSIVK E  GQ  V      TH T  + +DT+L A GR+ D   + L+ AG
Sbjct  239  MDFRFNTLPTSIVKDEATGQLHVSFANSETHETFTEAFDTVLYAVGRTADTFNIGLEKAG  298

Query  452  VALNPKSGRIHVVNEQTSTPNIYALGDVIDA-PELTPVAIQAGKLLSRRLFG-NGTTLMD  509
            V   P +G+   VNE T+ P+I+A+GDV+   PELTPVAI+AG+ L RRLF  N T  M+
Sbjct  299  VKALP-NGKFETVNEATNVPHIHAVGDVLQGKPELTPVAIRAGEHLVRRLFKPNYTKTMN  357

Query  510  YTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSH-----------  558
            Y  I T VFTPVEYG  GLSEE+AI   G++++ VY   F  LEW   H           
Sbjct  358  YDLIPTTVFTPVEYGTIGLSEEEAITRYGKDDIVVYPWEFQTLEWGAVHRKKAESAQEGD  417

Query  559  -DRPLAKECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIH  617
             D      C +KL+   +  ++VLGFH++GPNAGEVTQ   +A+ + AT +DF N +GIH
Sbjct  418  YDTEFPANCLSKLVCQKSANEKVLGFHFVGPNAGEVTQGFAVAVTMGATKEDFDNVIGIH  477

Query  618  PTTAEIFTTLEITKESG  634
            PT AE F  L +TKESG
Sbjct  478  PTDAESFMALTVTKESG  494

>SDRG_14408
Length=528

 Score = 428 bits (1100),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 249/510 (49%), Positives = 325/510 (64%), Gaps = 31/510 (6%)

Query  156  TSDADVKYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVG  215
            T+     +D+D VVIGGGSGG+A +KEA++LG KV + D+VKP+  G+ WGLGGTCVNVG
Sbjct  16   TTSTMSNFDYDFVVIGGGSGGMAAAKEAARLGAKVALFDFVKPTVHGTKWGLGGTCVNVG  75

Query  216  CIPKKLMHQSSIIGEILHKDADQFGWSV-SNATFDWSKLVSSVQDYIHGLNFKYRVDLRD  274
            C+PKK+MH S I+G  LH DA   GW +      +W  LV +VQ ++  LNF YRV LR 
Sbjct  76   CVPKKIMHYSGILGAGLH-DAAHLGWQLPEKVEHNWETLVETVQAHVKKLNFSYRVGLRS  134

Query  275  KKVKYENMLGTFKDAHTLTLTNDAKKKGPTD-VTFRRAVIAVGGRPK-PLSCPG-WEHAL  331
             KV+Y N L  F+D HTL+      K GPT  +T    +IA GGRP  P   PG  E+A+
Sbjct  135  NKVQYINALARFEDPHTLSY---QIKNGPTQTLTAAHILIATGGRPTVPKEIPGVGEYAI  191

Query  332  SSDDIFSKPDAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGE  391
            +SDD+FS   APGKTLVVG SY+ALECAGFL    +  T+ VRSILLRGFD+ +A +I +
Sbjct  192  TSDDLFSLTTAPGKTLVVGGSYIALECAGFLNELHYPTTVAVRSILLRGFDRQVAAKIQD  251

Query  392  YMESESGIAFIKESVPTSIVKLE-NGQFQV------THTTGQDVYDTILNATGRSPDVQK  444
             M ++ G+ F   ++PTSIVK +  GQ  V      T+ T  +V+DT+L A GR+ D   
Sbjct  252  IMVAQ-GMDFRFNTLPTSIVKDDATGQLHVSFANSETNETFTEVFDTVLYAVGRTADTFN  310

Query  445  LNLDAAGVALNPKSGRIHVVNEQTSTPNIYALGDVIDA-PELTPVAIQAGKLLSRRLFG-  502
            + L+  GV   P +G+   VNE T+ P+I+A+GDV+   PELTPVAI+AG+ L RRLF  
Sbjct  311  IGLEKVGVKALP-NGKFETVNEATNVPHIHAVGDVLQGKPELTPVAIRAGEHLVRRLFKP  369

Query  503  NGTTLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSH----  558
            N T  M+Y  I T VFTPVEYG  GLSEE+AIA  G+++V VY   F  LEW   H    
Sbjct  370  NYTKTMNYDLIPTTVFTPVEYGTIGLSEEEAIARYGKDDVVVYPWEFQTLEWGAVHRQKA  429

Query  559  --------DRPLAKECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDF  610
                    D      C +KL+   +  ++VLGFH++GPNAGEVTQ   +A+ + AT +DF
Sbjct  430  ESAQEGDYDTEFPANCLSKLVCQKSANEKVLGFHFVGPNAGEVTQGFAVAVTMGATKEDF  489

Query  611  INTVGIHPTTAEIFTTLEITKESGVDASAS  640
             N +GIHPT AE F  L +TKESG    A+
Sbjct  490  DNVIGIHPTDAESFMALTVTKESGASWVAT  519

>SDRG_03822
Length=494

 Score = 256 bits (654),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 166/475 (35%), Positives = 248/475 (52%), Gaps = 26/475 (5%)

Query  165  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  224
            +D +V+G GSGG++ +  A   G KVLV++  + +      GLGGTCVNVGC+PKK+M  
Sbjct  4    YDYIVLGAGSGGVSSAHRAVAYGAKVLVIERGQAN---DGAGLGGTCVNVGCVPKKIMFN  60

Query  225  SSIIGEILHKDADQFGWS----VSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYE  280
            +++  E+LH  A  + +     +    FDW+ + +    Y+  LN  Y   + + KV   
Sbjct  61   AALHAEMLHS-ARAYAFKGVQDIQFGAFDWAAMKAKRDAYVKWLNDMYGEGMLEDKVDLV  119

Query  281  NMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDDIFSKP  340
                 F D HT+ +  D           +  +IAVGG P     PG EHA+SSD  F+  
Sbjct  120  MGAAKFVDNHTVEVNGDRYAA-------KHILIAVGGVPAMPPLPGIEHAISSDGFFALE  172

Query  341  DAPGKTLVVGASYVALECAGFLKGQGFDVTIMVR-SILLRGFDQDIARRIGEYMESESGI  399
              P K  VVGA Y+A+E AG       D T+  R + +LR FD  +   +   ME  +G+
Sbjct  173  TQPRKVAVVGAGYIAVELAGIFNALKSDTTVFCRGNQVLRTFDPIVRDLVNTEME-HAGV  231

Query  400  AFIKESVPTSIVKLENGQFQVTHTTGQDV-----YDTILNATGRSPDVQKLNLDAAGVAL  454
             F++ES  TSI K E+G   +  T          ++T+L A GR+P    L L+   +AL
Sbjct  232  RFVRESGITSIEKAEDGTLTIQATVAGVAQSFAGFETVLFAIGRTPRTHDLGLETTDIAL  291

Query  455  NPKSGRIHVVNEQTSTPNIYALGDVIDAP-ELTPVAIQAGKLLSRRLFGN-GTTLMDYTK  512
            +P         E T+ PN++A+GDV     ELTPVAI AG+ L+ RLFGN     ++Y +
Sbjct  292  SPDQFIQVDAQENTTVPNVHAVGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVNYHQ  351

Query  513  ICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAKECYAKLIV  572
            I T VF+    G  GL+E  A+A  G  NV  +  +F+ + +++S ++   K   A  +V
Sbjct  352  IPTVVFSHPPIGTIGLTEPQAVAQYGAHNVTTHTSSFSNMFYAMSAEKD--KVQTAMKLV  409

Query  573  DTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIFTTL  627
                ++ V+G H  G  A E+ Q  G+A+K+ A   DF N V IHPT +E   T+
Sbjct  410  CIGVEETVVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  464

>PYAR_17512
Length=533

 Score = 254 bits (650),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 173/506 (34%), Positives = 260/506 (51%), Gaps = 50/506 (10%)

Query  160  DVKYDWDLVVIGGGSGGLACSKEASKL-GQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIP  218
            DV+YD+  +VIG GSGG+A S+ A+     +V V++  +         LGGTCVNVGC+P
Sbjct  31   DVEYDY--LVIGAGSGGMASSRRAASYPNTRVAVVEQAR---------LGGTCVNVGCVP  79

Query  219  KKLMHQSSIIGEILHKDADQFGWS--------VSNATFDWSKLVSSVQDYIHGLNFKYRV  270
            KK+M+ ++ +G +LH+D   +G+         +    F W+KL      Y+  LN  Y  
Sbjct  80   KKIMYLAANMGHLLHRDLFHYGFETKRGGGHLIDETQFHWNKLKERRDAYVLRLNGIYER  139

Query  271  DLRDKKVKYENMLGTFK-------DAHTLTLTN---------DAKKKGPTD---VTFRRA  311
            +L + KV+      TF        D   +   N         +A+     D   ++ +  
Sbjct  140  NLGNSKVELLTGTATFNAQGNVEVDGKEIPAKNVLIAVXXXXNAQGNVEVDGKEISAKNV  199

Query  312  VIAVGGRPKPLSCPGWEHALSSDDIFSKPDAPGKTLVVGASYVALECAGFLKGQGFDVTI  371
            +IAVGG+P   + PG EH + SD  F   + P K  VVGA Y+A+E AG L G G D TI
Sbjct  200  LIAVGGKPLIPNIPGKEHCIDSDGFFELEEMPKKVAVVGAGYIAVELAGVLHGLGSDTTI  259

Query  372  MVRSI-LLRGFDQDIARRIGEYMESESGIAFIKESVPTSIVKLENGQFQVTHTTGQD--V  428
              R   +LRGFD+ I   + + M+ + G+     S+   + K  +G   +    G +   
Sbjct  260  FCRKDGVLRGFDELIRSTLHDAMDKD-GLKLRPHSLVAKVTKQADGTKTLVLQDGTEHAG  318

Query  429  YDTILNATGRSPDVQKLNLDAAGVALNPKSG-RIHVVNEQTSTPNIYALGDVIDAPELTP  487
            +DT++ A GR P  Q LNL+ AGV  + +   +I      T+  NI+A+GDV   P LTP
Sbjct  319  FDTVIYAAGRVPLTQSLNLEGAGVETDAQGFIKIDEYQRTTAKKNIFAVGDVCGTPALTP  378

Query  488  VAIQAGKLLSRRLFGN-GTTLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYH  546
            VAI AG+ LS RLFG      M Y  I T VF+    G  GL+E++A A  G + V+VY 
Sbjct  379  VAIAAGRRLSDRLFGGMKEAKMSYENIPTVVFSHPPIGTVGLTEKEARAKHGDDAVKVYS  438

Query  547  QNFTPLEWSLSHD-----RPLAKECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAI  601
              F  + + + ++     +   K   A  +V   ++++V+G H +G  A E+ Q  G+A+
Sbjct  439  SRFVNMHYGIVNEFGNDGQQKPKPMTAMKLVCVGKEEKVVGVHLIGMAADEILQGFGVAV  498

Query  602  KLNATYDDFINTVGIHPTTAEIFTTL  627
            K+ AT  DF + V IHPT AE   T+
Sbjct  499  KMGATKADFDSCVAIHPTAAEELVTM  524

>SDRG_12187
Length=462

 Score = 249 bits (637),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 175/479 (37%), Positives = 258/479 (54%), Gaps = 42/479 (9%)

Query  165  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  224
            +DLVV+GGGSGG+A ++ A+  G+KVLV++  +         LGGTCVNVGC+PKK+M+ 
Sbjct  5    YDLVVMGGGSGGIASARRAATYGKKVLVVERGR---------LGGTCVNVGCVPKKVMYA  55

Query  225  SSIIGEILHKDADQFGW-SVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYENML  283
            ++ +   +  DA  +G+ +V N T DW+ L      Y+  LN  Y  +L+   V +   L
Sbjct  56   AADLAHSMRHDAPAYGFPAVPNTTVDWATLKQRRDAYVTRLNGIYSRNLQGSGVDFAQGL  115

Query  284  GTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDDIFSKPDAP  343
             +F     + +  DA    P D      ++AVGG+P     PG EH +SSD  F   + P
Sbjct  116  CSFGSDGRVQI--DAT---PLDAEATNVLVAVGGQPVMPDIPGIEHCISSDGFFELDERP  170

Query  344  GKTLVVGASYVALECAGFLKGQGFDVTIMVRSI-LLRGFD-------QDIARRIGEYMES  395
             +  VVGA Y+A+E AG L+G G D TI  R   +LR FD        D  +R G  ++ 
Sbjct  171  ARVAVVGAGYIAVELAGVLRGLGSDTTIFCRQQGVLRSFDDMLQAVLHDAFQRDGITLQP  230

Query  396  ESGIAFIKESVPTSIVKLENGQFQVTHTTGQ--DVYDTILNATGRSPDVQKLNLDAAGVA  453
             S IA + +  PT+      G   VT T G+    +D +L ATGR+P  + L L+  G+ 
Sbjct  231  HSTIARVDKD-PTT------GSLSVTTTAGEHHSGFDCVLVATGRTPMTKDLGLEHRGIQ  283

Query  454  LNPKSGRIHV-VNEQTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLFGN-GTTLMDYT  511
            L+P +G I V   + TS P ++ALGDV+D   LTPVAI AG+ L+ RLFG       DYT
Sbjct  284  LSP-NGFIPVDAYQATSAPGVFALGDVVDTAALTPVAIAAGRRLADRLFGGLHDAKADYT  342

Query  512  KICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSL---SHDRPLAKECYA  568
             I + VF+    G  GL+E++A      + ++VY   F  + +SL   +H++P      A
Sbjct  343  NIPSVVFSHPPIGTIGLTEQEARKVYRDDELKVYSSKFVNMHYSLYEHAHEKPTT----A  398

Query  569  KLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIFTTL  627
              ++     ++++G H +G  A E+ Q  G+AIK+ A   D    + IHPT AE   TL
Sbjct  399  MKLICVGPSEKIVGLHVIGRGADEMLQGFGVAIKMGACKKDLDACIAIHPTAAEELVTL  457

>SDRG_03823
Length=497

 Score = 249 bits (636),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 171/475 (36%), Positives = 249/475 (52%), Gaps = 26/475 (5%)

Query  165  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  224
            +D +VIGGGSGG + ++ A+  G KVLV++           G+GGTCVNVGC+PKK+M  
Sbjct  7    YDYIVIGGGSGGNSSARRAAAYGAKVLVIER---GHANDGAGMGGTCVNVGCVPKKVMFN  63

Query  225  SSIIGEILHKDADQFGWS----VSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYE  280
            +++  E+LH  A  + +     V   +FDW+ L      Y+  LN  Y  +L + K+   
Sbjct  64   AAMHAEMLHS-AHAYTFKNIQDVEYGSFDWAALKKKRDAYVARLNGIYERNLGNNKIPLI  122

Query  281  NMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDDIFSKP  340
                 F D HT+ +  D         T +  +IAVGG P     PG EHA+SSD  F+  
Sbjct  123  YGAAKFVDNHTIEVNGD-------RYTAKHILIAVGGVPAMPPLPGIEHAISSDGFFALE  175

Query  341  DAPGKTLVVGASYVALECAGFLKGQGFDVTIMVR-SILLRGFDQDIARRIGEYMESESGI  399
              P K  VVGA Y+A+E AG       D T+  R + +LR FD  +   +   ME  +G+
Sbjct  176  TQPRKVAVVGAGYIAVELAGIFNALKSDTTVFCRGNQVLRTFDPIVRDLVNTEME-HAGV  234

Query  400  AFIKESVPTSIVKLENGQFQVTHTTGQDV-----YDTILNATGRSPDVQKLNLDAAGVAL  454
             F++ES  TSI K E+G   +  T          ++T+L A GR+P    L L+   +AL
Sbjct  235  RFVRESGITSIEKAEDGTLTIQATVAGVAQSFAGFETVLFAIGRTPRTHDLGLETTDIAL  294

Query  455  NPKSGRIHVVNEQTSTPNIYALGDVIDAP-ELTPVAIQAGKLLSRRLFGNG-TTLMDYTK  512
            +P         E T+ PN++A+GDV     ELTPVAI AG+ L+ RLFGN     ++Y +
Sbjct  295  SPDQFIQVDAQENTTVPNVHAVGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVNYHQ  354

Query  513  ICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAKECYAKLIV  572
            I T VF+    G  GL+E  AI   G  NV+VY   F  + +++S      K+  A  ++
Sbjct  355  IPTVVFSHPPIGTIGLTEPQAIEQYGAHNVKVYTSTFFNMFYAMSEQD--EKQKTAMKLM  412

Query  573  DTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIFTTL  627
               +++ V+G H  G  A E+ Q  G+A+K+ A   DF N V IHPT +E   T+
Sbjct  413  CIGEEETVIGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  467

>PYAP_21882
Length=502

 Score = 248 bits (634),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 166/482 (34%), Positives = 248/482 (51%), Gaps = 37/482 (8%)

Query  165  WDLVVIGGGSGGLACSKEASKLGQ-KVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMH  223
            +D +VIG GSGG+A S+ A+     +V V++  +         LGGTCVNVGC+PKK+M+
Sbjct  31   YDYLVIGAGSGGMASSRRAATYANTRVAVVEQAR---------LGGTCVNVGCVPKKIMY  81

Query  224  QSSIIGEILHKDADQFGWSVSNA-------TFDWSKLVSSVQDYIHGLNFKYRVDLRDKK  276
             ++ +G  LH+D   +G+  +          F W KL      Y+  LN  Y  +L + K
Sbjct  82   LAANLGHTLHRDLFHYGFESTKGEHLAHETQFHWKKLKERRDAYVLRLNGIYGRNLDNSK  141

Query  277  VKYENMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDDI  336
            V        F+   T     + +  G  ++  +  +IAVGG+P     PG EH + SD  
Sbjct  142  VDL------FRGTATFNAKGNVEVDG-KEIAAKNVLIAVGGKPLIPDIPGKEHCIDSDGF  194

Query  337  FSKPDAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSI-LLRGFDQDIARRIGEYMES  395
            F   + P K  VVGA Y+A+E AG L G G D TI  R   +LRGFD+ I   + + M  
Sbjct  195  FELEEQPKKVAVVGAGYIAVELAGVLHGLGSDTTIFCRKEGVLRGFDELIRTTLHDAMAK  254

Query  396  ESGIAFIKESVPTSIVKLENGQFQVTHTTGQD--VYDTILNATGRSPDVQKLNLDAAGVA  453
            E G+     S  T ++K  +G   +    G +   +D+++ A GR P  + LNL+AAG+ 
Sbjct  255  E-GVNLRPHSSVTKVIKAADGTKTLVLADGSEHSGFDSVIYAAGRVPLTESLNLEAAGIE  313

Query  454  LNPKSGRIHVVNEQTSTP--NIYALGDVIDAPELTPVAIQAGKLLSRRLFGN-GTTLMDY  510
             +   G I +   Q +T   NI+A+GDV   P LTPVAI AG+ L+ RLFG        Y
Sbjct  314  TD-DHGFIKIDEYQRTTAKTNIFAVGDVCGTPALTPVAIAAGRRLADRLFGGMKDAKASY  372

Query  511  TKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHD-----RPLAKE  565
              I T VF+    G  GL+E+ A A  G + ++VY   F  + + + ++     +   K 
Sbjct  373  ENIPTVVFSHPPIGTVGLTEDHARAKFGDDQIKVYTSRFVNMHYGIINEFGEDGQQKPKP  432

Query  566  CYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIFT  625
              A  +V   + ++V+G H +G  A E+ Q  G+A+K+ AT  DF + V IHPT AE   
Sbjct  433  MTAMKLVCQGKDEKVVGVHIIGMAADEMLQGFGVAVKMGATKADFDSCVAIHPTAAEELV  492

Query  626  TL  627
            T+
Sbjct  493  TM  494

>SDRG_11131
Length=494

 Score = 248 bits (632),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 163/474 (34%), Positives = 247/474 (52%), Gaps = 24/474 (5%)

Query  165  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  224
            +D +V+G GSGG++ +  A   G KVLV++  + +      GLGGTCVNVGC+PKK+M  
Sbjct  4    YDYIVLGAGSGGVSTAHRAVAYGAKVLVVERGREN---DGAGLGGTCVNVGCVPKKIMFN  60

Query  225  SSIIGEILHKDADQFGWSVSN---ATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYEN  281
            +++  E+LH         VS+     FDW+ + +    Y+  LN  Y   + + KV    
Sbjct  61   AALHAEMLHSARAYAFKGVSDIQYGAFDWAAMKAKRDAYVTWLNSMYGEGMLEDKVDLVM  120

Query  282  MLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDDIFSKPD  341
                F D HT+ +  +         T +  +IAVGG P     PG EHA+SSD  F+   
Sbjct  121  GAAKFVDNHTIEVNGE-------RYTAKHILIAVGGVPALPPIPGIEHAISSDGFFALET  173

Query  342  APGKTLVVGASYVALECAGFLKGQGFDVTIMVR-SILLRGFDQDIARRIGEYMESESGIA  400
             P K  VVGA Y+A+E AG       + T+  R + +LR FD  +   +   ME  +G+ 
Sbjct  174  QPRKVAVVGAGYIAVELAGIFNALKSNTTVFCRGNQVLRTFDPIVRDLVNTEME-HAGVQ  232

Query  401  FIKESVPTSIVKLENGQFQVTHTTGQDV-----YDTILNATGRSPDVQKLNLDAAGVALN  455
            F++ES   +I K  +G   +  T   +      ++T+L A GR+P    L L+   +AL+
Sbjct  233  FVRESGINAIEKAGDGTLTLQATVAGEPQSFTGFETVLFAIGRTPRTHDLGLETTDIALS  292

Query  456  PKSGRIHVVNEQTSTPNIYALGDVIDAP-ELTPVAIQAGKLLSRRLFGNG-TTLMDYTKI  513
             +        E T+ PN+YA+GDV     ELTPVAI AG+ L+ RLFGN     ++Y++I
Sbjct  293  TEKFIQVDAQENTTVPNVYAIGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVNYSQI  352

Query  514  CTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAKECYAKLIVD  573
             T VF+    G  GL+E  AIA  G  NV  +  +F+ + +++  ++   K   A  +V 
Sbjct  353  PTVVFSHPPIGTIGLTEAQAIAQYGAHNVTTHTSSFSNMFYAMCAEKD--KVQTAMKLVC  410

Query  574  TTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIFTTL  627
               ++ V+G H  G  A E+ Q  G+A+K+ A   DF N V IHPT +E   T+
Sbjct  411  IGVEEAVVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  464

>H310_14447
Length=501

 Score = 248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 164/459 (36%), Positives = 238/459 (52%), Gaps = 23/459 (5%)

Query  180  SKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGEILHKDADQF  239
            +  A + G KVLV++  +   V    G+GGTCVNVGC+PKK+M+ + +  EILH   D  
Sbjct  24   ASRAVEYGAKVLVIERGR---VNGGAGMGGTCVNVGCVPKKIMYNAGVHAEILHSAKDYS  80

Query  240  GWSVSN---ATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYENMLGTFKDAHTLTLTN  296
               V N    +FDW+ + +    Y++ L+  Y   L ++ + +      F D HT+ + N
Sbjct  81   FKDVVNVKFGSFDWAAMKAKRDAYVNWLSAAYEEGLGEENIDHVIGAAVFVDDHTVEV-N  139

Query  297  DAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDDIFSKPDAPGKTLVVGASYVAL  356
              +   P        +IAVGG P+  + PG EHA+SSD  F  P  P K  VVGA Y+A+
Sbjct  140  GQRYTAP------HILIAVGGMPQMPNIPGIEHAVSSDGFFDLPTQPKKVAVVGAGYIAV  193

Query  357  ECAGFLKGQGFDVTIMVR-SILLRGFDQDIARRIGEYMESESGIAFIKESVPTSIVKLEN  415
            E AG       D  +  R + +LR FD  +   + + M +++G+AF+  +   SI K  +
Sbjct  194  ELAGIFNALKSDTVVFCRGNQVLRKFDPLVRDLVNDEM-AKAGVAFVTHAHLESIRKEAD  252

Query  416  GQFQVTHTTGQDV-----YDTILNATGRSPDVQKLNLDAAGVALNPKSGRIHVVNEQTST  470
            G   V    G+       +D I++A GR P  Q + LD   V L+     +    E T+ 
Sbjct  253  GSLTVVAKVGEATNEFAGFDAIVSAIGRIPRTQDVGLDKTHVELSDDGFVVVDAQENTTV  312

Query  471  PNIYALGDVIDAP-ELTPVAIQAGKLLSRRLFGNGTTL-MDYTKICTAVFTPVEYGCCGL  528
              +YA+GDV     ELTPVAI AG+ L+ RLFG  T   + Y +I T VF+    G  GL
Sbjct  313  DGVYAIGDVTTTGWELTPVAIAAGRRLADRLFGKETNACIHYHQIPTVVFSHPPIGTIGL  372

Query  529  SEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAKECYAKLIVDTTQQKRVLGFHYLGP  588
            +E DAIA  GR+NV VY   F+ + ++L+       +   KL+    ++  V+G H  G 
Sbjct  373  TEPDAIAKYGRDNVTVYTSTFSNMFYALATHSAHKPQTAMKLVCIGVEET-VIGAHVAGL  431

Query  589  NAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIFTTL  627
             A E+ Q  G+AIKL A   DF N V IHPT AE   T+
Sbjct  432  GADEMIQGFGVAIKLGAYKSDFDNVVAIHPTAAEEMVTM  470

>SDRG_15045
Length=494

 Score = 246 bits (627),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 162/474 (34%), Positives = 246/474 (52%), Gaps = 24/474 (5%)

Query  165  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  224
            +D +V+G GSGG++ +  A   G KVLV++  + +      GLGGTCVNVGC+PKK+M  
Sbjct  4    YDYIVLGAGSGGVSTAHRAVAYGAKVLVVERGREN---DGAGLGGTCVNVGCVPKKIMFN  60

Query  225  SSIIGEILHKDADQFGWSVSN---ATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYEN  281
            +++  E+LH         VS+     FDW+ + +    Y+  LN  Y   + + KV    
Sbjct  61   AALHAEMLHSARAYAFKGVSDIQYGAFDWAAMKAKRDAYVTWLNSMYGEGMLEDKVDLVM  120

Query  282  MLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDDIFSKPD  341
                F D HT+ +  +         T +  +IAVGG P     PG EHA+SSD  F+   
Sbjct  121  GAAKFVDNHTIEVNGE-------RYTAKHILIAVGGVPALPPIPGIEHAISSDGFFALET  173

Query  342  APGKTLVVGASYVALECAGFLKGQGFDVTIMVR-SILLRGFDQDIARRIGEYMESESGIA  400
             P K  VVGA Y+A+E AG       + T+  R + +LR FD  +   +   ME  +G+ 
Sbjct  174  QPRKVAVVGAGYIAVELAGIFNALKSNTTVFCRGNQVLRTFDPIVRDLVNTEME-HAGVQ  232

Query  401  FIKESVPTSIVKLENGQFQVTHTTGQDV-----YDTILNATGRSPDVQKLNLDAAGVALN  455
            F++ES   +I K  +G   +  T   +      ++T+L A GR+P    L L+   +AL+
Sbjct  233  FVRESGINAIEKAGDGTLTLQATVAGEPQSFTGFETVLFAIGRTPRTHDLGLETTDIALS  292

Query  456  PKSGRIHVVNEQTSTPNIYALGDVIDAP-ELTPVAIQAGKLLSRRLFGN-GTTLMDYTKI  513
             +        E T+ PN+YA+GDV     ELTPVAI AG+ L+ RLFGN     ++Y++I
Sbjct  293  TEKFIQVDAQENTTVPNVYAIGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVNYSQI  352

Query  514  CTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAKECYAKLIVD  573
             T VF+    G  GL+E  AI   G  NV  +  +F+ + +++  ++   K   A  +V 
Sbjct  353  PTVVFSHPPIGTIGLTEPQAIEQYGAHNVTTHTSSFSNMFYAMCAEKD--KVQTAMKLVC  410

Query  574  TTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIFTTL  627
               ++ V+G H  G  A E+ Q  G+A+K+ A   DF N V IHPT +E   T+
Sbjct  411  IGVEEAVVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  464

>PPTG_09787
Length=493

 Score = 244 bits (622),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 176/484 (36%), Positives = 254/484 (52%), Gaps = 35/484 (7%)

Query  160  DVKYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPK  219
            DV YD+  +VIGGGSGG+A ++ A+  G KVLV++  +        GLGGTCVN GC+PK
Sbjct  4    DVVYDY--MVIGGGSGGMASARRAATFGAKVLVVERGREF---DGMGLGGTCVNFGCVPK  58

Query  220  KLMHQSSIIGEILHKDADQFGWSVSNAT-------FDWSKLVSSVQDYIHGLNFKYRVDL  272
            K+M  ++   E L+++ D   +S++ A+       FDW  + +    YI  LN  Y  +L
Sbjct  59   KVMFNTAAHVEHLNRNKD---YSINTASKDFEFGDFDWGNMKTKRDAYIKRLNGIYERNL  115

Query  273  RDKKVKYENMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALS  332
             + KV +   +          +  D  +      T +  ++A GG P     PG EH + 
Sbjct  116  GNAKVDHVQGIAKL-------VAKDKIEVAGQVYTGKHVLVAPGGVPTIPDLPGMEHVID  168

Query  333  SDDIFSKPDAPGKTLVVGASYVALECAGFLKGQGFDVTIMVR-SILLRGFDQDIARRIGE  391
            SD  F     P K  VVGA Y+A+E AG       D T+  R   +LR FD  +   + E
Sbjct  169  SDGFFKLEQQPKKVAVVGAGYIAVELAGIFNVLKSDTTLFCRYDQVLRKFDPIVRDLVNE  228

Query  392  YMESESGIAFIKESVPTSIVKLENGQFQ-VTHTTGQDV----YDTILNATGRSPDVQKLN  446
             ME ++G+ F++ S    + K ENG+   V    G++     +DTI+ A GR P  + L 
Sbjct  229  EME-KAGVKFVRNSRAVRVEKQENGKLTFVVTVNGEEQKFADFDTIVFAIGREPRTKDLG  287

Query  447  LDAAGVALNPKSGRIHV-VNEQTSTPNIYALGDV-IDAPELTPVAIQAGKLLSRRLFG-N  503
            L+  GV L+ + G I V   E TS P +YA+GD  +   ELTPVAI AG+ LS RLFG  
Sbjct  288  LEEIGVKLS-EGGFIEVDAQENTSVPGVYAIGDATVTGWELTPVAIAAGRRLSDRLFGGE  346

Query  504  GTTLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLA  563
                ++Y +I T +F+    G  G +E +AIA  G EN++VY   F  L  S++   P  
Sbjct  347  KDACLNYHQIPTVIFSHPPIGTIGYTEPEAIAKYGEENIKVYTSKFVNLLHSMAD--PER  404

Query  564  KECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEI  623
            K   A  +V   +++ V+G H  G  A E+ Q  G+A+K+NAT  DF N V IHPT AE 
Sbjct  405  KGKTAMKLVTVGEKETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEE  464

Query  624  FTTL  627
              T+
Sbjct  465  LVTM  468

>SPRG_11769
Length=453

 Score = 242 bits (617),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 168/479 (35%), Positives = 255/479 (53%), Gaps = 51/479 (11%)

Query  165  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  224
            +DLVV+GGGSGG+A ++ A+  G+KVLV++  +         LGGTCVNVGC+PKK+M+ 
Sbjct  5    YDLVVMGGGSGGIASARRAATYGKKVLVVERGR---------LGGTCVNVGCVPKKVMYA  55

Query  225  SSIIGEILHKDADQFGW-SVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYENML  283
            ++ +   +  DA  +G+ +V N T DW+ L      Y+  LN  Y  +L+   V + + L
Sbjct  56   AADLAHSMRHDAPAYGFPAVPNTTVDWATLKQRRDAYVTRLNGIYARNLQGSGVDFAHGL  115

Query  284  GTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDDIFSKPDAP  343
             +F         +D ++           ++AVGG+P     PG EH +SSD  F   + P
Sbjct  116  CSFG--------SDGRRG-------DERLVAVGGQPVMPDIPGIEHCISSDGFFELDERP  160

Query  344  GKTLVVGASYVALECAGFLKGQGFDVTIMVRSI-LLRGFD-------QDIARRIGEYMES  395
             +  VVGA Y+A+E AG L+G G D TI  R   +LR FD        D  +R G  ++ 
Sbjct  161  ARVAVVGAGYIAVELAGVLRGLGSDTTIFCRQQGVLRSFDDMLQSVLHDAFKRDGITLQP  220

Query  396  ESGIAFIKESVPTSIVKLENGQFQVTHTTG--QDVYDTILNATGRSPDVQKLNLDAAGVA  453
             S +A + +  P +      G   +T T G     +D +L ATGR+P  + L L+  G+ 
Sbjct  221  HSTVARVDKVDPAT------GTLSLTTTAGDYHTGFDCVLVATGRTPMTKHLGLEHRGIE  274

Query  454  LNPKSGRIHV-VNEQTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLFGN-GTTLMDYT  511
            L+P +G I V   + TS P ++ALGDV++   LTPVAI AG+ L+ RLFG       DYT
Sbjct  275  LSP-NGFIPVDAYQATSAPGVFALGDVVNTAALTPVAIAAGRRLADRLFGGLPDAKADYT  333

Query  512  KICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSL---SHDRPLAKECYA  568
             I + VF+    G  GL+E++A      + ++VY   F  + +SL   +H++P      A
Sbjct  334  SIPSVVFSHPPIGTIGLTEQEARKVYREDEIKVYSSKFVNMHYSLYEHAHEKPTT----A  389

Query  569  KLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIFTTL  627
              ++     ++++G H +G  A E+ Q  G+AIK+ A   D    + IHPT AE   TL
Sbjct  390  MKLICVGPTEKIVGLHVIGRGADEMLQGFGVAIKMGACKKDLDACIAIHPTAAEELVTL  448

>PYIR_17506
Length=509

 Score = 241 bits (615),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 172/489 (35%), Positives = 249/489 (51%), Gaps = 42/489 (9%)

Query  159  ADVKYDWDLVVIGGGSGGLACSKEASKL-GQKVLVLDYVKPSPVGSTWGLGGTCVNVGCI  217
            +D  YD+  +VIG GSGG+A S+ A+     +V V++  +         LGGTCVNVGC+
Sbjct  35   SDAPYDY--LVIGAGSGGMASSRRAASYPNTRVAVVEQAR---------LGGTCVNVGCV  83

Query  218  PKKLMHQSSIIGEILHKDADQFGWSVS-------NATFDWSKLVSSVQDYIHGLNFKYRV  270
            PKK+M+ ++ +   LH+DA  +G+          N  F WSKL      YI  LN  Y  
Sbjct  84   PKKIMYLAANMNHTLHRDAFYYGFESKDGSHIGDNVEFHWSKLKERRDAYILRLNGIYER  143

Query  271  DLRDKKVKYENMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHA  330
            +L + KV        F     + +  D K      ++ R  +IAVGG+P     PG EH 
Sbjct  144  NLGNSKVDLIQGTAAFNAQGEVEV--DGKV-----ISARNVLIAVGGKPLIPDIPGKEHC  196

Query  331  LSSDDIFSKPDAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSI-LLRGFDQDIARRI  389
            + SD  F   + P K  VVGA Y+A+E AG L G G D TI  R   +LR FD+ +   +
Sbjct  197  IDSDGFFELEELPNKVAVVGAGYIAVELAGVLHGLGSDTTIFCRKDGVLRTFDELVRDTL  256

Query  390  GEYMESESGIAFIKESVPTSIVKLENGQFQVTHTTGQD--VYDTILNATGRSPDVQKLNL  447
             + M ++ GI    +S    I K  +G+  +    G +   +DT++ A GR P    LN+
Sbjct  257  HDAM-AKDGIVVRPQSNVARIEKTLDGKKTLVLADGSEHAGFDTVIYAAGRIPLTSNLNI  315

Query  448  DAAGVALNPKSGRIHVVNEQTSTP-NIYALGDVIDAPELTPVAIQAGKLLSRRLFGNGT-  505
             AAG+  + K G I V   QT++  N++A+GDV     LTPVAI AG+ LS RLFG    
Sbjct  316  SAAGIETD-KHGFIKVDEYQTTSKNNVFAVGDVCGTTALTPVAIAAGRRLSDRLFGGMED  374

Query  506  TLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHD------  559
              + Y  I T VF+    G  GL+E++A    G   ++ Y   F  + + L ++      
Sbjct  375  AKISYNNIPTVVFSHPPIGTIGLTEKEAREKYGDAQIKTYTSRFVNMYYGLVNELDAEGN  434

Query  560  -RPLAKECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHP  618
             +P  K   A  +V   + ++V+G H +G  A E+ Q  G+A+K+ AT  DF N V IHP
Sbjct  435  TKP--KPMTAMKLVCLGKDEKVVGLHIIGMAADEILQGFGVAVKMGATKADFDNCVAIHP  492

Query  619  TTAEIFTTL  627
            T  E   TL
Sbjct  493  TAGEELVTL  501

>PHYRA_72037
Length=493

 Score = 241 bits (614),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 177/484 (37%), Positives = 249/484 (51%), Gaps = 35/484 (7%)

Query  160  DVKYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPK  219
            DV YD+  VVIGGGSGG+A ++ A+  G KVLV++  +        GLGGTCVN GC+PK
Sbjct  4    DVVYDY--VVIGGGSGGMASARRAATYGAKVLVVERGREF---DGMGLGGTCVNFGCVPK  58

Query  220  KLMHQSSIIGEILHKDADQFGWSVSNAT-------FDWSKLVSSVQDYIHGLNFKYRVDL  272
            K+M  ++   E LH++ D   +S+  AT       FDW+ +      YI  LN  Y  +L
Sbjct  59   KVMFNAAAHVEHLHRNED---YSIKTATRDFAFGDFDWANMKKKRDAYILRLNGIYERNL  115

Query  273  RDKKVKYENMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALS  332
             + KV +   + T        +  D  +      T +  ++A GG P     PG EH   
Sbjct  116  GNAKVDHVQGIATL-------VAKDQVEVAGKVYTGKHVLVAPGGVPFVPDLPGMEHVTD  168

Query  333  SDDIFSKPDAPGKTLVVGASYVALECAGFLKGQGFDVTIMVR-SILLRGFDQDIARRIGE  391
            SD  F     P K  VVGA Y+A+E AG       D T+  R   +LR FD  +   + +
Sbjct  169  SDGFFRLEQQPKKVAVVGAGYIAVELAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVND  228

Query  392  YMESESGIAFIKESVPTSIVKLENGQFQ-VTHTTGQDV----YDTILNATGRSPDVQKLN  446
             ME ++G+ F++ +    + K ++G+   V    G++     +D IL A GR P  + L 
Sbjct  229  EME-KAGVKFVRNTRAVRVDKQDDGKLTFVVTVDGEEQKFPDFDVILYAIGREPRTKDLG  287

Query  447  LDAAGVALNPKSGRIHV-VNEQTSTPNIYALGDVIDAP-ELTPVAIQAGKLLSRRLFG-N  503
            L+  GV L    G I V   E TS P +YA+GD      ELTPVAI AG+ LS RLFG  
Sbjct  288  LEKVGVKL-ADGGFIEVDAQENTSVPGVYAIGDATTTGWELTPVAIAAGRRLSDRLFGGE  346

Query  504  GTTLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLA  563
                ++Y +I T +F+    G  G +E +A+A  G ENV+VY   F  L  S++   P  
Sbjct  347  KDACLNYHQIPTVIFSHPPIGTIGYTEPEAVAKFGEENVKVYSSKFVNLLHSMAD--PER  404

Query  564  KECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEI  623
            K   A  +V   +Q+ V+G H  G  A E+ Q  G+A+K+NAT  DF N V IHPT AE 
Sbjct  405  KGKTAMKLVTVGEQETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEE  464

Query  624  FTTL  627
              T+
Sbjct  465  LVTM  468

>SPRG_05609
Length=496

 Score = 241 bits (614),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 170/475 (36%), Positives = 249/475 (52%), Gaps = 26/475 (5%)

Query  165  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  224
            +D +VIGGGSGG + ++ A+  G KVL+++           G+GGTCVNVGC+PKK+M  
Sbjct  6    YDYIVIGGGSGGNSSARRAAAYGAKVLLIER---GHANDGAGMGGTCVNVGCVPKKIMFN  62

Query  225  SSIIGEILHKDADQFGWS----VSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYE  280
            +++  E+LH  A  + +     V   +FDW+ L      Y+  LN  Y  +L + ++   
Sbjct  63   AALHAEMLHS-AHAYTFKNIQDVEYGSFDWAALKKKRDAYVARLNGIYERNLGNNQIPLV  121

Query  281  NMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDDIFSKP  340
                 F D HT+ +  D         T +  +IAVGG P     PG EHA+SSD  F+  
Sbjct  122  YGAAKFVDNHTVEVNGD-------RYTAKHILIAVGGVPAMPPLPGIEHAISSDGFFALE  174

Query  341  DAPGKTLVVGASYVALECAGFLKGQGFDVTIMVR-SILLRGFDQDIARRIGEYMESESGI  399
              P K  VVGA Y+A+E AG       D T+  R + +LR FD  +   +   ME  +G+
Sbjct  175  TQPRKVAVVGAGYIAVELAGIFNALKSDTTLFCRGNQVLRTFDPIVRDLVNTEME-HAGV  233

Query  400  AFIKESVPTSIVKLENGQFQVTHTTGQ-----DVYDTILNATGRSPDVQKLNLDAAGVAL  454
             F++ES  TSI K  +G    +   G        ++T+L A GR+P    L L+   +AL
Sbjct  234  HFVRESGITSIEKAVDGYADDSGDGGGVPQSFPGFETVLFAIGRTPRTHDLGLETTDIAL  293

Query  455  NPKSGRIHVVNEQTSTPNIYALGDVIDAP-ELTPVAIQAGKLLSRRLFGN-GTTLMDYTK  512
            +          E TS PN+YA+GDV     ELTPVAI AG+ L+ RLFGN     ++Y +
Sbjct  294  SADKFIQVDAQENTSVPNVYAVGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACINYHQ  353

Query  513  ICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAKECYAKLIV  572
            I T VF+    G  GL+E  AIA  G  NV+VY  +F  + +++S      K+  A  ++
Sbjct  354  IPTVVFSHPPIGTIGLTEPQAIAQYGANNVKVYTSSFFNMFYAMSEQDD--KQKTAMKLI  411

Query  573  DTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIFTTL  627
               +++ V+G H  G  A E+ Q  G+A+K+ A   DF N V IHPT +E   T+
Sbjct  412  CIGEEETVVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  466

>PITG_14083
Length=493

 Score = 239 bits (609),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 175/484 (36%), Positives = 253/484 (52%), Gaps = 35/484 (7%)

Query  160  DVKYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPK  219
            DV YD+  +VIGGGSGG+A ++ A+  G KVLV++  +        GLGGTCVN GC+PK
Sbjct  4    DVVYDY--MVIGGGSGGMASARRAATYGAKVLVVERGREF---DGMGLGGTCVNFGCVPK  58

Query  220  KLMHQSSIIGEILHKDADQFGWSVSNAT-------FDWSKLVSSVQDYIHGLNFKYRVDL  272
            K+M  ++   E L+++ D   +S++ A+       FDW+ + +    YI  LN  Y  +L
Sbjct  59   KVMFNAAAHVEHLNRNKD---YSINTASKDFEFGDFDWANMKTKRDAYIKRLNGIYERNL  115

Query  273  RDKKVKYENMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALS  332
             + KV +   +          +  D  +      T +  ++A GG P     PG EH + 
Sbjct  116  GNAKVDHVQGIAKL-------VAKDKIEVAGQVYTGKHVLVAPGGTPTVPDLPGMEHVID  168

Query  333  SDDIFSKPDAPGKTLVVGASYVALECAGFLKGQGFDVTIMVR-SILLRGFDQDIARRIGE  391
            SD  F     P K  VVGA Y+A+E AG       D T+  R   +LR FD  +   + E
Sbjct  169  SDGFFKLEQQPKKVAVVGAGYIAVELAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNE  228

Query  392  YMESESGIAFIKESVPTSIVKLENGQFQ-VTHTTGQDV----YDTILNATGRSPDVQKLN  446
             ME ++G+ F++ S    + K +NG+   V    G++     +D+I+ A GRSP  + L 
Sbjct  229  EME-KAGVNFVRNSRAVRVEKQDNGKLTYVVTVDGEEQKFTDFDSIVYAIGRSPRTKDLG  287

Query  447  LDAAGVALNPKSGRIHV-VNEQTSTPNIYALGDV-IDAPELTPVAIQAGKLLSRRLFG-N  503
            L+  GV L  + G I V   E TS   +YA+GD  +   ELTPVAI AG+ LS RLFG  
Sbjct  288  LEEVGVKL-AEGGFIEVDAQENTSVAGVYAIGDATVTGWELTPVAIAAGRRLSDRLFGGE  346

Query  504  GTTLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLA  563
                ++Y +I T +F+    G  G +E +AIA  G ENV+VY   F  L  S++   P  
Sbjct  347  KDACLNYHQIPTVIFSHPPIGTIGYTEPEAIAKYGEENVKVYSSKFVNLIHSMAD--PER  404

Query  564  KECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEI  623
            K   A  +V    ++ V+G H  G  A E+ Q  G+A+K+NAT  DF N V IHPT AE 
Sbjct  405  KGKTAMKLVTVGDKETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEE  464

Query  624  FTTL  627
              T+
Sbjct  465  LVTM  468

>PHYSO_254571
Length=489

 Score = 238 bits (608),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 169/484 (35%), Positives = 240/484 (50%), Gaps = 38/484 (8%)

Query  164  DWDLVVIGGGSGGLACSKEASKL-GQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLM  222
            ++D +VIG GSGG+A ++ A+   G +V V++  +         LGGTCVNVGC+PKKLM
Sbjct  15   EYDYLVIGAGSGGMASARRAASYPGTRVAVVEQSR---------LGGTCVNVGCVPKKLM  65

Query  223  HQSSIIGEILHKDADQFGWSVSNAT--------FDWSKLVSSVQDYIHGLNFKYRVDLRD  274
              ++ +   LH D   +G+              FDW KL +    Y+  LN  Y  +L +
Sbjct  66   FIAADMSHKLHHDFLHYGFEDEETGGHLGQRTHFDWPKLKARRDAYVLRLNGIYERNLAN  125

Query  275  KKVKYENMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSD  334
             KV        F D   + +  D K     ++  +  +IAVGG+P     PG E  + SD
Sbjct  126  SKVALIRGSAKFNDKGNVEV--DGK-----EILAKNVMIAVGGKPLIPDIPGKELCIDSD  178

Query  335  DIFSKPDAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSI-LLRGFDQDIARRIGEYM  393
              F     P K  VVGA Y+A+E AG L   G D +I  R   +LR FD DI R   E  
Sbjct  179  GFFELETLPKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRSFD-DIVRTTLEDA  237

Query  394  ESESGIAFIKESVPTSIVKLENGQFQVTHTTGQDV--YDTILNATGRSPDVQKLNLDAAG  451
             ++ G+     S    + K ++G   +    G +   YD ++ A GR P    L LD AG
Sbjct  238  MAKDGVHLRPHSNIARVEKADDGTKTLVLADGSEYSGYDVVIYAAGRVPLTSNLQLDKAG  297

Query  452  VALNPKSGRIHVVN-EQTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLFGN-GTTLMD  509
            V  + K+G I V   ++TS   + A+GDV   P LTPVAI AG+ LS RLFG      + 
Sbjct  298  VDTD-KNGFIQVNEFQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLFGGMKDAKVS  356

Query  510  YTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHD------RPLA  563
            Y  I T VF+    G  GL+EE A    G + ++VY   F  + + L ++       P  
Sbjct  357  YENIPTVVFSHPPIGTIGLTEEQARRKYGDDEIKVYTSRFVNMYYGLINEMDEATGEPKD  416

Query  564  KECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEI  623
            K   A  +V   ++++V+G H +G  A E+ Q  G+A+K+ AT  DF N V IHPT  E 
Sbjct  417  KPKTAMKLVCAGKEEKVVGLHMIGMAADEILQGFGVAVKMGATKADFDNCVAIHPTAGEE  476

Query  624  FTTL  627
              TL
Sbjct  477  LVTL  480

>PHALS_08068
Length=497

 Score = 238 bits (607),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 161/487 (33%), Positives = 246/487 (51%), Gaps = 38/487 (8%)

Query  161  VKYDWDLVVIGGGSGGLACSKEASKL-GQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPK  219
            ++ ++D +VIG GSGG+A ++ A+   G +V +++  +         LGGTCVNVGC+PK
Sbjct  20   LQTEYDYLVIGAGSGGMASARRAASYSGTRVAIVEQDR---------LGGTCVNVGCVPK  70

Query  220  KLMHQSSIIGEILHKDADQFGWSVS--------NATFDWSKLVSSVQDYIHGLNFKYRVD  271
            KLM+ ++ +   LH D   +G+  +           F+WSKL +    Y+  LN  Y  +
Sbjct  71   KLMYIAADMNHKLHHDFLYYGFEDAATGGHLSHRMHFNWSKLKARRDAYVLRLNEIYETN  130

Query  272  LRDKKVKYENMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAL  331
            L + KV        F +   + + +        +V  ++ +IAVGGRP     PG E  +
Sbjct  131  LANSKVDLIRGSAKFNERGNVEVDDK-------EVRAKKILIAVGGRPLIPDIPGKELCI  183

Query  332  SSDDIFSKPDAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSI-LLRGFDQDIARRIG  390
             SD  F     P K  +VGA Y+A+E AG L   G   ++  R   +LR FD +I R   
Sbjct  184  DSDGFFELETLPTKVAIVGAGYIAVELAGVLNALGSKTSVFCRKEGVLRSFD-NILRTTL  242

Query  391  EYMESESGIAFIKESVPTSIVKLENGQFQVTHTTGQD--VYDTILNATGRSPDVQKLNLD  448
            E   +  G+     S    + +  +G   +  T G +   +D ++ ATGR P    LNL+
Sbjct  243  EEAMANDGVHLRPNSTVARVKEAADGTKTLVLTNGSEHRGFDVVICATGRVPLTSTLNLE  302

Query  449  AAGVALNPKSGRIHVVN-EQTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLFGN-GTT  506
             AG+  +  +G I V   ++T+  N+YA+GDV + P LTPVAI AG+ LS RLFG     
Sbjct  303  KAGITTD-DNGYIRVNEFQETTKNNVYAVGDVCNTPALTPVAIAAGRRLSDRLFGGMKDA  361

Query  507  LMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDR------  560
             + Y  I T +F+    G  GL+EE A    G  N++VY   F  + + L ++       
Sbjct  362  KLSYENIPTVIFSHPPIGTIGLTEEGARKKYGDNNIKVYSSRFVNMYYGLINETIEATGV  421

Query  561  PLAKECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTT  620
            P  K   A  +V    +++V+G H +G  A E+ Q  G+A+K+ AT  DF N + IHPT 
Sbjct  422  PKEKPKTAMKLVCAGNKEKVVGLHMIGMAADEILQGFGVAVKMGATKADFDNCIAIHPTA  481

Query  621  AEIFTTL  627
             E   TL
Sbjct  482  GEELVTL  488

>CCI11048
Length=496

 Score = 237 bits (604),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 161/465 (35%), Positives = 232/465 (50%), Gaps = 29/465 (6%)

Query  181  KEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGEILHKDADQ--  238
            + A+  G KVL+++  +        G GGTCVN GC+PKK+M+ ++   E + + +D   
Sbjct  22   RRAATYGAKVLLIERHREY---DGAGYGGTCVNYGCVPKKVMYNAAAHVEHIERASDYSI  78

Query  239  --------FGWSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYENMLGTFKDAH  290
                       S S   FDW ++ +    YI  LN  Y  +L + K+     +       
Sbjct  79   RPFTSKECASHSFSFGDFDWGRMKTKRDAYIERLNGIYTRNLANAKIDTVKGIAKLIAKD  138

Query  291  TLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDDIFSKPDAPGKTLVVG  350
             + +  D+  +G      +  +IAVGG P   S PG EHA+ SD  F     P K  VVG
Sbjct  139  RVQVNQDSVYEG------KHILIAVGGTPAMPSLPGIEHAIDSDGFFKLETQPKKVAVVG  192

Query  351  ASYVALECAGFLKGQGFDVTIMVR-SILLRGFDQDIARRIGEYMESESGIAFIKESVPTS  409
            A Y+A+E AG       D  +  R   +LR FD  +   + E ME + G+ F+++S    
Sbjct  193  AGYIAVEIAGVFNTLKSDTFVFCRFDQVLRKFDPLVRDLVNEEMEKD-GVNFVRKSHLEK  251

Query  410  IVKLENGQFQVTHTTGQDV-----YDTILNATGRSPDVQKLNLDAAGVALNPKSGRIHVV  464
            I K ++ +  +T   G++      +D I+ A GRSP    L L+  GVALN     I   
Sbjct  252  ITKAKDDKLAITARIGEENQTFSDFDQIVMAVGRSPRTVGLGLEEVGVALNETGHIIVDA  311

Query  465  NEQTSTPNIYALGDVIDAP-ELTPVAIQAGKLLSRRLFGN-GTTLMDYTKICTAVFTPVE  522
             E TS P +YALGDV     ELTPVAI AG+ L+ RLF N     + Y +I T VF+   
Sbjct  312  QENTSVPGVYALGDVTTTGWELTPVAIAAGRRLADRLFNNEKEACLHYHQIPTVVFSHPP  371

Query  523  YGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAKECYAKLIVDTTQQKRVLG  582
             G  G +E +AIA  G ENV+ Y   F  L +S++ D P  K+  A  +V    ++ V+G
Sbjct  372  LGTIGYTEPEAIAKYGEENVKCYSSKFVNLLYSMAED-PEKKKKTAMKLVCVGSKETVVG  430

Query  583  FHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIFTTL  627
             H  G  A E+ Q  G+A+K+ AT  DF N V IHPT +E   T+
Sbjct  431  LHVAGDGADEMVQGFGVAMKMGATKADFDNIVAIHPTASEELVTM  475

>PHYSO_550665
Length=491

 Score = 237 bits (604),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 173/484 (36%), Positives = 247/484 (51%), Gaps = 35/484 (7%)

Query  160  DVKYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPK  219
            DV YD+  VVIGGGSGG+A ++ A+  G KVLV++  +        GLGGTCVN GC+PK
Sbjct  4    DVVYDY--VVIGGGSGGMASARRAATYGAKVLVVERGREF---EGMGLGGTCVNFGCVPK  58

Query  220  KLMHQSSIIGEILHKDADQFGWSVSNAT-------FDWSKLVSSVQDYIHGLNFKYRVDL  272
            K+M  ++   E L ++ D   +S++ A        FDW+ + +    YI  LN  Y  +L
Sbjct  59   KVMFNAAAHVEHLARNKD---YSINTAAKDFEFGDFDWANMKTKRDAYIKRLNGIYERNL  115

Query  273  RDKKVKYENMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALS  332
             + +V +   +          +  D  +      T +  ++A GG P     PG EH + 
Sbjct  116  GNAQVDHVQGIAKL-------VAKDKVEVAGKVFTGKHVLVAPGGVPSVPDLPGMEHVID  168

Query  333  SDDIFSKPDAPGKTLVVGASYVALECAGFLKGQGFDVTIMVR-SILLRGFDQDIARRIGE  391
            SD  F     P K  VVGA Y+A+E AG       D T+  R   +LR FD  +   + E
Sbjct  169  SDGFFKLEQQPKKVAVVGAGYIAVEMAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNE  228

Query  392  YMESESGIAFIKESVPTSIVKLENGQFQVTHTTGQDV-----YDTILNATGRSPDVQKLN  446
             ME ++G+ F++      + K  +G+     T   +      +D IL A GR P  + L 
Sbjct  229  EME-KAGVKFVRNMRAARVEKQADGKLTFVVTINGEEHKFPDFDAILYAVGREPRTKDLG  287

Query  447  LDAAGVALNPKSGRIHV-VNEQTSTPNIYALGDV-IDAPELTPVAIQAGKLLSRRLFG-N  503
            L+  GV L+ + G I V   E TS P +YA+GD  I   ELTPVAI AG+ LS RLFG  
Sbjct  288  LEEVGVKLS-EGGFIEVDAQENTSVPGVYAIGDATITGWELTPVAIAAGRRLSDRLFGGE  346

Query  504  GTTLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLA  563
                ++Y +I T +F+    G  G +E +A+A  G ENV+ Y   F  L  S++   P  
Sbjct  347  KDACLNYHQIPTVIFSHPPIGTIGYTEPEAVAKYGEENVKCYTSKFVNLLHSMAD--PER  404

Query  564  KECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEI  623
            K   A  +V   +Q+ V+G H  G  A E+ Q  G+A+K+NAT  DF N V IHPT AE 
Sbjct  405  KGKTAMKLVTVGEQETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEE  464

Query  624  FTTL  627
              T+
Sbjct  465  LVTM  468

>PHYCA_504517
Length=493

 Score = 236 bits (601),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 173/484 (36%), Positives = 251/484 (52%), Gaps = 35/484 (7%)

Query  160  DVKYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPK  219
            DV YD+  +VIGGGSGG+A ++ A+  G KVLV++  +        GLGGTCVN GC+PK
Sbjct  4    DVVYDY--MVIGGGSGGMASARRAATYGAKVLVVERGREF---DGMGLGGTCVNFGCVPK  58

Query  220  KLMHQSSIIGEILHKDADQFGWSVSNAT-------FDWSKLVSSVQDYIHGLNFKYRVDL  272
            K+M  ++   E L+++ D   +S++ A        FDW+ +      YI  LN  Y  +L
Sbjct  59   KVMFNTAAHVEHLNRNKD---YSINTADKEFQFGDFDWNNMKIKRDAYIKRLNGIYERNL  115

Query  273  RDKKVKYENMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALS  332
             +  V +   +          +  D  + G    T +  ++A GG P     PG E+ + 
Sbjct  116  GNANVDHVQGIAKL-------VAKDKIQVGDKVYTGKHVLVAPGGVPSVPDLPGMENVID  168

Query  333  SDDIFSKPDAPGKTLVVGASYVALECAGFLKGQGFDVTIMVR-SILLRGFDQDIARRIGE  391
            SD  F     P K  VVGA Y+A+E AG       D T+  R   +LR FD  +   + E
Sbjct  169  SDGFFKLEQQPKKVAVVGAGYIAVEMAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNE  228

Query  392  YMESESGIAFIKESVPTSIVKLENGQFQ-VTHTTGQDV----YDTILNATGRSPDVQKLN  446
             ME ++G+ F++      + K +NG+   V    G++     +DTIL A GR P  + L 
Sbjct  229  EME-KAGVKFVRNMRAARVEKQDNGKLTFVVTINGEEQKFPDFDTILYAVGREPRTKDLG  287

Query  447  LDAAGVALNPKSGRIHV-VNEQTSTPNIYALGDV-IDAPELTPVAIQAGKLLSRRLFG-N  503
            L+  GV L+ + G I V   E TS P +YA+GD  +   ELTPVAI AG+ LS RLFG  
Sbjct  288  LEEVGVKLS-EGGFIEVDAQENTSVPGVYAIGDATVTGWELTPVAIAAGRRLSDRLFGGE  346

Query  504  GTTLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLA  563
                ++Y +I T +F+    G  G +E +A+   G ENV+VY   F  L  S++   P  
Sbjct  347  KDACLNYHQIPTVIFSHPPIGTIGYTEPEAVEKYGEENVKVYTSKFVNLLHSMAD--PER  404

Query  564  KECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEI  623
            K   A  +V   +++ V+G H  G  A E+ Q  G+A+K+NAT  DF N V IHPT AE 
Sbjct  405  KGKTAMKLVTVGEKETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEE  464

Query  624  FTTL  627
              T+
Sbjct  465  LVTM  468

>PHYKE_10327
Length=1200

 Score = 247 bits (631),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 171/493 (35%), Positives = 252/493 (51%), Gaps = 50/493 (10%)

Query  161  VKYDWDLVVIGGGSGGLACSKEASKL-GQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPK  219
            ++ ++D +VIG GSGG+A ++ A+   G +V V++  +         LGGTCVNVGC+PK
Sbjct  23   LQTEYDYLVIGAGSGGMASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPK  73

Query  220  KLMHQSSIIGEILHKDADQFGWS--------VSNATFDWSKLVSSVQDYIHGLNFKYRVD  271
            KLM  ++ +G  LH D   +G+           +A FDW+KL +    Y+  LN  Y  +
Sbjct  74   KLMFIAADLGHKLHHDLLHYGFEDAASGGHVSQHARFDWAKLKTRRDAYVLRLNGIYERN  133

Query  272  LRDKKVKYENMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAL  331
            L + KV+       F D   + +  D K     +V  +  +IAVGG+P     PG E  +
Sbjct  134  LANSKVELIRGSAAFNDNGNVVV--DGK-----EVRAKNVLIAVGGKPMIPDIPGKELCI  186

Query  332  SSDDIFSKPDAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSI-LLRGFD-------Q  383
             SD  F     P K  VVGA Y+A+E AG L   G D +I  R   +LR FD       +
Sbjct  187  DSDGFFELEMLPKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRTFDGIVRTTLE  246

Query  384  DIARRIGEYMESESGIAFIKESVP-TSIVKLENGQFQVTHTTGQDVYDTILNATGRSPDV  442
            D  ++ G +++  S IA + ++   T  + L +G       +    YD ++ A GR P  
Sbjct  247  DAMKKDGVHLQRHSNIARVNQAADGTKTLVLADG-------SEHSGYDVVIYAAGRVPLT  299

Query  443  QKLNLDAAGVALNPKSGRIHVVN-EQTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLF  501
              L LD AG+A + K+G I V   ++TS   + A+GDV   P LTPVAI AG+ LS RLF
Sbjct  300  STLKLDKAGIATD-KNGFIQVNKFQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLF  358

Query  502  GN-GTTLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHD-  559
            G  G   + Y  I T VF+    G  GL+EE A    G ++++VY   F  + + L ++ 
Sbjct  359  GGMGGAKVSYENIPTVVFSHPPIGTIGLTEEQARQKYGDDSIKVYTSRFVNMYYGLINEM  418

Query  560  -----RPLAKECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTV  614
                  P  K   A  +V   + ++V+G H +G  A E+ Q  G+A+K+ AT  DF N +
Sbjct  419  DETTGEPKDKPKTAMKLVCAGKDEKVVGLHMIGMAADEILQGFGVAVKMGATKADFDNCM  478

Query  615  GIHPTTAEIFTTL  627
             IHPT  E   TL
Sbjct  479  AIHPTAGEELVTL  491

>PYIW_25301
Length=512

 Score = 236 bits (601),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 169/483 (35%), Positives = 246/483 (51%), Gaps = 40/483 (8%)

Query  165  WDLVVIGGGSGGLACSKEASKL-GQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMH  223
            +D +VIG GSGG+A S+ A+     +V V++  +         LGGTCVNVGC+PKK+M+
Sbjct  40   YDYLVIGAGSGGMASSRRAALYPNTRVAVVEQAR---------LGGTCVNVGCVPKKIMY  90

Query  224  QSSIIGEILHKDADQFGWSVS-------NATFDWSKLVSSVQDYIHGLNFKYRVDLRDKK  276
             ++ +  +LH+DA  +G+          N  F W KL      YI  LN  Y  +L + K
Sbjct  91   LAANMNHMLHRDAFHYGFEGKDGVRIGDNVAFHWDKLKERRDAYILRLNDIYERNLGNSK  150

Query  277  VKYENMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDDI  336
            V        F +AH   +  D K     ++  +  +IAVGG+P     PG E  + SD  
Sbjct  151  VDLLTGTAVF-NAHG-NVEMDGK-----EIQAKNILIAVGGKPLIPDIPGKELCIDSDGF  203

Query  337  FSKPDAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSI-LLRGFDQDIARRIGEYMES  395
            F     P K  VVGA Y+A+E AG L G G + TI  R   +LR FD+ +   + + M +
Sbjct  204  FELEQLPKKVAVVGAGYIAVELAGVLHGLGSNTTIFCRKDGVLRTFDELVRDTLHDAM-A  262

Query  396  ESGIAFIKESVPTSIVKLENGQFQVTHTTGQD--VYDTILNATGRSPDVQKLNLDAAGVA  453
            + GI    +S    + +  +G+  +    G +   +DT++ A GR P   +LNL AAG+A
Sbjct  263  KDGIVVRPQSNVARVEQTADGKKTLFLQNGSEHAGFDTVIYAAGRVPLTSELNLSAAGIA  322

Query  454  LNPKSGRIHVVNEQ-TSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLFGN-GTTLMDYT  511
             + K G I V   Q TS  N++A+GDV     LTPVAI AG+ LS RLFG      + Y 
Sbjct  323  TD-KHGFIKVDEYQTTSKSNVFAVGDVCGTTALTPVAIAAGRRLSDRLFGGMADAKISYD  381

Query  512  KICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHD-------RPLAK  564
             I T VF+    G  GL+E +A    G   ++ Y   F  + + L +D       +P  K
Sbjct  382  NIPTVVFSHPPIGTIGLTEHEAREKHGDAQIKTYTSRFVNMYYGLVNDVDADGAAKP--K  439

Query  565  ECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIF  624
               A  +V   + ++V+G H +G  A E+ Q  G+A+K+ AT  DF N V IHPT  E  
Sbjct  440  PMTAMKLVCLGKDEKVVGLHVIGMAADEMLQGFGVAVKMGATKADFDNCVAIHPTAGEEL  499

Query  625  TTL  627
             T+
Sbjct  500  VTM  502

>H257_17037
Length=498

 Score = 235 bits (599),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 159/460 (35%), Positives = 235/460 (51%), Gaps = 25/460 (5%)

Query  180  SKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGEILHKDADQF  239
            +  A + G KVLV++  + +      G+GGTCVNVGC+PKK+M+ +    EILH   D  
Sbjct  23   ASRAVEYGAKVLVIERGRAN---GGAGMGGTCVNVGCVPKKIMYNAGFHAEILHSAKDYS  79

Query  240  GWSVSN---ATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYENMLGTFKDAHTLTLTN  296
               V N    +FDW+ + +    Y++ L   Y   L ++ + +     TF D HT+ + N
Sbjct  80   FKEVVNVKFGSFDWAAMKAKRDAYVNWLTGAYEEGLGEENIDHVIGAATFVDDHTVEV-N  138

Query  297  DAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDDIFSKPDAPGKTLVVGASYVAL  356
              +   P        +IAVGG P+  + PG EHA+SSD  F  P  P K  VVGA Y+A+
Sbjct  139  GLRFTAP------HILIAVGGVPQLPTIPGIEHAISSDGFFDLPTQPKKVAVVGAGYIAV  192

Query  357  ECAGFLKGQGFDVTIMVRS-ILLRGFDQDIARRIGEYMESESGIAFIKESVPTSIVKLEN  415
            E AG       D  +  R   +LR FD  +   + + M ++SG+ F+ +S   SI K  +
Sbjct  193  ELAGIFNALKSDTVVFCRGDQVLRKFDPLVRDLVNDEM-AKSGVTFVTQSHLQSIRKEAD  251

Query  416  GQFQVTHTTGQDV------YDTILNATGRSPDVQKLNLDAAGVALNPKSGRIHVVNEQTS  469
            G   +  T   D+      ++ I++A GR P    + LD   V L+     +    E T+
Sbjct  252  GTLTIVATV-NDIRAEFPGFNAIVSAIGRIPRTFDVGLDKTTVELSTDGFVVVDAQENTT  310

Query  470  TPNIYALGDV-IDAPELTPVAIQAGKLLSRRLFGN-GTTLMDYTKICTAVFTPVEYGCCG  527
             P +YA+GD  I   ELTPVAI AG+ L+ RLFG+     + Y +I T +F+    G  G
Sbjct  311  VPGVYAIGDATITGWELTPVAIAAGRRLADRLFGHEANACIHYHQIPTVIFSHPPIGTIG  370

Query  528  LSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAKECYAKLIVDTTQQKRVLGFHYLG  587
            L+E +AIA  G+ NV  Y  +F+ L +SL        +   KL+    ++  V+G H  G
Sbjct  371  LTEPEAIAKYGQANVTAYTSSFSNLFYSLGKPADHKPQTAMKLVCIGVEET-VVGAHVAG  429

Query  588  PNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIFTTL  627
              A E+ Q  G+AIK+ A   DF N V IHPT +E   T+
Sbjct  430  LGADEMIQGFGVAIKMGAYKSDFDNIVAIHPTASEEMVTM  469

>HYAP_08763
Length=473

 Score = 233 bits (595),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 160/465 (34%), Positives = 238/465 (51%), Gaps = 31/465 (7%)

Query  177  LACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGEILHKDA  236
            +A ++ A+  G KVLV++  +        GLGGTCVN GC+PKK+M  ++   E L++  
Sbjct  1    MASARRAATYGAKVLVIERGRQY---DGMGLGGTCVNFGCVPKKIMFNTAAHVEHLNRAK  57

Query  237  DQFGWSVSNATF-----DWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYENMLGTFKDAHT  291
            D   +S+  A F     DWSK+ +    YI+ L   Y+ +L + +V +   +  F   + 
Sbjct  58   D---YSIHTAEFAFGDFDWSKMKTKRDAYINRLTGIYQRNLGNARVDHVEGIAKFVAKNK  114

Query  292  LTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDDIFSKPDAPGKTLVVGA  351
            + + +          T +  +IA GG P     PG  H + SDD F     P K  VVGA
Sbjct  115  VQVADRV-------FTGKHVLIAPGGVPLKPDLPGINHVIDSDDFFRLEQQPQKVAVVGA  167

Query  352  SYVALECAGFLKGQGFDVTIMVR-SILLRGFDQDIARRIGEYMESESGIAFIKESVPTSI  410
             Y+A+E AG       D T+  R   +LR F+  +   + E ME ++G+ F++      +
Sbjct  168  GYIAVEMAGIFHALKSDTTLFCRHDQVLRRFEPIVRDLVNEEME-KAGVTFVRNMSAVGV  226

Query  411  VKLENGQFQV---THTTGQDV--YDTILNATGRSPDVQKLNLDAAGVALNPKSGRIHV-V  464
             K  +G+  +    H   Q    +DTIL A GR P  + L L+  GV L  + G I V  
Sbjct  227  EKQLDGKLTLVVNVHNEEQKFTDFDTILFAVGRKPRTEDLGLEDIGVKL-AEGGFIQVDA  285

Query  465  NEQTSTPNIYALGDV-IDAPELTPVAIQAGKLLSRRLF-GNGTTLMDYTKICTAVFTPVE  522
             E TS P +YA+GD  +   ELTPVAI AG+ L+ RLF G     ++Y +I + +F+   
Sbjct  286  QENTSVPGVYAIGDATVTGWELTPVAIAAGRRLADRLFGGEKDACLNYHQIPSVIFSHPP  345

Query  523  YGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAKECYAKLIVDTTQQKRVLG  582
             G  G +E +A+A  G ENV+VY   F  L  S++   P  K   A  +V   +Q+ V+G
Sbjct  346  IGTIGYTEPEAVAKYGEENVKVYTSKFVNLLHSMAD--PEHKGKTAMKLVTVGEQETVVG  403

Query  583  FHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIFTTL  627
             H  G  A E+ Q  G+A+K+NAT  DF N V IHPT +E   T+
Sbjct  404  VHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTASEELVTM  448

>CCA23647
Length=496

 Score = 233 bits (593),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 161/465 (35%), Positives = 228/465 (49%), Gaps = 29/465 (6%)

Query  181  KEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGEILHKDAD---  237
            + A+  G KVL+++  +        G GGTCVN GC+PKK+M+ ++   E + +  D   
Sbjct  22   RRAATYGAKVLLIERHREY---EGAGYGGTCVNYGCVPKKVMYNAAAHVEHIERAPDYSI  78

Query  238  -------QFGWSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYENMLGTFKDAH  290
                       S S   FDW ++      YI  LN  Y  +L + K+     +       
Sbjct  79   RPFASKGDTSHSFSFGDFDWGRMKVKRDAYIERLNGIYTRNLANAKIDTVTGIAKLIAKD  138

Query  291  TLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDDIFSKPDAPGKTLVVG  350
             + +  D+  +G      +  +IAVGG P   S PG EHA+ SD  F     P K  VVG
Sbjct  139  RVQVNQDSFFEG------KHILIAVGGTPAMPSIPGIEHAIDSDGFFKLETQPKKVAVVG  192

Query  351  ASYVALECAGFLKGQGFDVTIMVR-SILLRGFDQDIARRIGEYMESESGIAFIKESVPTS  409
            A Y+A+E AG       D  +  R   +LR FD  +   + E ME ++G+ F+++S    
Sbjct  193  AGYIAVEIAGVFNTLKSDTFLFCRFDQVLRKFDPLVRDLVNEEME-KNGVNFVRKSHLEK  251

Query  410  IVKLENGQFQVTHTTGQDV-----YDTILNATGRSPDVQKLNLDAAGVALNPKSGRIHVV  464
            IVK E+ +  +T   G        +D I+ A GRSP    L L+  GV LN     I   
Sbjct  252  IVKSEDDKLAITARIGDQSQTFSNFDQIVMAVGRSPRTVDLGLEDVGVELNETGHIIVDA  311

Query  465  NEQTSTPNIYALGDVIDAP-ELTPVAIQAGKLLSRRLFGN-GTTLMDYTKICTAVFTPVE  522
             E TS P +YALGDV     ELTPVAI AG+ L+ RLF N     + Y +I T VF+   
Sbjct  312  QENTSIPGVYALGDVTTTGWELTPVAIAAGRRLADRLFNNEKEACLYYHQIPTVVFSHPP  371

Query  523  YGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAKECYAKLIVDTTQQKRVLG  582
             G  G +E +AIA  G ENV+ Y   F  L +S++ D    K+   KL+     ++ V+G
Sbjct  372  LGTIGYTEPEAIAKYGEENVKCYSSKFVNLLYSMAEDPEKKKKTCMKLVC-VGSKETVVG  430

Query  583  FHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIFTTL  627
             H  G  A E+ Q  G+A+K+ AT  DF N V IHPT +E   T+
Sbjct  431  LHVAGDGADEMVQGFGVAMKMGATKADFDNIVAIHPTASEELVTM  475

>PHALS_09136
Length=493

 Score = 231 bits (589),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 168/479 (35%), Positives = 251/479 (52%), Gaps = 33/479 (7%)

Query  165  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  224
            +D +VIGGGSGG+A ++ A+  G KVLV++  +        GLGGTCVN GC+PKK+M  
Sbjct  7    YDFMVIGGGSGGMASARRAATCGAKVLVVERGREF---DGMGLGGTCVNFGCVPKKVMFN  63

Query  225  SSIIGEILHKDADQFGWSVSNAT-------FDWSKLVSSVQDYIHGLNFKYRVDLRDKKV  277
            +++  E L+++ D   +S++          FDW+ + +    YI  LN  Y  +L + +V
Sbjct  64   TAVHVEHLNRNKD---YSINTCAKDFEFGDFDWANMKTKRDAYIQRLNGIYERNLSNAQV  120

Query  278  KYENMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDDIF  337
              + + G  K      +  D  +      T +  ++A GG P     PG EH + SD  F
Sbjct  121  --DVIQGIAK-----IVAKDKIQVAGHIYTGKHVLVAPGGVPNIPDIPGKEHVIDSDGFF  173

Query  338  SKPDAPGKTLVVGASYVALECAGFLKGQGFDVTIMVR-SILLRGFDQDIARRIGEYMESE  396
                 P K  VVGA Y+A+E AG       D T+  R   +LR FD  +   + E ME +
Sbjct  174  KLEQQPKKVAVVGAGYIAVELAGIFNMLKSDTTLFCRHDQVLRKFDPIVRDLVNEEME-K  232

Query  397  SGIAFIKESVPTSIVKLENGQFQ-VTHTTGQDV----YDTILNATGRSPDVQKLNLDAAG  451
            +G+ F++    T I K  + +   V    G++     +DTIL A GR P  + L L+  G
Sbjct  233  AGVEFVRNMSATRIEKSNDDKLTFVVTMNGEEQEFTNFDTILFAVGRVPRTKDLGLEEIG  292

Query  452  VALNPKSGRIHV-VNEQTSTPNIYALGDV-IDAPELTPVAIQAGKLLSRRLFG-NGTTLM  508
            V L    G I V   E T+ P +YA+GDV +   ELTPVAI AG+ L+ RLFG      +
Sbjct  293  VKL-ADGGYIEVDAQENTTVPGVYAIGDVTVTGWELTPVAIAAGRRLADRLFGGEKDACL  351

Query  509  DYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAKECYA  568
            +Y +I T +F+    G  G +E +AIA  G+EN+++Y   F  L  +++   P  K   A
Sbjct  352  NYHQIPTVIFSHPPIGTIGYTEPEAIARFGKENIKIYTSKFVNLLHAMAD--PERKGKTA  409

Query  569  KLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIFTTL  627
              +V   +++ V+G H  G  A E+ Q  G+A+K+NAT  DF N V IHPT +E   T+
Sbjct  410  MKLVTVGEEETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTASEELVTM  468

>PPTG_18033
Length=500

 Score = 231 bits (589),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 171/485 (35%), Positives = 241/485 (50%), Gaps = 40/485 (8%)

Query  164  DWDLVVIGGGSGGLACSKEASKL-GQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLM  222
            ++D +VIG GSGG+A ++ A+   G +V V++  +         LGGTCVNVGC+PKKLM
Sbjct  26   EYDYLVIGAGSGGMASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLM  76

Query  223  HQSSIIGEILHKDADQFGWSVSNAT---------FDWSKLVSSVQDYIHGLNFKYRVDLR  273
              ++ +   L  D   +G+    AT         FDW KL +    Y+  LN  Y  +L 
Sbjct  77   FIAADMSHKLDHDFLHYGFE-DEATGEHLGKRTHFDWMKLKARRDAYVLRLNGIYERNLA  135

Query  274  DKKVKYENMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALSS  333
            + KV  E + G+ K      +  D K     ++  +  +IAVGG+P     PG E  + S
Sbjct  136  NSKV--ELIRGSAKFNENGNVEVDGK-----ELLAKNVLIAVGGKPLIPDIPGKELCIDS  188

Query  334  DDIFSKPDAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSI-LLRGFDQDIARRIGEY  392
            D  F     P K  VVGA Y+A+E AG L   G D +I  R   +LR FD DI R   E 
Sbjct  189  DGFFELEILPKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRSFD-DIVRTTLED  247

Query  393  MESESGIAFIKESVPTSIVKLENGQFQVTHTTGQDV--YDTILNATGRSPDVQKLNLDAA  450
               + G+     S    + +  +G   V  T G +   YD ++ A GR P    L LD A
Sbjct  248  AMVKDGVHLRPHSNVARVEQAADGTKTVVLTDGSEYNGYDVVMYAAGRVPLTSNLQLDKA  307

Query  451  GVALNPKSGRIHVVN-EQTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLFGN-GTTLM  508
            GV  + + G I V   ++TS   + A+GDV   P LTPVAI AG+ LS RLFG    + +
Sbjct  308  GVTTD-EHGFIPVNEFQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLFGGLNNSKV  366

Query  509  DYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSL------SHDRPL  562
             Y  I T VF+    G  GL+E+ A    G + V+VY   F  + + L      S   P 
Sbjct  367  SYENIPTVVFSHPPIGTIGLTEDQARRKYGDDAVKVYTSRFVNMYYGLINEVDESTGEPK  426

Query  563  AKECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAE  622
             K   A  +V   ++++V+G H +G  A E+ Q  G+A+K+ AT  DF N + IHPT  E
Sbjct  427  DKPKTAMKLVCVGKEEKVVGLHMIGMAADEILQGFGVAVKMGATKADFDNCIAIHPTAGE  486

Query  623  IFTTL  627
               TL
Sbjct  487  ELVTL  491

>PHYRA_71927
Length=485

 Score = 229 bits (584),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 169/496 (34%), Positives = 246/496 (50%), Gaps = 40/496 (8%)

Query  162  KYDWDLVVIGGGSGGLACSKEASKL-GQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKK  220
            + ++D +VIG GSGG+A ++ A+   G +V V++  +         LGGTCVNVGC+PKK
Sbjct  9    RTEYDYLVIGAGSGGMASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKK  59

Query  221  LMHQSSIIGEILHKDADQFGWSVSNAT---------FDWSKLVSSVQDYIHGLNFKYRVD  271
            LM  ++ +   L  D   +G+    AT         FDW KL +    Y+  LN  Y  +
Sbjct  60   LMFIAADMSHKLRHDFLHYGFE-DEATGGHLGQRTHFDWPKLKARRDAYVLRLNGIYERN  118

Query  272  LRDKKVKYENMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAL  331
            L + KV+  +    F +   + +  D K     ++  +  ++AVGG+P     PG E  +
Sbjct  119  LANSKVELIHGSAKFNEKGNVEV--DGK-----ELLAKNVLVAVGGKPLIPDIPGKELCI  171

Query  332  SSDDIFSKPDAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSI-LLRGFDQDIARRIG  390
             SD  F     P K  VVGA Y+A+E AG L   G D +I  R   +LR FD  I R   
Sbjct  172  DSDGFFELEMLPKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRTFD-GIVRTTL  230

Query  391  EYMESESGIAFIKESVPTSIVKLENGQFQVTHTTGQD--VYDTILNATGRSPDVQKLNLD  448
            E   ++ G+     S  T + ++ +G   +    G +   YD ++ A GR P    L LD
Sbjct  231  EDAMAKDGVHLRPHSNVTRVEQVADGTKTLVLADGSEHSGYDVVIYAAGRVPLTSNLQLD  290

Query  449  AAGVALNPKSGRIHVVN-EQTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLFGN-GTT  506
             A +A + K G I V   ++TS   + A+GDV   P LTPVAI AG+ LS RLFG     
Sbjct  291  NADIATD-KHGFIQVNEFQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLFGGMKDA  349

Query  507  LMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHD------R  560
             + Y  I T VF+    G  GL+EE A    G +N +VY   F  + + L ++       
Sbjct  350  KVSYENIPTVVFSHPPIGTIGLTEEQARRQYGDDNTKVYASRFVNMYYGLINEVDEATGE  409

Query  561  PLAKECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTT  620
            P  K   A  +V   ++++V+G H +G  A E+ Q  G+A+K+ AT  DF N + IHPT 
Sbjct  410  PKDKPKTAMKLVCVGKEEKVVGLHMIGMAADEILQGFGVAVKMGATKADFDNCIAIHPTA  469

Query  621  AEIFTTLEITKESGVD  636
             E   TL     SG D
Sbjct  470  GEELVTLAPWGLSGRD  485

>PYAP_23435
Length=951

 Score = 234 bits (598),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 175/479 (37%), Positives = 247/479 (52%), Gaps = 33/479 (7%)

Query  165  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  224
            +D VVIGGGSGG+A ++ A+  G KVL+++  +        GLGGTCVN GC+PKK+M  
Sbjct  471  YDYVVIGGGSGGMASARRAATYGAKVLLVERGRAH---DGMGLGGTCVNYGCVPKKVMFN  527

Query  225  SSIIGEILHKDADQFGWSVSNAT-------FDWSKLVSSVQDYIHGLNFKYRVDLRDKKV  277
            ++   E L ++ D   +S++ A        FDW+ + +    YI  LN  Y  ++ +  +
Sbjct  528  AAAHVEHLARNGD---YSINTAPKAFEFGDFDWANMKTKRDAYILRLNGIYERNVGNAGI  584

Query  278  KYENMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDDIF  337
                     +   TL  +N  +  G    T +  ++AVGG P   + PG EHA+ SD  F
Sbjct  585  DL------VQGVATLVSSNQIEVDGKV-FTGKHVLVAVGGVPAMPAIPGIEHAIDSDGFF  637

Query  338  SKPDAPGKTLVVGASYVALECAGFLKGQGFDVTIMVR-SILLRGFDQDIARRIGEYMESE  396
                 P K  VVGA Y+A+E AG       +  +  R   +LR FD  +   + E ME +
Sbjct  638  KLESQPKKVAVVGAGYIAVEIAGIFNTLKSETFLFCRYDQVLRAFDPYVRDLVNEEME-K  696

Query  397  SGIAFIKESVPTSIVKLENGQFQV-THTTGQDV----YDTILNATGRSPDVQKLNLDAAG  451
             G+ F++ S    I K  +G+  +     GQD     +D +L A GR P  + L LD AG
Sbjct  697  HGVNFVRRSRIEKIEKQADGKLTIHAKVDGQDQTLEGFDEVLFAIGREPRTRGLGLDKAG  756

Query  452  VALNPKSGRIHV-VNEQTSTPNIYALGDVIDAP-ELTPVAIQAGKLLSRRLFGNGT-TLM  508
            V LN   G I V   E TS P +YA+GD      ELTPVAI AG+ L+ RLFGN     +
Sbjct  757  VKLN-DGGFIEVDAQENTSVPGVYAIGDATTTGWELTPVAIAAGRRLADRLFGNEPDACL  815

Query  509  DYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAKECYA  568
             Y +I T VF+    G  G +E +A+A  G + V+VY   F  L  S++   P  K   A
Sbjct  816  HYHQIPTVVFSHPPLGTIGYTEPEAVAKFGADKVKVYTSKFVNLLHSMAD--PENKGKTA  873

Query  569  KLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIFTTL  627
              +V     + V+G H  G  A E+ Q  G+A+K+NAT  DF N V IHPT AE F T+
Sbjct  874  MKLVCVGDDEVVVGLHVAGEGADEMVQGFGVAMKMNATKADFDNIVAIHPTAAEEFVTM  932

>H257_09722
Length=518

 Score = 221 bits (562),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 165/482 (34%), Positives = 246/482 (51%), Gaps = 35/482 (7%)

Query  165  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  224
            +D +V+GGGSGG++ ++ A+  G  VLV++  +        GLGGTCVNVGC+PKK+M+ 
Sbjct  28   YDYIVLGGGSGGISSARRAASYGANVLVIERGREQ---GGAGLGGTCVNVGCVPKKVMYN  84

Query  225  SSIIGEILHKDADQFGWS----VSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYE  280
            ++   EILH  A  + +     V   +FDW+ + +    Y+  L+  Y  +L    +   
Sbjct  85   AAFHAEILH-SAKAYAFKGVQDVGFGSFDWATMKTKRDSYVARLHGIYERNLAKDNITLV  143

Query  281  NMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDDIFSKP  340
            +   +F D HT+ + + A    P        ++AVGG P+  S PG EHA+SSD  F   
Sbjct  144  SGRASFVDNHTIAV-DGATFTAP------HILVAVGGVPQLPSIPGIEHAISSDGFFGLE  196

Query  341  DAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSI-LLRGFDQDIARRIGEYMESESGI  399
              P K  V+GA Y+A+E AG       +  +  R   +LR FD  +   + + M   SG+
Sbjct  197  TQPKKVAVIGAGYIAVELAGIFNALQSETVVFCRGRQVLRTFDPLVRDLVNDEMR-RSGV  255

Query  400  AFIKESVPTSIVKLENGQFQVT--------HTTGQDV---YDTILNATGRSPDVQKLNLD  448
             F+  S   SI K  +G   +         H+T       +D I+ A GR+P      ++
Sbjct  256  QFVPHSGVQSIRKEPDGTLTIEATLTTEDGHSTTHHAFRGFDAIVMAVGRTPRTSGF-ME  314

Query  449  AAGVALNPKSGRIHV-VNEQTSTPNIYALGDVIDAP-ELTPVAIQAGKLLSRRLFGNGT-  505
               +  N K G I V   E TS P +YA+GDV +   ELTPVAI AG+ L+ RLFG    
Sbjct  315  HTTIIRNEK-GFIEVDGQENTSVPGVYAIGDVTNTGWELTPVAIAAGRRLADRLFGGEPD  373

Query  506  TLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAKE  565
              + Y +I T VF+    G  G +E DA+A  G  NV+VY  +F  L +S+    P  K 
Sbjct  374  ACLHYHQIPTVVFSHPPIGTVGYTEPDAVAKFGPSNVKVYTSSFVNLFYSML--APENKP  431

Query  566  CYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIFT  625
              A  ++   +++ V+G H  G  A E+ Q  G+A+K+ A   D  N V IHPT +E F 
Sbjct  432  KTAMKLICVGKEETVVGMHVAGMGADEMIQGFGVAVKMGAYKSDLDNIVAIHPTASEEFV  491

Query  626  TL  627
            T+
Sbjct  492  TM  493

>H310_11259
Length=519

 Score = 220 bits (560),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 166/481 (35%), Positives = 248/481 (52%), Gaps = 33/481 (7%)

Query  165  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  224
            +D +V+GGGSGG+A ++ A+  G KVLV++  +        GLGGTCVNVGC+PKK+M+ 
Sbjct  29   YDYIVLGGGSGGIASARRAASYGAKVLVVERGRTL---GGAGLGGTCVNVGCVPKKVMYN  85

Query  225  SSIIGEILHKDADQFGW----SVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYE  280
            ++ + EI+H  A  + +     V   +FDW  + S    Y+  L+  Y  +L    +   
Sbjct  86   AAFLAEIMHS-AKTYTFKGVQGVEFGSFDWPAMKSKRDAYVTRLHGIYERNLAKDGISLV  144

Query  281  NMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDDIFSKP  340
            + +  F D HT+ + + AK   P        ++AVGG P+  S PG E A+SSD  F+  
Sbjct  145  SGVAAFVDNHTIAV-DGAKFTAP------HILVAVGGTPQLPSIPGIELAISSDGFFALE  197

Query  341  DAPGKTLVVGASYVALECAGFLKGQGFDVTIMVR-SILLRGFDQDIARRIGEYMESESGI  399
              P K  VVGA Y+A+E AG       D T+  R   +LR FD  +   + + M   +G+
Sbjct  198  TQPRKVAVVGAGYIAVELAGIFNALQTDTTLFCRHDQVLRKFDPLVRDHVNKEMR-RAGV  256

Query  400  AFIKESVPTSIVKLENGQFQVTHTTGQDV----------YDTILNATGRSPDVQKLNLDA  449
            AF+ +S   SI K  NG   +  T  Q+           YD ++ A GR+P       D 
Sbjct  257  AFVTQSGVDSIHKEANGTLTIQATIKQENGSATTQEFSGYDAVVVAIGRTPRTTDCGFDR  316

Query  450  AGVALNPKSGRIHV-VNEQTSTPNIYALGDVIDAP-ELTPVAIQAGKLLSRRLFGNGT-T  506
              +  + + G I V   E T+ P +YA+GD      ELTPVAI AG+ L+ RLFG     
Sbjct  317  TDIVFD-RKGFIQVDGQENTTVPGVYAIGDATATGWELTPVAIAAGRRLADRLFGGEPDA  375

Query  507  LMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAKEC  566
             ++Y +I T VF+    G  G +E DAIA  G  NV+VY  +F  L ++L   + +    
Sbjct  376  CINYHQIPTVVFSHPPIGTIGYTEPDAIAKYGPANVKVYTSSFVNLFYTLLPPKDMPST-  434

Query  567  YAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIFTT  626
             A  +V   +++ V+G H  G  A E+ Q  G+A+K+ A   D  N + IHPT +E   T
Sbjct  435  -AMKVVCVGKEETVVGMHVAGMGADEMIQGFGVAVKMGAYKSDLDNVIAIHPTASEELVT  493

Query  627  L  627
            +
Sbjct  494  M  494

>PHYKE_6836
Length=493

 Score = 218 bits (555),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 175/487 (36%), Positives = 254/487 (52%), Gaps = 41/487 (8%)

Query  160  DVKYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPK  219
            DV YD+  VVIGGGSGG+A ++ A+  G KVLV++  +        GLGGTCVN GC+PK
Sbjct  4    DVVYDY--VVIGGGSGGMASARRAATYGAKVLVVERGRKY---DGMGLGGTCVNYGCVPK  58

Query  220  KLMHQSSIIGEILHKDADQFGWSVSNAT-------FDWSKLVSSVQDYIHGLNFKYRVDL  272
            K+M  +++  E L ++ D   +S++ A        FDWS + +    YI  LN  Y  +L
Sbjct  59   KVMFNTAMHVEHLARNRD---YSINTAQRDFQFGDFDWSNMKTKRDAYILRLNGIYERNL  115

Query  273  RDKKVKYENMLGTFKDAHTLTLTNDAKKKGPTD---VTFRRAVIAVGGRPKPLSCPGWEH  329
            ++++V +   +              AK K   D    T +  ++A GG P     PG EH
Sbjct  116  QNQQVDHVQGIAKIV----------AKDKIQVDGQVFTGKNLLVAPGGVPTIPDFPGNEH  165

Query  330  ALSSDDIFSKPDAPGKTLVVGASYVALECAGFLKGQGFDVTIMVR-SILLRGFDQDIARR  388
             + SD  F     P K  VVGA Y+A+E AG       D T+  R   +LR FD  +   
Sbjct  166  VIDSDGFFKLEQQPKKVAVVGAGYIAVEMAGIFNTLKSDTTLFCRFDQVLRKFDPIVRDL  225

Query  389  IGEYMESESGIAFIKESVPTSIVKLENGQFQ-VTHTTGQDV----YDTILNATGRSPDVQ  443
            + E ME ++G+ F++ S    + K  +G+   V    G++     +DTIL A GR+P  +
Sbjct  226  VNEEME-KAGVKFVRNSRAVRVEKQTDGKLTFVVTVDGKEEKFPDFDTILYAVGRTPRTK  284

Query  444  KLNLDAAGVALNPKSGRIHV-VNEQTSTPNIYALGDVIDAP-ELTPVAIQAGKLLSRRLF  501
             L L+   V L+ + G I V   E TS   +YA+GD      ELTPVAI AG+ LS RLF
Sbjct  285  DLGLEEINVKLS-QDGFIEVDAQENTSVEGVYAIGDATTTGWELTPVAIAAGRRLSDRLF  343

Query  502  G-NGTTLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDR  560
            G      ++Y +I T +F+    G CG +E +A+   G+EN++ Y   F  L  S++   
Sbjct  344  GGEKDACLNYHQIPTVIFSHPPIGTCGYTEPEAVEKFGQENIKTYSSKFVNLLHSMAD--  401

Query  561  PLAKECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTT  620
            P  K   A  +V   +++ V+G H  G  A E+ Q  G+A+K+NAT  DF N V IHPT 
Sbjct  402  PERKGKTAMKLVCVGEEEVVVGVHVAGEGADEMIQGFGVAMKMNATKADFDNIVAIHPTA  461

Query  621  AEIFTTL  627
            AE   T+
Sbjct  462  AEELVTM  468

>PITG_13427
Length=463

 Score = 214 bits (545),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 160/471 (34%), Positives = 227/471 (48%), Gaps = 40/471 (8%)

Query  178  ACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGEILHKDAD  237
            +  + AS  G +V V++  +         LGGTCVNVGC+PKKLM  ++ +   L  D  
Sbjct  3    SARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLMFIAADMSHKLRHDLL  53

Query  238  QFGWSVSNAT---------FDWSKLVSSVQDYIHGLNFKY-RVDLRDKKVKYENMLGTFK  287
             +G+    AT         FDW KL +    Y+  LN  Y R +L + KV+    L TF 
Sbjct  54   HYGFE-DEATGGHLGKRTHFDWPKLKAGRDAYVLRLNGIYERRNLANSKVELIRGLATFN  112

Query  288  DAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDDIFSKPDAPGKTL  347
            +   + +       G  ++  +  +IAVGG+P     PG E  + SD  F     P K  
Sbjct  113  EKGNVEV-------GGKELLAKNVLIAVGGKPLIPDLPGKELCIDSDGFFELETLPKKVA  165

Query  348  VVGASYVALECAGFLKGQGFDVTIMVRSI-LLRGFDQDIARRIGEYMESESGIAFIKESV  406
            VVGA Y+A+E AG L   G D ++  R   +LR FD DI R   E   ++ G+     S 
Sbjct  166  VVGAGYIAVELAGVLNALGSDTSLFCRKEGVLRAFD-DIVRTTLEDAMAKEGVHLRPHSN  224

Query  407  PTSIVKLENGQFQVTHTTGQDV--YDTILNATGRSPDVQKLNLDAAGVALNPKSGRIHVV  464
               +    +G   +  T G     YD ++ A GR P    L LD AG+  + + G I V 
Sbjct  225  VARVELGADGTKTLVLTDGSKYSGYDVVIYAAGRVPLTSNLQLDKAGITTD-EHGFIPVN  283

Query  465  N-EQTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLFGN-GTTLMDYTKICTAVFTPVE  522
              ++TS   + A+GDV   P LTPVAI AG+ LS RLFG      + Y  I T VF+   
Sbjct  284  ELQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLFGGMNDAKVSYENIPTVVFSHPP  343

Query  523  YGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSL------SHDRPLAKECYAKLIVDTTQ  576
             G  GL+EE A    G + ++VY   F  + + L      S   P  K   A  +V   +
Sbjct  344  IGTIGLTEEQARRKYGDDAIKVYTSRFVNMYYGLINEVDESTGEPKDKPKTAMKLVCAGK  403

Query  577  QKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIFTTL  627
            +++V+G H +G  A E+ Q  G+A+K+ AT  DF N + IHPT  E   TL
Sbjct  404  EEKVVGLHMIGMAADEILQGFGVAVKMGATKADFDNCIAIHPTAGEELVTL  454

>PHYCA_7619
Length=462

 Score = 207 bits (526),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 153/472 (32%), Positives = 224/472 (47%), Gaps = 43/472 (9%)

Query  178  ACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGEILHKDAD  237
            +  + AS  G +V V++  +         LGGTCVNVGC+PKKLM  ++ +   LH D  
Sbjct  3    SARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLMFIAADMSHKLHHDFL  53

Query  238  QFGWS--------VSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYENMLGTFKDA  289
             +G+              FDW KL +    Y+  LN  Y  +L + KV    + G+ K  
Sbjct  54   HYGFEDEVTGGHLGKRTHFDWPKLKARRDAYVLRLNGIYERNLENSKVDL--IRGSAKFN  111

Query  290  HTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDDIFSKPDAPGKTLVV  349
                +  D K     ++     +IAVGG+P     PG E  + SD  F     P K  VV
Sbjct  112  QNGNVEVDGK-----EILADNVMIAVGGKPLIPDIPGKELCIDSDGFFELETLPKKVAVV  166

Query  350  GASYVALECAGFLKGQGFDVTIMVRSI-LLRGFDQDIARRIGEYMESESGIAFIKESVPT  408
            GA Y+A+E AG L   G + +I  R   +LR FD  +   + + ME + G+     S   
Sbjct  167  GAGYIAVELAGVLNALGSETSIFCRKEGVLRTFDDIVPTTLEDAMEKD-GVHLCPHS---  222

Query  409  SIVKLENGQ-----FQVTHTTGQDVYDTILNATGRSPDVQKLNLDAAGVALNPKSGRIHV  463
            ++V++E          +   +    Y+ ++ A GR P    L LD AGV  +   G I V
Sbjct  223  NVVRVEQAADNTRTLVLADGSEHSGYEVVIYAAGRVPLTTSLQLDKAGVTTD-NHGFIQV  281

Query  464  VN-EQTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLFGN-GTTLMDYTKICTAVFTPV  521
               +QTS  N++A+GD    P LTPVAI AG+ LS RLFG      + Y  I T VF+  
Sbjct  282  DEYQQTSNSNVFAVGDACGTPALTPVAIAAGRRLSDRLFGGMKDAKISYENIPTVVFSHP  341

Query  522  EYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHD------RPLAKECYAKLIVDTT  575
              G  GL+E  A    G + ++VY   F  + + L ++       P  K   A  +V   
Sbjct  342  PIGTIGLTEAQARCKYGDDEIKVYTSRFVNMYYGLINEIDEETGEPKDKPKTAMKLVCAG  401

Query  576  QQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIFTTL  627
            + ++V+G H +G  A E+ Q  G+A+K+ AT  DF + + IHPT  E   TL
Sbjct  402  KDEKVVGLHMIGMAADEILQGFGVAVKMGATKADFDDCIAIHPTAGEELVTL  453

>PYVX_21517
Length=482

 Score = 197 bits (501),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 151/503 (30%), Positives = 234/503 (47%), Gaps = 78/503 (16%)

Query  164  DWDLVVIGGGSGGLACSKEASKL-GQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLM  222
            ++DL+VIG GSGG+A S+ A+     +V V++  +         LGGTCVNVGC+PKK+M
Sbjct  27   EFDLLVIGAGSGGMAASRRAASYPNTRVAVVERAR---------LGGTCVNVGCVPKKIM  77

Query  223  HQSSIIGEILHKDADQFGWS---------VSNATFDWSKLVSSVQDYIHGLNFKYRVDLR  273
            +  + +   LH+DA  +G+           +   FDW KL      Y+  LN  Y  +L 
Sbjct  78   YTGASLSHALHRDAFHYGFEDAASPGKSIGARVAFDWQKLKQRRDAYVLRLNGIYERNLA  137

Query  274  DKKVKYENMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPK----PLSCPGWEH  329
            + KV  E + GT +      +    +  G  +V  ++ ++AVGG+P     P++  G E 
Sbjct  138  NSKV--ELLTGTAR----FNVDGKIEVDG-VEVRAKKVLLAVGGKPLIPDIPVAATGKEL  190

Query  330  ALSSDDIFSKPDAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSI-LLRGFD------  382
             + SD  F     P K  VVGA Y+A+E AG L   G D TI  R   +LR FD      
Sbjct  191  CIDSDGFFELEQLPRKVAVVGAGYIAVELAGVLNALGADTTIFTRRDGVLRSFDWWNSQF  250

Query  383  ------QDIARRIGEYMESESGIAFIKESVPTSIVKLENGQFQVTHTTG--QDVYDTILN  434
                  Q+I R   +   ++ G+     S    +    +G   +    G     +++++ 
Sbjct  251  LAGDSEQEIVRSTLQDTMAQDGVTLRPHSNIERVELAADGTKTLVLADGSTHTGFESVIY  310

Query  435  ATGRSPDVQKLNLDAAGVALNPKSGRIHVVN-EQTSTPNIYALGDVIDAPELTPVAIQAG  493
            A GR P    L LD AGVA + + G I V   +QT+ P+I A+GD      LTP++    
Sbjct  311  AAGRVPLTGDLGLDNAGVATDER-GHIRVDEYQQTTAPDILAVGDACGTIALTPIS----  365

Query  494  KLLSRRLFGNGTTLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLE  553
                            Y  + T VF+    G  GL+E+ A A  G E +++Y   F  + 
Sbjct  366  ----------------YENVPTVVFSHPPIGTVGLTEKQARAKFGDEQIKIYKSTFVNMY  409

Query  554  WSLSHDRPLAKECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINT  613
            + + ++           +V     ++++G H +G  A E+ Q  G+A+K+ AT  D  + 
Sbjct  410  YGVVNE-----------LVCAGPDEKIVGLHVIGMGADEMLQGFGVAVKMGATKADLDSC  458

Query  614  VGIHPTTAEIFTTLEITKESGVD  636
            V IHPT AE   T+     SG D
Sbjct  459  VAIHPTGAEELVTMAPWGLSGAD  481

>HYAP_04843
Length=430

 Score = 191 bits (484),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 138/392 (35%), Positives = 199/392 (51%), Gaps = 22/392 (6%)

Query  248  FDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYENMLGTFKDAHTLTLTNDAKKKGPTDVT  307
            FDW+KL +    Y+  LN  Y  +L   KV++      F     + +  D K     +V 
Sbjct  29   FDWTKLKTRRDAYVRRLNGIYERNLASSKVEFIQGSARFNKQGNVEV--DGK-----EVL  81

Query  308  FRRAVIAVGGRPKPLSCPGWEHALSSDDIFSKPDAPGKTLVVGASYVALECAGFLKGQGF  367
             +  +IAVGG+P     PG E  + SD  F     P K  V+GA Y+A+E AG L   G 
Sbjct  82   AKNVMIAVGGKPMIPDIPGKELCIDSDGFFELDTLPKKVAVIGAGYIAVELAGVLNALGS  141

Query  368  DVTIMVRSI-LLRGFDQDIARRIGEYMESESGIAFIKESVPTSIVKLENGQFQVTHTTGQ  426
            + +I  R   +LR FD DI R   E   +  G+     S    + +  +G   +  T G 
Sbjct  142  ETSIFCRKEGVLRTFD-DIVRTTLEDAMAIDGLHLRPNSNVARVEQAADGTNTLVLTDGS  200

Query  427  D--VYDTILNATGRSPDVQKLNLDAAGVALNPKSGRIHVVNE--QTSTPNIYALGDVIDA  482
                +D ++ A GR P   KL+LD AGVA N K G I VVNE  +TS   ++A+GDV   
Sbjct  201  AHCGFDIVIYAAGRVPLTDKLDLDNAGVATN-KHGYI-VVNEFQETSNSKVFAVGDVCGT  258

Query  483  PELTPVAIQAGKLLSRRLFGN-GTTLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGREN  541
            P LTPVA+ AG+ LS RLFGN     + Y  I T VF+    G  GL+E+ A    G ++
Sbjct  259  PALTPVAVAAGRKLSDRLFGNMKDARVSYENIPTVVFSHPPIGTIGLTEKQAQGKYGDDD  318

Query  542  VEVYHQNFTPLEWSLSHDRPLA------KECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQ  595
            ++VY  +F  + + L ++   A      K   A  +V   ++++V+G H +G  A E+ Q
Sbjct  319  IKVYTSHFVNMYYGLINEVDEATGELKEKPKTAIKLVCAGKKEKVVGLHMIGMAADEILQ  378

Query  596  AIGIAIKLNATYDDFINTVGIHPTTAEIFTTL  627
              G+A+K+ AT  DF N + IHPT +E   TL
Sbjct  379  GFGVAVKMGATKADFDNCIAIHPTASEELVTL  410

>PYIR_23431
Length=468

 Score = 188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 152/462 (33%), Positives = 215/462 (47%), Gaps = 56/462 (12%)

Query  181  KEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGEILHKDADQFG  240
            + A+  G KVLV++  +        GLGGTCVN GC+PKK+M  +S   E L+++AD   
Sbjct  23   RRAATYGAKVLVVERGRKY---DGMGLGGTCVNYGCVPKKVMFNASAHVEHLNRNAD---  76

Query  241  WSVSN--------ATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYENMLGTFKDAHTL  292
            +S++           FDW+ + +    YI  LN  Y  +L +  V     +        +
Sbjct  77   YSITTNGSKKFEFGDFDWANMKTKRDAYILRLNGIYERNLGNAAVDLVEGIAK------V  130

Query  293  TLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDDIFSKPDAPGKTLVVGAS  352
               N  +  G    T +  ++AVGG+P   + PG EH + SD  F     P K  VVGA 
Sbjct  131  VAKNQIEVNGVV-YTGKHILVAVGGKPSLPNIPGIEHVIDSDGFFRLEAQPKKVAVVGAG  189

Query  353  YVALECAGFLKGQGFDVTIMVR-SILLRGFDQDIARRIGEYMESESGIAFIKESVPTSIV  411
            Y+A+E AG       D ++  R   +LR FD  +   I E  E ++GI F++ S    I 
Sbjct  190  YIAIELAGIFNTLKSDTSLFCRYDHVLRQFDPIVRDLINEESE-KAGINFVRNSRIERID  248

Query  412  KLENGQFQVT-HTTGQDV----YDTILNATGRSPDVQKLNLDAAGVALNPKSGRIHVVNE  466
            K  +G   +T    G++     +DTIL A GR P  + L L+  GV L      +    E
Sbjct  249  KQADGTLTITAKVDGEEQVLSGFDTILYAIGREPRTKDLGLEEVGVKLTDAGFIVVDAQE  308

Query  467  QTSTPNIYALGDV-IDAPELTPVAIQAGKLLSRRLFGNGTTLMDYTKICTAVFTPVEYGC  525
             TS P IYA+GD  I   ELTP                         I T VF+    G 
Sbjct  309  NTSVPGIYAIGDATITGWELTP-------------------------IPTVVFSHPPLGT  343

Query  526  CGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAKECYAKLIVDTTQQKRVLGFHY  585
             G +E  AI   G ENV+VY   F  L ++++   P  K   A  +V   + + V+G H 
Sbjct  344  IGYTEPQAIEKFGAENVKVYTSKFVNLLYAMAD--PDHKGKTAMKLVTVGEDEVVVGVHV  401

Query  586  LGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIFTTL  627
             G  A E+ Q  G+A+K+NAT  DF N V IHPT AE   T+
Sbjct  402  AGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVTM  443

>PYAR_17714
Length=444

 Score = 180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 153/476 (32%), Positives = 226/476 (47%), Gaps = 70/476 (15%)

Query  165  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  224
            +D +VIGGGSGG+A ++ A+  G KVL+++  + +      GLGGTCVN GC+PKK+M  
Sbjct  7    YDYIVIGGGSGGMASARRAAVHGAKVLLIERGRAN---DGMGLGGTCVNFGCVPKKVMWN  63

Query  225  SSIIGEILHKDAD---QFGWSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYEN  281
            ++   E L ++AD   + G       FDW+ + +    YI  LN  Y  ++ + K+    
Sbjct  64   AASHVEHLARNADYSIRSGAEFQYGDFDWANMAAKRDAYILRLNGIYERNIGNAKIDLIE  123

Query  282  MLG--TFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDDIFSK  339
             +   T KDA    +T D K         +  ++AVGG P     PG EHA+ SDD F  
Sbjct  124  GIASLTAKDA----VTVDGKTXXXXG---KHILVAVGGVPAMPQIPGIEHAIDSDDFFKL  176

Query  340  PDAPGKTLVVGASYVALECAGFLKGQGFDVTIMVR-SILLRGFDQDIARRIGEYMESESG  398
               P K  VVGA Y+A+E AG       +  +  R   +LR FD  +   +   M+ + G
Sbjct  177  KTQPKKVAVVGAGYIAVEIAGVFNTLKSETHLFCRYDQVLRAFDPIVRDLVNAEMD-KHG  235

Query  399  IAFIKESVPTSIVKLENGQFQVTHTT-GQDV----YDTILNATGRSPDVQKLNLDAAGVA  453
            + F++ S   +IVK  +G+  V  T  G D     +D +L A GR P  + L L++ GV 
Sbjct  236  VHFVRRSRIHAIVKQPDGKLSVQATVDGVDTVLNDFDQVLFAIGREPRTKGLGLESVGVK  295

Query  454  LNPKSGRIHVVN-EQTSTPNIYALGDVIDAP-ELTPVAIQAGKLLSRRLFGNGTTLMDYT  511
            L+  +G I V   E TS   +YA+GD      ELTP                        
Sbjct  296  LS-DAGFIEVDKFENTSVDGVYAIGDATTTGYELTP------------------------  330

Query  512  KICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAKECYAKLI  571
                                +A+   G ++V+VY   F  L ++++   P  K   A  +
Sbjct  331  -------------------PEAVEKFGADHVKVYTSTFVNLLYAMAD--PDHKSKTAMKL  369

Query  572  VDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIFTTL  627
            V   + ++V+G H  G  A E+ Q  G+AIK+NAT  DF N V IHPT AE   T+
Sbjct  370  VCVGENEQVVGVHVAGEGADEMIQGFGVAIKMNATKSDFDNIVAIHPTAAEELVTM  425

>PYVX_16175
Length=446

 Score = 174 bits (441),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 149/465 (32%), Positives = 210/465 (45%), Gaps = 80/465 (17%)

Query  181  KEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGEILHKDADQFG  240
            + A+  G KVL+++  + +      GLGGTCVN GC+PKK+M  ++   E L++  D   
Sbjct  23   RRAASHGAKVLLVERGRAN---DGAGLGGTCVNYGCVPKKVMFNAAAHVEHLNRAGD---  76

Query  241  WSVSN--------ATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYENMLGTFKDAHTL  292
            +SV+           FDW  + +    YI  LN  Y  +L + K+  + + G  +     
Sbjct  77   YSVTTLGERKFQFGDFDWLNMKTKRDAYIARLNGIYERNLGNAKI--DVVQGVARVVARN  134

Query  293  TLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDDIFSKPDAPGKTLVVGAS  352
             L  D K       T +  ++A GG P     PG EHA+ SD  F     P K  VVGA 
Sbjct  135  QLEVDGKV-----YTGKNLLLAPGGVPTLPPIPGIEHAIDSDGFFKLEQQPRKVAVVGAG  189

Query  353  YVALECAGFLKGQGFDVTIMVR-SILLRGFDQDIARRIGEYMESESGIAFIKESVPTSIV  411
            Y+A+E AG       +  +  R   +LR FD  +   +   ME ++G+ F++ S  T I 
Sbjct  190  YIAVEIAGIFNVLQSETFLFCRYDQVLRTFDPIVRDLVNAEME-KNGVQFVRRSHITRID  248

Query  412  KLENGQFQV-------THTTGQDVYDTILNATGRSPDVQKLNLDAAGVALNPKSGRIHV-  463
            KLE+G+ Q+       T T G   +DT+L A GR P    L L+A GV L+ K G I V 
Sbjct  249  KLEDGKLQITAEVDGATQTIGG--FDTVLFAIGREPRTADLGLEAIGVDLDDK-GFIKVD  305

Query  464  VNEQTSTPNIYALGDVIDAP-ELTPVAIQAGKLLSRRLFGNGTTLMDYTKICTAVFTPVE  522
              E TS   +YA+GD      ELTP                                   
Sbjct  306  AQENTSAAGVYAIGDATTTGWELTP-----------------------------------  330

Query  523  YGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAKECYAKLIVDTTQQKRVLG  582
                     DA+A  G ENV+VY   F  L  +++   P  K   A  +V    Q+ V+G
Sbjct  331  --------PDAVAKYGAENVKVYTSTFVNLVHAMAD--PDHKGKTAMKLVTVGAQETVVG  380

Query  583  FHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIFTTL  627
             H  G  A E+ Q  G+A+KL AT  DF N V IHPT +E   T+
Sbjct  381  VHVAGEGADEMIQGFGVAVKLGATKADFDNIVAIHPTASEELVTM  425

>CCA22989
Length=494

 Score = 147 bits (370),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 127/471 (27%), Positives = 209/471 (44%), Gaps = 30/471 (6%)

Query  164  DWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMH  223
            ++DL+VIGGG GG   + +A++LG K + ++        S   LGGTC+NVGCIP K + 
Sbjct  26   EYDLIVIGGGPGGYVAAIKAAQLGMKTVCIE--------SRGTLGGTCLNVGCIPSKALL  77

Query  224  QSSIIGEILHKDADQFGWSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYENML  283
             SS +      D    G   S+   ++ K++ + +  +  L        +  KV Y    
Sbjct  78   HSSHMFHTAQHDFKAIGIEASDLRLNFGKMMKAKEKSVKVLTSGIEGLFKKNKVAYIKGH  137

Query  284  GTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPL-SCP---GWEHALSSDDIFSK  339
            GT      ++++   + KG   +  +  +IA G    PL  CP        + S      
Sbjct  138  GTIVGKDQVSVSYSDESKGKETIQAKNILIATGSEVSPLPPCPVDNEKGRIVDSTGALVL  197

Query  340  PDAPGKTLVVGASYVALECAGFLKGQGFDVTIM-VRSILLRGFDQDIARRIGEYMESESG  398
               P + +VVGA  + LE     +  G +VT++   + +  G D ++ R   + ++ + G
Sbjct  198  KSTPKEMVVVGAGVIGLELGSVYRRLGANVTVIEYLNHVCPGLDMELGREFAKTLQKQ-G  256

Query  399  IAFIKESVPTSIVKLENGQFQVTHTTGQDVYDT------ILNATGRSPDVQKLNLDAAGV  452
              F K +   +  K+   +  +T    +   +T      +L ATGR P  Q L L+  G+
Sbjct  257  FKF-KFATKVTSTKVNEDRVTITMEDAKGGNETNMECDVVLVATGRRPFTQNLGLENLGI  315

Query  453  ALNPKSGRIHVVNE-QTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLFGNGTTLMDYT  511
              + K GRI V N  +T  PNIYA+GDVI  P L   A + G      + G     ++Y 
Sbjct  316  QTD-KLGRIPVDNHFRTLVPNIYAIGDVIAGPMLAHKAEEEGIAAVEIMLGK-QGHVNYN  373

Query  512  KICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAKECYAKLI  571
             I   ++T  E  C G +EE       +E    Y+    P+  + S  R + +      +
Sbjct  374  AIPGVIYTFPEVACVGRTEEQL-----KEEGVSYNVGKFPM-IANSRARAVGETDGFVKV  427

Query  572  VDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAE  622
            +      R+LG H +  NAGE+     + I+  A+ +D   T   HPT +E
Sbjct  428  LAQKDNDRILGIHLMTSNAGEMIAEGVLGIEYGASSEDIGRTCHAHPTLSE  478

>CCI10477
Length=494

 Score = 144 bits (362),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 126/470 (27%), Positives = 209/470 (44%), Gaps = 28/470 (6%)

Query  164  DWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMH  223
            ++DLVVIGGG GG   + +A++LG K   ++        S   LGGTC+NVGCIP K + 
Sbjct  26   EYDLVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGSLGGTCLNVGCIPSKALL  77

Query  224  QSSIIGEILHKDADQFGWSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYENML  283
             SS +      D    G  VS+   ++ K++ + +  +  L        +  KV Y    
Sbjct  78   HSSHLFHTAQHDFKSIGIEVSDLRLNFGKMMKAKEKSVKVLTSGIEGLFKKNKVAYIKGH  137

Query  284  GTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPL-SCPGWEHA---LSSDDIFSK  339
            G     + +++    + KG   +T +  +IA G    PL  CP        + S      
Sbjct  138  GKIVAKNQVSVALSDESKGNETITAKNILIATGSEVSPLPPCPVDNEKGKIVDSTGALVL  197

Query  340  PDAPGKTLVVGASYVALECAGFLKGQGFDVTIM-VRSILLRGFDQDIARRIGEYMESESG  398
               P + +VVGA  + LE     +  G +VT++   + +  G D ++ R   + ++ + G
Sbjct  198  KSIPKEMVVVGAGVIGLELGSVYRRLGANVTVVEYLNHVCPGLDMELGREFAKTLQKQ-G  256

Query  399  IAF-IKESVPTSIVKLENGQFQVTHTTGQDVY----DTILNATGRSPDVQKLNLDAAGVA  453
            + F     V ++ V  +N    +    G +      D +L ATGR P    L L++ G+ 
Sbjct  257  LKFKFATRVTSTKVNGDNVTITMEDAKGGNETSMECDVVLVATGRRPFTNGLGLESMGIQ  316

Query  454  LNPKSGRIHVVNE-QTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLFGNGTTLMDYTK  512
             + K GRI V +  +T+ P+IYA+GDVI  P L   A + G      + G    + +Y  
Sbjct  317  TD-KMGRIQVDDHFRTAIPSIYAIGDVIAGPMLAHKAEEEGIAAVEIMLGKHGHV-NYNA  374

Query  513  ICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAKECYAKLIV  572
            I   ++T  E  C G +EE       +E    Y+    P+  + S  R + +      ++
Sbjct  375  IPGVIYTHPEVACVGKTEEQL-----KEEGISYNVGKFPM-IANSRARAVGETDGFVKVL  428

Query  573  DTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAE  622
                  R+LG H +  NAGE+     + ++  A  +D   T   HPT +E
Sbjct  429  AQKDNDRILGIHIMTSNAGEMIAEGVLGLEYGAASEDIGRTCHAHPTLSE  478

>PYAP_22645
Length=1565

 Score = 144 bits (362),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 134/475 (28%), Positives = 216/475 (45%), Gaps = 36/475 (8%)

Query  164   DWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMH  223
             ++DLVVIGGG GG   + +A++LG        +K + V S   LGGTC+NVGCIP K + 
Sbjct  1099  EYDLVVIGGGPGGYVAAIKAAQLG--------LKTACVESRGSLGGTCLNVGCIPSKALL  1150

Query  224   QSSIIGEILHKDADQFGWSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYENML  283
              ++ +      D  ++G  VS+   ++  ++ S +  +  L        +  KV Y    
Sbjct  1151  HATHMYHAAQHDFSKYGIEVSDVKMNFDGMMKSKEKAVKTLTGGIEGLFKKNKVTYVKGF  1210

Query  284   GTFKDAHTLTLT-NDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHA----LSSDDIFS  338
             G    A+ +++  NDA   G   +  +  +IA G    PL     ++A    + S     
Sbjct  1211  GKIVSANEVSVALNDA---GNETLKAKNILIATGSEVAPLPPVPVDNAAGKIVDSTGALE  1267

Query  339   KPDAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRS-ILLRGFDQDIARRIGEYMESES  397
                 P   +V+G   + LE     K  G  VT++  +  +  G DQ++ +   + ++ + 
Sbjct  1268  LKKVPEHLVVIGGGVIGLELGSVYKRLGAKVTVVEYADRVAPGLDQELGKEFTKLLKKQ-  1326

Query  398   GIAF-IKESVPTSIVKLENGQFQVTHTTGQDV----YDTILNATGRSPDVQKLNLDAAGV  452
             G+ F     V  S V  +     V    G        DT+L ATGR P  + L L+  G+
Sbjct  1327  GLQFEFSTKVTASEVNGDKVTLTVEPAAGGASSTIEADTVLVATGRRPFTKGLGLEQMGI  1386

Query  453   ALNPKSGRIHVVNE-QTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLFG-NGTTLMDY  510
               + K GRI V N  +T  PNI+A+GDVI  P L   A + G      + G +G   ++Y
Sbjct  1387  QTD-KLGRIQVDNHFRTQIPNIFAIGDVIAGPMLAHKAEEEGIACVENIAGLHGH--VNY  1443

Query  511   TKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAK-ECYAK  569
               I   ++T  E    G +EE       +E    Y+    P+  + S  R +A+ + + K
Sbjct  1444  DAIPGVIYTYPEVASVGKTEEQL-----KEEGVAYNVGKFPM-MANSRARAVAESDGFVK  1497

Query  570   LIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIF  624
             +I D T   R+LG H +  NAGE+     + ++  A  +D   T   HPT +E F
Sbjct  1498  VIADKTTD-RILGIHIIASNAGEMISEGVLGMEYGAASEDIGRTCHAHPTLSEAF  1551

>PYU1_G014259
Length=244

 Score = 127 bits (319),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 79/219 (36%), Positives = 113/219 (52%), Gaps = 24/219 (11%)

Query  164  DWDLVVIGGGSGGLACSKEASKL-GQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLM  222
            ++D +VIG GSGG+A S+ A+     +V V++  +         LGGTCVNVGC+PKK+M
Sbjct  34   EYDYLVIGAGSGGMASSRRAASYPNTRVAVVEKAR---------LGGTCVNVGCVPKKIM  84

Query  223  HQSSIIGEILHKDADQFGWSVS-------NATFDWSKLVSSVQDYIHGLNFKYRVDLRDK  275
            + ++ +  +LH+DA  +G+          N +F W+KL      Y+  LN  Y  +L + 
Sbjct  85   YLAADMNHMLHRDAFHYGFETQDGKRIGENVSFHWNKLKERRDAYVLRLNGIYERNLANS  144

Query  276  KVKYENMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDD  335
            KV        F     + +  D K     +V  +  +IAVGG+P     PG EH + SD 
Sbjct  145  KVDLLQGTAAFNAQGNVEV--DGK-----EVKAKNILIAVGGKPLIPDIPGKEHCIDSDG  197

Query  336  IFSKPDAPGKTLVVGASYVALECAGFLKGQGFDVTIMVR  374
             F     P K  VVGA Y+A+E AG L G G D TI  R
Sbjct  198  FFELEVLPKKVAVVGAGYIAVELAGVLNGLGSDTTIFCR  236

>SPRG_19943
Length=343

 Score = 130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 86/251 (34%), Positives = 124/251 (49%), Gaps = 21/251 (8%)

Query  165  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  224
            +D +V+G GSGG++ +  A   G KVLV++           GLGGTCVNVGC+PKK+M  
Sbjct  21   YDYIVLGAGSGGVSSAHRAVAYGAKVLVIER---GHANDGAGLGGTCVNVGCVPKKIMFN  77

Query  225  SSIIGEILHKDADQFGWS----VSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYE  280
            +++  E+LH  A  + +     +    FDW+ + +    Y+  LN  Y   + + KV   
Sbjct  78   AALHAEMLHS-ARAYAFKGVQDIQFGAFDWAAMKAKRDAYVKWLNDMYGEGMLEDKVDLV  136

Query  281  NMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDDIFSKP  340
                 F D HT+ +  D         T +  +IAVGG P     PG EHA+SSD  F+  
Sbjct  137  MGAAKFVDNHTVEVNGD-------RYTAKHILIAVGGVPAMPPLPGIEHAISSDGFFALE  189

Query  341  DAPGKTLVVGASYVALECAGFLKGQGFDVTIMVR-SILLRGFDQDIARRIGEYMESESGI  399
              P K  VVGA Y+A+E AG       D T+  R + +LR FD  +   +   ME     
Sbjct  190  TQPRKVAVVGAGYIAVELAGIFNALKSDTTLFCRGNQVLRTFDPIVRDLVNSEMEHAG--  247

Query  400  AFIKESVPTSI  410
               KE V T++
Sbjct  248  ---KEKVQTAM  255

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 30/51 (59%), Gaps = 0/51 (0%)

Query  577  QKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIFTTL  627
            ++ V+G H  G  A E+ Q  G+A+K+ A   DF N V IHPT +E   T+
Sbjct  263  EETVVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  313

>PYIR_20273
Length=505

 Score = 133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 134/487 (28%), Positives = 212/487 (44%), Gaps = 54/487 (11%)

Query  164  DWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMH  223
            ++DLVVIGGG GG   + +A++LG        +K + V S   LGGTC+NVGCIP K + 
Sbjct  33   EYDLVVIGGGPGGYVAAIKAAQLG--------LKTACVESRGSLGGTCLNVGCIPSKALL  84

Query  224  QSSIIGEILHKDADQFGWSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYENML  283
             S+ +      D  ++G  VS  + ++ K++ S +  +  L        +  KV Y    
Sbjct  85   HSTHLYHSAQHDFAKYGIEVSEVSMNFGKMMKSKEKAVKTLTGGIEQLFKKNKVTYIKGH  144

Query  284  GTFKDAHTLTLT-NDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHA----LSSDDIFS  338
            G     + + +  ND+   G   VT +  +IA G    PL     ++A    + S     
Sbjct  145  GKIVAKNEVAVALNDS---GNQTVTAKNILIATGSEVSPLPPVPVDNAAGKIVDSTGALE  201

Query  339  KPDAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLR---GFDQDIARRIGEYMES  395
                P   +VVGA  + LE     K  G  VT++    L R   G D ++ +   + ++ 
Sbjct  202  LKKVPEHLVVVGAGVIGLELGSVYKRLGAKVTVV--EYLDRVCPGLDLELGKEFTKLLKK  259

Query  396  ESGIAFIKESVPTSIVKLENGQFQVTHTTGQDVY--------------DTILNATGRSPD  441
            + G+ F      T +   E    ++T T                    D +L ATGR P 
Sbjct  260  Q-GLGF---EFSTKVTASEVNGEKITLTXXXXXXXXXXAGGAASTIECDAVLVATGRRPY  315

Query  442  VQKLNLDAAGVALNPKSGRIHVVNE-QTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRL  500
               L L+  G+  + K GRI V +  +T  PNI+A+GDVI  P L   A + G   +  +
Sbjct  316  TNGLGLENMGIQTD-KFGRISVDDHFRTQIPNIFAIGDVIAGPMLAHKAEEEGIACAETI  374

Query  501  FGNGTTLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDR  560
             G    + +Y  I   ++T  E    G +EE       +E    Y+    P+   L++ R
Sbjct  375  AGKHGHV-NYNAIPGVIYTFPEVASVGKTEEQL-----KEEGVTYNVGKFPM---LANSR  425

Query  561  PLA---KECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIH  617
              A    +   K+I D    K +LG H +  NAGE+     + ++  A+ +D   T   H
Sbjct  426  ARAVGEADGLVKVIADKATDK-ILGVHIIASNAGEMISEGVLGMEYGASSEDIARTCHAH  484

Query  618  PTTAEIF  624
            PT +E F
Sbjct  485  PTLSEAF  491

>HYAP_12621
Length=501

 Score = 129 bits (325),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 136/477 (29%), Positives = 214/477 (45%), Gaps = 39/477 (8%)

Query  164  DWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKK-LM  222
            D+DLVVIGGG GG   + +A++LG        +K + V S   LGGTC+NVGCIP K L+
Sbjct  34   DYDLVVIGGGPGGYVAAIKAAQLG--------LKTACVESRGKLGGTCLNVGCIPSKALL  85

Query  223  HQSSIIGEILHKDADQFGWSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYENM  282
            H + ++    H +   +G    N T ++ +++ + +  +  L           KV Y   
Sbjct  86   HSTHLLHTAQH-EFKSYGIDAPNVTANFPQMMKAKEKAVRTLTAGIESLFSKNKVTYIKG  144

Query  283  LGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPL-SCPGWEHA---LSSDDIFS  338
            +G       +++T  A ++G   +T +  ++A G    PL   P    A   + S    +
Sbjct  145  VGKLAAKGQVSVTL-ADRQGNGTLTAKNIILATGSEVTPLPPVPVDNDAGKIVDSTGALA  203

Query  339  KPDAPGKTLVVGASYVALECAGFLKGQGFDVTIM-VRSILLRGFDQDIARRIGEYMESES  397
                P   +VVGA  + LE     K  G  VT++        G D+   +   + ++ + 
Sbjct  204  LTRVPEHLVVVGAGVIGLELGSVYKRLGAKVTVVEYLDSACSGMDKGAVKEFLKLLKKQ-  262

Query  398  GIAFIKESVPTSIVKLENGQFQVTHTT-------GQDVY-DTILNATGRSPDVQKLNLDA  449
            G+ F      T +   E     VT TT       G  +  DT+L ATGR      L L+ 
Sbjct  263  GLEF---QFGTKVTASEVNGDVVTLTTEPANGGDGSTIKCDTVLVATGRRAFTAGLGLEQ  319

Query  450  AGVALNPKSGRIHVVNE-QTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLFGNGTTLM  508
             G+  + K GRI V +  QT  P ++A+GDVI    L   A + G      + G    + 
Sbjct  320  MGIQTD-KQGRIEVDHAFQTQVPGVFAIGDVIKGTMLAHKAEEEGIACVENIAGKHGHV-  377

Query  509  DYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAK-ECY  567
            +Y  I   ++T  E+   G +EE+  A    E VE Y+    P+  + S  R +A+ +  
Sbjct  378  NYGAIPNVIYTFPEFASVGKTEEELKA----EGVE-YNVGKFPM-MANSRARTVAEADGM  431

Query  568  AKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIF  624
             K++ D    K +LG H +  NAGE+     I I+  A  +D   T   HPT +E F
Sbjct  432  VKVLADKKTDK-LLGVHIIASNAGEMISEGVIGIEYGAASEDLARTCHAHPTLSEAF  487

>PYVX_21248
Length=502

 Score = 128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 123/445 (28%), Positives = 198/445 (44%), Gaps = 31/445 (7%)

Query  196  VKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGEILHKDADQFGWSVSNATFDWSKLVS  255
            +K + V S   LGGTC+NVGCIP K +  S+ +      D  ++G  V     +   ++ 
Sbjct  59   LKTACVESRGKLGGTCLNVGCIPSKALLHSTHLYHSAQHDFAKYGVEVEGVKANLGGMMK  118

Query  256  SVQDYIHGLNFKYRVDLRDKKVKYENMLGTF--KDAHTLTLTNDAKKKGPTDVTFRRAVI  313
            + +  +  L        +  KV Y    G    K+   + L +D   KG   VT +  +I
Sbjct  119  AKEKAVTTLTGGIESLFKKNKVTYIKGHGKIVGKNEVAVALNDD---KGNQTVTAKNIMI  175

Query  314  AVGGRPKPLSCPGWEHA----LSSDDIFSKPDAPGKTLVVGASYVALECAGFLKGQGFDV  369
            A G  P PL     +++    + S    S P  P   +VVGA  + LE     K  G  V
Sbjct  176  ATGSEPAPLPPVPVDNSKFKIVDSTGALSLPKIPEHLVVVGAGVIGLELGSVYKRLGSKV  235

Query  370  TIMVRSILLR---GFDQDIARRIGEYMESESGIAF-IKESVPTSIVKLENGQFQVTHTTG  425
            T++    L R   G D ++++   + ++ + G+ F     V  S VK +N    V  + G
Sbjct  236  TVV--EFLDRACPGLDLEVSKEFTKLLKKQ-GLEFQFSTKVTASEVKGDNVTLTVEPSAG  292

Query  426  QDVY----DTILNATGRSPDVQKLNLDAAGVALNPKSGRIHVVNE-QTSTPNIYALGDVI  480
                    DT+L ATGR P  + L L+  G+  + K GR+ V +  +T  PNIYA GDVI
Sbjct  293  GSAASIECDTVLVATGRRPFTEGLGLEQMGIQTD-KQGRVEVDSHFRTQIPNIYAFGDVI  351

Query  481  DAPELTPVAIQAGKLLSRRLFGNGTTLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRE  540
                L   A + G   +  + G    + +Y  I   ++T  E    G +EE+      + 
Sbjct  352  KGAMLAHKAEEEGVACAEIISGKHGHV-NYDAIPGVIYTTPEVASVGKTEEEL-----KN  405

Query  541  NVEVYHQNFTPLEWSLSHDRPLAK-ECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGI  599
                Y+    P+  + S  R +A+ + + K++ D     R+LG H +  NAGE+     +
Sbjct  406  EGVTYNVGKFPM-MANSRARTIAEADGFVKILADKATD-RILGVHIIAGNAGEMVAEGVL  463

Query  600  AIKLNATYDDFINTVGIHPTTAEIF  624
             ++  A+ +D   T   HPT +E F
Sbjct  464  GLEYGASSEDIARTCHAHPTLSEAF  488

>H257_01186
Length=496

 Score = 120 bits (302),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 124/476 (26%), Positives = 215/476 (45%), Gaps = 37/476 (8%)

Query  164  DWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMH  223
            ++DL+VIG G  GL C+ E++K+G+ V ++D         +  +GG CV+ G IP K   
Sbjct  28   EYDLIVIGSGPSGLQCALESAKMGKSVAIID--------KSEEIGGVCVHTGTIPSKTFR  79

Query  224  QSSIIGEILHKDADQ----FGWSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKY  279
            ++     +LH         +G S S      S ++  V   +       R  L+   V+ 
Sbjct  80   EA-----VLHLSGFNHHGFYGKSYSRERITLSDILHRVNVVVSSEMDVIRAQLKAAHVQI  134

Query  280  ENMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRP--KPLSCPGWEHALSSDDIF  337
                  F++A+ +++ N    +       ++ +IA G  P   P+     E  L SD I 
Sbjct  135  IPGKARFENANEVSVENGTVHREAMIYRGKKFLIACGTYPAHSPVVPVDGEVILDSDGIL  194

Query  338  --SKPDAPGKTLVVGASYVALECAGFLKG-QGFDVTIM-VRSILLRGFDQDIARRIGEYM  393
              SK + P   +VVGA  + +E A  L    G  VT++  R  +L   D +I   +   M
Sbjct  195  EASKGELPKSWIVVGAGVIGMEYASMLNVLPGVAVTVVDGRPDILTFCDDEIVSALKMEM  254

Query  394  ESESGIAFIKESVPTSIVKLENGQFQVTHTTGQDVY-DTILNATGRSPDVQKLNLDAAGV  452
              +     + E++  S+ ++  G  +V   +G+  + + +L   GR  +   LNL+  G+
Sbjct  255  RHKGARFLLGETI-QSVTRVAKG-VRVDFASGKSSFAEALLYCVGRQANTDALNLEGVGL  312

Query  453  ALNPKSGRIHVVNE-QTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLFGNG---TTLM  508
            A N K G + V  + QTS P+IYA GD I AP L   +++ G+L +  ++ +    T+ +
Sbjct  313  AKN-KRGLLTVNKQYQTSQPHIYAAGDCIGAPSLASTSLEQGRLAACDMWHHEDQPTSQL  371

Query  509  DYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAKECYA  568
            D       ++T  E    G +E+  +   GR N  V    ++ L   +       ++   
Sbjct  372  DSGNYPYGIYTIPEISMVGKTEQQ-LTKEGR-NYAVGMAKYSELAKGMMAG---GQKGAL  426

Query  569  KLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIF  624
            K++ D   Q  VLG H +G  A E+     +A+ +N     F + V  +PT AE +
Sbjct  427  KILFDPDTQS-VLGVHAIGQGATEIIHIGQVAMAMNCKITYFRDAVFNYPTLAEAY  481

>SDRG_14446
Length=495

 Score = 119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 129/478 (27%), Positives = 218/478 (46%), Gaps = 47/478 (10%)

Query  164  DWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMH  223
            ++DLVVIG G   + C+ E+ K G+ V V+D           G+GG CV+ G IP K   
Sbjct  28   EYDLVVIGSGPSAVQCAIESVKKGKTVAVID--------KKAGIGGVCVHTGTIPSKTFR  79

Query  224  QSSI-IGEILHKDADQFGWSVSNATFD-----WSKLVSSVQDYIHGLNFKYRVDLRDKKV  277
            +S + +    H+      ++  N T +      + +VS   D I       RVDL     
Sbjct  80   ESVLHLSGFRHQGFYGKSYARDNITLNDILGRVNTVVSKEMDVIQAQLKAARVDLVPGLA  139

Query  278  KYENMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRP--KPLSCPGWEHALSSDD  335
            ++EN        + +++  D  +  PT +  ++ ++A G RP   PL     +  L SD 
Sbjct  140  RFEN-------ENEVSVEGDDGQ--PTRLRGKKFLVACGTRPAHSPLVPCDGKVILDSDQ  190

Query  336  IFS--KPDAPGKTLVVGASYVALECAGFLKG-QGFDVTIM-VRSILLRGFDQDIARRIGE  391
            I +      P   +VVGA  + +E A  L    G +VT++  R+ +L   D +I   +  
Sbjct  191  ILNHGTTKLPKSWIVVGAGVIGMEYASMLNVLPGINVTVVDGRAEILSFCDDEIVSSLKM  250

Query  392  YMESESGIAFIKESVPTSIVKLENGQFQVTHTTGQDVY-DTILNATGRSPDVQKLNLDAA  450
             M  +     + ES+  S+   +NG  +V   +G+ ++ + +L   GR  +   LNL+A 
Sbjct  251  EMRHKGARFLLGESIK-SVEHFKNG-VKVEFNSGKAMFAEALLYCVGRQANTDGLNLEAV  308

Query  451  GVALNPKSGRIHVVNEQ--TSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLFGNG---T  505
            G++ N +   +  VNEQ  TS P+IYA GD I AP L   +++ G+L +  ++ +    T
Sbjct  309  GLSKNHRG--LITVNEQYQTSHPHIYAAGDCIGAPSLASTSMEQGRLAACDMWSDKDQTT  366

Query  506  TLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPL-EWSLSHDRPLAK  564
            + ++       ++T  E    G +E+         N  V    F+ L +  +S D     
Sbjct  367  SQLESGNYPYGIYTIPEISMVGKTEQQLTKEGA--NYAVGLAKFSELAKGQMSGD----I  420

Query  565  ECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAE  622
            E   KL+ D    + +LG H +G  A E+     +A+ +N     F + V  +PT AE
Sbjct  421  EGILKLLFDPVSLQ-LLGVHAIGHGATEIIHIGQVAMAMNCKLTYFRDAVFNYPTLAE  477

>PHYRA_73883
Length=551

 Score = 118 bits (295),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 133/503 (26%), Positives = 228/503 (45%), Gaps = 59/503 (12%)

Query  165  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  224
            +DL+VIG G  G  C+ +++K G+ V ++D            LGG CV+ G +P K   +
Sbjct  46   FDLIVIGSGPAGQKCAIDSAKHGKSVAIID--------KRDMLGGVCVHTGTVPSKTFRE  97

Query  225  SSI-IGEILHKD--ADQFGWSVSNATFDWSKLVSSVQDYIHGLN----FKYRVDLRDKKV  277
            +++ +    HK     Q G S      D  + V  V+D    +      +  V L +   
Sbjct  98   AALHLTGYRHKAFYNGQAGPSKRFGVEDILQRVRKVEDAETDITRHQLMRNGVQLINGTA  157

Query  278  KY----ENMLGTFKDAHTLTLTNDAKKKGPTDVTFR-----RAVIAVGGRPK--PLSCPG  326
            ++    +NM+    +    T T DAK+    D+  R     + ++ VG RP   P     
Sbjct  158  RFLPGNKNMVAVLSNESYETAT-DAKRHTSADICKRVLTADKFLVCVGTRPARHPDIPFD  216

Query  327  WEHALSSDDIF--SKPDAPGKTLVVGASYVALECAGFLKG-QGFDVTIM-VRSILLRGFD  382
             E    SD +        P + +VVGA  V +E A  +    G DVT++  R  +L   D
Sbjct  217  GETIFDSDQLLWGKVKTVPRRLIVVGAGVVGMEYASMMTIIPGTDVTVIDGRKEILNMAD  276

Query  383  QDIARRIGEYMESESGIAFIKESVPTSIVKLENGQFQVTHTTGQDVY-DTILNATGRSPD  441
            ++++  +  Y  +++G  F+ E    S+ K +NG+  V   +G+ V  D +L   GR  +
Sbjct  277  KEVSEGLC-YSMAQTGTRFLTEETIKSVEKADNGEIFVHLESGKTVVGDGLLYTVGRQGN  335

Query  442  VQKLNLDAAGVALNPKSGRIHVVNE-QTSTPNIYALGDVIDAPELTPVAIQAGKL-----  495
            V+ LNL+A G+A + K GRI V N  QT+ P+IYA GD+I  P L   +++ G+L     
Sbjct  336  VEGLNLEAVGLAPD-KRGRIKVDNNFQTAAPHIYAAGDIIGFPGLASTSMEQGRLASVHM  394

Query  496  -----LSRRLFGNGTTLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFT  550
                 L+ ++  +   + D  ++ T + +  E    G+     I+  G+   ++  +  T
Sbjct  395  RTSKPLNNQVLSDDKKMDDPDRVRTRMRSG-EVFPFGIYTVPEISMVGKNEQQLTKEQ-T  452

Query  551  PLEWSLSHDRPLAK-------ECYAKLIV--DTTQQKRVLGFHYLGPNAGEVTQAIGIAI  601
            P E  ++    LA+         + K+I   DT    ++LG H +G  A E+     + +
Sbjct  453  PYEVGMARYEELARGQMLGGVPGFLKIIFCPDTL---KILGVHAIGEGATEIIHIGQVVM  509

Query  602  KLNATYDDFINTVGIHPTTAEIF  624
                  + F N V  +PT AE +
Sbjct  510  STGGNLEYFRNAVFNYPTLAEAY  532

>PYAR_20075
Length=469

 Score = 113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 113/438 (26%), Positives = 182/438 (42%), Gaps = 45/438 (10%)

Query  196  VKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGEILHKDADQFGWSVSNATFDWSKLVS  255
            +K + + S   LGGTC+NVGCIP K +  S+ +      D  ++G  VS+   D+  ++ 
Sbjct  54   LKTACIESRGSLGGTCLNVGCIPSKALLHSTHLFHTAQHDFKKYGIEVSDVQMDFGGMMK  113

Query  256  SVQDYIHGLNFKYRVDLRDKKVKYENMLGTFKDAHTLTLT-NDAKKKGPTDVTFRRAVIA  314
            S +  +  L        +  KV Y    G    A+ + +  ND                 
Sbjct  114  SKEKAVKTLTAGIESLFKKNKVTYIKGFGKIVAANEVAVALNDNN---------------  158

Query  315  VGGRPKPLSCPGWEHALSSDDIFSKPDAPGKTLVVGASYVALECAGFLKGQGFDVTIMVR  374
                       G E  + S    +   AP   +V+G   + LE     K  G  VT++  
Sbjct  159  -----------GNETIVDSTGALALKKAPEHLVVIGGGVIGLELGSVYKRLGSKVTVVEY  207

Query  375  S-ILLRGFDQDIARRIGEYMESESGIAFIKESVPTSIVKLENGQFQVTHTTGQDV----Y  429
            +  +  G D ++ +   + ++ +      K  V  S V  +     V    G +      
Sbjct  208  ADRVCPGLDLELGKEFAKLLKKQGLDLQFKTKVTASQVNGDKVTLTVEPAAGGEATTIEA  267

Query  430  DTILNATGRSPDVQKLNLDAAGVALNPKSGRIHVVNE-QTSTPNIYALGDVIDAPELTPV  488
            DT+L ATGR P    L L+  G+  + K GRI V    +T  P+IYA+GDVI  P L   
Sbjct  268  DTVLVATGRRPFTNGLGLEQMGIQTD-KMGRIQVDEHFRTQIPSIYAIGDVIAGPMLAHK  326

Query  489  AIQAGKLLSRRLFG-NGTTLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQ  547
            A + G      + G +G   ++Y  I   ++T  E    G +EE       +E    Y+ 
Sbjct  327  AEEEGIACVENIAGLHGH--VNYNAIPGVIYTHPEVASVGKTEEQL-----KEEGIAYNV  379

Query  548  NFTPLEWSLSHDRPLAK-ECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNAT  606
               P+  + S  R + + + + K++ D T  K +LG H +  NAGE+     + I+  A 
Sbjct  380  GKFPM-MANSRARAVGEGDGFVKVLADKTTDK-ILGIHIIASNAGEMISEGVLGIEYGAA  437

Query  607  YDDFINTVGIHPTTAEIF  624
             +D   T   HPT +E F
Sbjct  438  SEDIGRTCHAHPTLSEAF  455

>H310_00561
Length=497

 Score = 114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 121/480 (25%), Positives = 214/480 (45%), Gaps = 39/480 (8%)

Query  161  VKYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKK  220
            V  ++DL+VIG G  GL C+ E++K+G+ V ++D         +  +GG CV+ G IP K
Sbjct  26   VPKEYDLIVIGSGPSGLQCALESAKMGKSVAIVD--------KSEEIGGVCVHTGTIPSK  77

Query  221  LMHQSSIIGEILHKDADQ----FGWSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKK  276
               ++     +LH         +G S S        ++  V   +       R  L+   
Sbjct  78   TFREA-----VLHLSGFNHHGFYGKSYSRERITLRDILHRVNVVVSSEMDVIRAQLKAAH  132

Query  277  VKYENMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRP--KPLSCPGWEHALSSD  334
            V+       F++A+ +++  +      T    ++ +IA G  P   P+     E  L SD
Sbjct  133  VQIIPGKARFENANEVSVATEPVGSEATIYRGQKFLIACGTYPAHSPVVPVDGEVILDSD  192

Query  335  DIF--SKPDAPGKTLVVGASYVALECAGFLKG-QGFDVTIM-VRSILLRGFDQDIARRIG  390
             I   SK + P   +VVGA  + +E A  L    G  VT++  R  +L   D +I   + 
Sbjct  193  GILDASKGELPRSWIVVGAGVIGMEYASMLNVLPGVSVTVVDGRPDILTFCDDEIVSALK  252

Query  391  EYMESESGIAFIKESVPTSIVKLENGQFQVTHTTGQDVY-DTILNATGRSPDVQKLNLDA  449
              M  +     + E++  S+ ++  G  +V   +G+  + + +L   GR  +   LNL+ 
Sbjct  253  MEMRHKGARFLLGETI-QSVKRVRKG-VRVDFASGKSSFAEALLYCVGRQANTDTLNLEG  310

Query  450  AGVALNPKSGRIHVVNE--QTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLFGNG---  504
             G++ N +   +  VNE  QT+ P+I+A GD I AP L   +++ G+L +  ++ +    
Sbjct  311  VGLSKNKRG--LLSVNEQYQTTQPHIFAAGDCIGAPSLASTSLEQGRLAACAMWRHEDQP  368

Query  505  TTLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAK  564
            T+ +D       ++T  E    G +E+  +   GR N  V    ++ L   +       +
Sbjct  369  TSQLDSGNYPYGIYTIPEISMVGKTEQQ-LTKEGR-NYAVGVAKYSELAKGMMAG---GQ  423

Query  565  ECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIF  624
            +   KL+ D      VLG H +G  A E+     +A+ +N     F + V  +PT AE +
Sbjct  424  KGALKLLFDPDSHS-VLGVHAIGQGATEIIHIGQVAMAMNCKLTYFRDAVFNYPTLAEAY  482

>CCI50816
Length=807

 Score = 113 bits (283),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 130/482 (27%), Positives = 215/482 (45%), Gaps = 43/482 (9%)

Query  165  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  224
            +DL+VIG G     C+ +A+K G+ V ++D  K S VG      G CV+ G IP K   +
Sbjct  30   YDLIVIGSGPSATNCALDAAKRGKHVAIID--KKSSVG------GVCVHTGTIPSKTFRE  81

Query  225  SSI-IGEILHKDADQFGWSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYENML  283
            + + +    H       +S+ N T D   ++  V   I       RV  +  +V Y +  
Sbjct  82   AVLHLSGYRHHGFYGKSYSMKNVTID--DILYRVNRVIQSEVDLLRVQFKSARVDYISGH  139

Query  284  GTFKDAHTLTLTN---DAKKKGPTDVTFRRAVIAVGGRP--KPLSCPGWEHALSSDDIFS  338
              F+D H +++      A +K    +   + ++A G RP   P      +    SD I S
Sbjct  140  ARFEDDHQVSIIEADGPAHEKITKRLRASKFLVACGTRPAHNPNIPIDGKVIFDSDQILS  199

Query  339  --KPDAPGKTLVVGASYVALECAGFLKG-QGFDVTIMV-RSILLRGFDQDIARRIGEYME  394
                  P   +VVGA  + +E A  L   +G  VT++  R  +L   D +I   +   M 
Sbjct  200  WNIRQLPRSLIVVGAGVIGMEYASMLNVIRGHSVTVIDGREEILSFCDDEIISTLTHEMR  259

Query  395  SESGIAFIKESVPTSIVKLENGQFQVTHTTGQDVY-DTILNATGRSPDVQKLNLDAAGVA  453
            +      + E++  S+ K   G   V   +G+ V+ D +L   GR  +   LNL+AAG++
Sbjct  260  NHGARFLLGETI-ESVDKSSRGVL-VGLKSGKKVHGDALLYVVGRQANTDGLNLEAAGLS  317

Query  454  LNPKSGRIHVVNE-QTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLFGNGTTLMDY--  510
             NP+ G + V  + QT  P+I+A+GD I AP L   +++ G+L S  ++    +  D   
Sbjct  318  RNPR-GLLSVNTKYQTKKPHIFAVGDCIGAPSLASTSMEQGRLASCYMWNEDESNDDSIP  376

Query  511  TKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAK------  564
            +++ T  F    YG   + E   I+  G    ++  Q     E  ++    LAK      
Sbjct  377  SQLKTGNFP---YGIYTIPE---ISMVGHTEKQLTSQQIN-YEIGVAKYSELAKGQMSGA  429

Query  565  --ECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAE  622
              +   K++ D    K + G H +G  A E+     +AI + AT   F + V  +PT AE
Sbjct  430  SADGMLKILFDPHSLK-LFGVHAIGEGATEIIHIGQVAIAMGATLTYFRDAVFNYPTLAE  488

Query  623  IF  624
             +
Sbjct  489  AY  490

>PHYRA_47253
Length=481

 Score = 111 bits (278),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 124/489 (25%), Positives = 213/489 (44%), Gaps = 50/489 (10%)

Query  165  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  224
            +DLVVIG G     C+ E++K G++V ++D            LGG CV+ G IP K   +
Sbjct  1    YDLVVIGSGPSATQCALESAKQGKRVAIVD--------KRTRLGGVCVHTGTIPSKTFRE  52

Query  225  SSIIGEILHKDADQ----FGWSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYE  280
            +     +LH    +    +G S S  T     ++  VQ  +       R  L+  +V   
Sbjct  53   A-----VLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDVV  107

Query  281  NMLGTFKDAHTLTLT---NDAKKKGPT---------DVTFRRAVIAVGGRP--KPLSCPG  326
                 F+  H +++    +D +KKG +          V   + +IA G RP   PL    
Sbjct  108  PGFARFESEHEISIVRDDDDDQKKGASASSTLDSLSRVKADKFLIACGTRPAHNPLVPID  167

Query  327  WEHALSSDDIFSKP--DAPGKTLVVGASYVALECAGFLKG-QGFDVTIM-VRSILLRGFD  382
             +  + SD I S+     P   +VVGA  + +E A  +    G  VT++  R  +L   D
Sbjct  168  GQVVIDSDQILSRDMHQLPRSLIVVGAGVIGMEYASMVNVVPGHSVTVVDGRPDILSFCD  227

Query  383  QDIARRIGEYMESESGIAFIKESVPTSIVKLENGQFQVTHTTGQDV-YDTILNATGRSPD  441
            ++I   +   M+S      + E++    V+  + + +V   +G+ +  D +L   GR   
Sbjct  228  REIISNLTYEMQSNGARFLLGETIKK--VETADNRVKVFFDSGKVLSADALLYTVGRQAS  285

Query  442  VQKLNLDAAGVALNPKSGRIHV-VNEQTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRL  500
               LNL+A G++ N + G I+V  N QT  P+IYA GD I AP L   +++ G+L S  +
Sbjct  286  TDGLNLEAVGLSRNHR-GLINVNKNYQTDQPHIYAAGDCIGAPALASTSMEQGRLASCHM  344

Query  501  FGNGTTLMDYTKICT-----AVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWS  555
            +     L   +++ +      ++T  E    G +E+         N E+    ++  E +
Sbjct  345  WKPDEELAVTSQLESGNYPYGIYTIPEISMVGQTEQQLTKDC--VNYEIGVAKYS--ELA  400

Query  556  LSHDRPLAKECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVG  615
                         K++ D    K V G H +G  A E+     +A+ ++ +   F + V 
Sbjct  401  KGQMMGAMAGGTLKILFDPDTLK-VFGVHAIGEGATEIIHIGQVAMAMDCSLTYFRDAVF  459

Query  616  IHPTTAEIF  624
             +PT AE +
Sbjct  460  NYPTLAEAY  468

>PYU1_G011605
Length=524

 Score = 112 bits (279),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 126/494 (26%), Positives = 214/494 (43%), Gaps = 61/494 (12%)

Query  164  DWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMH  223
            D+DLVVIG G     C+ E++K G++V ++D            +GG CV+ G IP K   
Sbjct  40   DYDLVVIGSGPSATQCAIESAKQGKRVAIVD--------KKTSVGGVCVHTGTIPSKTFR  91

Query  224  QSSIIGEILHKDADQ----FGWSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKY  279
            ++     +LH    +    +G S S  T     ++  V+  ++      +  L+  +V+Y
Sbjct  92   EA-----VLHLSGYRHHGFYGKSYSMKTVTIDDILYRVKRVVNSEVDVIKAQLKAARVEY  146

Query  280  ENMLGTFKDAHTLTL-----TNDAKKKGPTDVTFRRA-----VIAVGGRP--KPLSCPGW  327
                  F++ H +++     T ++++ G    T  R      +IA G RP   P      
Sbjct  147  IPGFARFENDHEISIVRDPETGESQEAGEITNTVSRLRADKFLIACGTRPAHNPNVPIDG  206

Query  328  EHALSSDDIFSKP--DAPGKTLVVGASYVALECAGFLKG-QGFDVTIM-VRSILLRGFDQ  383
            +    SD I S    D P   +VVGA  + +E A  L    G  VT++  R  +L   D 
Sbjct  207  KVIFDSDQILSGDIRDLPRSLIVVGAGVIGIEYASMLNVIPGHSVTVIDARPEILSFCDN  266

Query  384  DIARRIGEYMESESGIAFIKESVPTSIVKLENGQFQVTHTTGQDVYDTILNATGRSPDVQ  443
            +I   +   M S+     + E++   + K  NG     ++      D +L   GR     
Sbjct  267  EIISNLTYEMRSKGARFLLGETI-NRVEKTGNGVTVYLNSGKVTSADAMLYTVGRQASTD  325

Query  444  KLNLDAAGVALNPKSGRIHVVNE-QTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLFG  502
             LNL+A  ++ NP+ G ++V    QT  P+IYA+GD I AP L   +++ G+L +  ++ 
Sbjct  326  GLNLEAVNLSRNPR-GLLNVNKSYQTGQPHIYAVGDCIGAPSLASTSMEQGRLAACHMWD  384

Query  503  NG----TTLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSH  558
                  T+ ++       ++T  E    G +E+       +E V     NF   E  ++ 
Sbjct  385  QEEQLVTSQLENGNYPYGIYTIPEISMVGKTEQQLT----KEGV-----NF---EIGIAK  432

Query  559  DRPLAKECYA--------KLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDF  610
               LAK   +        K++ D T  K + G H +G  A E+     +AI +  +   F
Sbjct  433  YSELAKGQMSGSTAGGMLKILFDPTTLK-LFGVHAIGEGATEIIHIGQVAIAMGCSVTYF  491

Query  611  INTVGIHPTTAEIF  624
             + V  +PT AE +
Sbjct  492  RDAVFNYPTLAEAY  505

>PYVX_20512
Length=528

 Score = 112 bits (279),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 127/488 (26%), Positives = 206/488 (42%), Gaps = 44/488 (9%)

Query  164  DWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMH  223
            D+DLVVIG G     C+ E++K G++V ++D  K + VG      G CV+ G IP K   
Sbjct  37   DYDLVVIGSGPSATQCAMESAKQGKRVAIVD--KRTRVG------GVCVHTGTIPSKTFR  88

Query  224  QSSI-IGEILHKDADQFGWSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYENM  282
            ++ + +    H       +S+ N T D   ++  VQ  +       +  L+  +V Y   
Sbjct  89   EAVLHLSGYRHHGFYGKSYSMKNITID--DILYRVQRVVASEVDVIKAQLKAARVDYIAG  146

Query  283  LGTFKDAHTLTLTNDAKKKGP--TDVTFR------------RAVIAVGGRP--KPLSCPG  326
              +F+  H L+++ D+    P   DV  R            + +IA G RP   PL    
Sbjct  147  TASFESPHELSISMDSTDSDPDLADVLDRADGLAPSRLRADKFLIACGTRPAHNPLVPVD  206

Query  327  WEHALSSDDIFSKP--DAPGKTLVVGASYVALECAGFLKG-QGFDVTIM-VRSILLRGFD  382
             +    SD I S      P   +VVGA  + +E A  +    G  VT++  R  +L   D
Sbjct  207  GKVVFDSDQILSGQIHQLPRSLIVVGAGVIGIEYASMVNVVPGHSVTVVDGRPDILSFCD  266

Query  383  QDIARRIGEYMESESGIAFIKESVPTSIVKLENGQFQVTHTTGQ-DVYDTILNATGRSPD  441
             +I   +   M S+     + E++  SI K E G  +V   +G+    D +L   GR   
Sbjct  267  TEIISNLMYEMRSKGARFLLGETI-KSIEKSERG-VKVFFNSGKVATADALLYTVGRQAS  324

Query  442  VQKLNLDAAGVALNPKSGRIHVVNEQTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLF  501
               LNL+A G++ NP+       N QT   +IYA GD I AP L   +++ G+L +  ++
Sbjct  325  TDGLNLEAVGLSRNPRGLLTVNKNYQTDQAHIYAAGDCIGAPALASTSMEQGRLAACHMW  384

Query  502  GN-----GTTLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSL  556
             +      T+ +D       ++T  E    G +E+         N EV    ++ L    
Sbjct  385  DDQAQLQSTSQLDNGNYPYGIYTIPEISMVGKTEQQLTKEG--VNYEVGIAKYSELAKGQ  442

Query  557  SHDRPLAKECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGI  616
                            D+ +   + G H +G  A E+     +AI +  +   F N V  
Sbjct  443  MTGAIAGGMLKILFCPDSLE---LFGVHAIGEGATEIIHIGQVAIAMGCSLTYFRNAVFN  499

Query  617  HPTTAEIF  624
            +PT AE +
Sbjct  500  YPTLAEAY  507

>CCA16670
Length=520

 Score = 111 bits (278),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 124/484 (26%), Positives = 220/484 (45%), Gaps = 47/484 (10%)

Query  165  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  224
            +DL+VIG G     C+ +A+K G+ V ++D  K S VG      G CV+ G IP K   +
Sbjct  30   YDLIVIGSGPSASNCALDAAKRGKHVAIID--KKSSVG------GVCVHTGTIPSKTFRE  81

Query  225  SSI-IGEILHKDADQFGWSVSNATFD-----WSKLVSSVQDYIHGLNFKYRVDLRDKKVK  278
            + + +    H       +S+ + T D      ++++ S  D++       R   +  ++ 
Sbjct  82   AVLHLSGYRHHGFYGKSYSMKHVTIDDILYRVNRVIQSEVDFL-------RTQFKSARID  134

Query  279  YENMLGTFKDAHTLTLTND---AKKKGPTDVTFRRAVIAVGGRP--KPLSCPGWEHALSS  333
            Y +    F+D H +++      A +K    +   + ++A G RP   P      +    S
Sbjct  135  YISGHARFEDDHQVSIIEADGPAHEKTTKRLRASKFLVACGTRPAHNPNIPIDGKVIFDS  194

Query  334  DDIFS--KPDAPGKTLVVGASYVALECAGFLKG-QGFDVTIM-VRSILLRGFDQDIARRI  389
            D I S      P   +VVGA  + +E A  L   +G  VT++  R  +L   D +I   +
Sbjct  195  DQILSWNIRQLPRSLIVVGAGVIGMEYASMLNVIRGHSVTVIDGREEILSFCDDEIISTL  254

Query  390  GEYMESESGIAFIKESVPTSIVKLENGQFQVTHTTGQDVY-DTILNATGRSPDVQKLNLD  448
               M +  G  F+   +  S+ K   G   V   +G+ V+ D +L   GR  +   LNL+
Sbjct  255  THEMRNH-GARFLLGEIIESVEKSSRG-VSVGLKSGKKVHGDALLYVVGRQANTDGLNLE  312

Query  449  AAGVALNPKSGRIHVVNE-QTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLFGNGTTL  507
            AAG++ NP+ G + V  + QT  P+I+A+GD I AP L   +++ G+L S  ++      
Sbjct  313  AAGLSRNPR-GLLSVNTKYQTKKPHIFAVGDCIGAPSLASTSMEQGRLASCYMWNENEAN  371

Query  508  MDY--TKICT-----AVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDR  560
             D   +++ T      ++T  E    G +E++   ++ + N E+    ++  E +     
Sbjct  372  DDSIPSQLTTGNFPYGIYTIPEISMVGKTEKE--LTSLKMNYEIGVAKYS--ELAKGQMS  427

Query  561  PLAKECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTT  620
              + +   K++ D    K + G H +G  A E+     +AI + AT   F + V  +PT 
Sbjct  428  GASADGMLKILFDPISLK-LYGVHAIGEGATEIIHIGQVAIAMGATLTYFRDAVFNYPTL  486

Query  621  AEIF  624
            AE +
Sbjct  487  AEAY  490

>PYIW_25190
Length=206

 Score = 104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 97/185 (52%), Gaps = 4/185 (2%)

Query  445  LNLDAAGVALNPKSGRIHVVNEQTSTPNIYALGDV-IDAPELTPVAIQAGKLLSRRLFGN  503
            L L+A GV LN     +    E TS   IYA+GD  I   ELTPVAI AG+ L+ RLFG 
Sbjct  2    LGLEAVGVKLNDAGFIVVDAQENTSVSGIYAIGDATITGWELTPVAIAAGRRLADRLFGG  61

Query  504  GT-TLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPL  562
                L+ Y +I T VF+    G  G +E  AI   G  NV+ Y   F  L  +++   P 
Sbjct  62   EPDALLHYHQIPTVVFSHPPLGTIGYTEPQAIEKFGAANVKSYTSKFVNLLHAMA--DPD  119

Query  563  AKECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAE  622
             K   A  +V   + + V+G H  G  A E+ Q  G+A+K+NAT  DF N V IHPT +E
Sbjct  120  HKGKTAMKLVTVGEDEVVVGVHVAGEGADEMIQGFGVAMKMNATKADFDNIVAIHPTASE  179

Query  623  IFTTL  627
               T+
Sbjct  180  ELVTM  184

>PYIW_19795
Length=519

 Score = 110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 121/483 (25%), Positives = 205/483 (42%), Gaps = 42/483 (9%)

Query  165  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  224
            +DLVVIG G     C+ E++K G++V V+D         T+ +GG CV+ G IP K   +
Sbjct  37   YDLVVIGSGPSATQCAIESAKKGKRVAVVDK-------KTF-VGGVCVHTGTIPSKTFRE  88

Query  225  SSIIGEILHKDADQ----FGWSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYE  280
            +     +LH    +    +G S S  T     ++  V+  ++      +  L+  +V+Y 
Sbjct  89   A-----VLHLSGYRHHGFYGKSYSMKTVTIDDILYRVKRVVNSEVDVIKAQLKAARVEYI  143

Query  281  NMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAV---------IAVGGRP--KPLSCPGWEH  329
              L  F+  H +++  DA     +D      V         IA G RP   PL     + 
Sbjct  144  PGLARFEGDHEISIVRDAADAEASDGEIANTVSRLHADKFLIACGTRPAHNPLVPIDGKV  203

Query  330  ALSSDDIFSKP--DAPGKTLVVGASYVALECAGFLKG-QGFDVTIM-VRSILLRGFDQDI  385
               SD I S    + P   +VVGA  + +E A  L    G  VT++  R  +L   D +I
Sbjct  204  IFDSDQILSGDIRELPRSLIVVGAGVIGMEYASMLNVIPGHSVTVVDGRPEILSFCDNEI  263

Query  386  ARRIGEYMESESGIAFIKESVPTSIVKLENGQFQVTHTTGQDVYDTILNATGRSPDVQKL  445
               +   M S+     + E++   + K E+G     ++      D +L   GR      L
Sbjct  264  ISNLTYEMRSKGARFLLGETIK-QVEKTEDGVTVHFNSGKTATADALLYTVGRQASTDGL  322

Query  446  NLDAAGVALNPKSGRIHVVNEQTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLFGNG-  504
            NL+A  +A NP+       + QT+  +IYA GD I AP L   +++ G+L +  ++    
Sbjct  323  NLEAVNLARNPRGLLTVNTSYQTNQSHIYAAGDCIGAPSLASTSMEQGRLAACHMWDQEE  382

Query  505  ---TTLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRP  561
               T+ ++       ++T  E    G +E+         N E+    ++  E +      
Sbjct  383  QLVTSQLENGNYPYGIYTIPEISMVGKTEQQLTKEGA--NYEIGIAKYS--ELAKGQMSG  438

Query  562  LAKECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTA  621
                   K++ D T  K +LG H +G  A E+     +A+ +  +   F + V  +PT A
Sbjct  439  STAGGMLKILFDPTTLK-LLGVHAIGEGATEIIHIGQVAMAMGCSVTYFRDAVFNYPTLA  497

Query  622  EIF  624
            E +
Sbjct  498  EAY  500

>PHYRA_72215
Length=499

 Score = 109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 118/442 (27%), Positives = 193/442 (44%), Gaps = 27/442 (6%)

Query  197  KPSPVGSTWGLGGTCVNVGCIPKK-LMHQSSIIGEILHKDADQFGWSVSNATFDWSKLVS  255
            K + V S   LGGTC+NVGCIP K L+H + ++    H D   +G      T ++ +++ 
Sbjct  57   KTACVESRGKLGGTCLNVGCIPSKALLHSTHLLHTAQH-DFKSYGIDAPGVTANFPQMMK  115

Query  256  SVQDYIHGLNFKYRVDLRDKKVKYENMLGTFKDAHTLTLT-NDAKKKGPTDVTFRRAVIA  314
            + +  +  L        +  KV Y    G       +++  ND   KG   V  +  +IA
Sbjct  116  AKEKAVTTLTGGIESLFKKNKVTYIKGYGKVSAQGEVSVALND--NKGNETVKAKNIIIA  173

Query  315  VGGRPKPLSCPGWEHA----LSSDDIFSKPDAPGKTLVVGASYVALECAGFLKGQGFDVT  370
             G    PL     ++A    + S    +    P   +VVGA  + LE     K  G  VT
Sbjct  174  TGSEVTPLPPVPVDNAAGKIIDSTGALALTRVPEHLVVVGAGVIGLELGSVYKRLGSKVT  233

Query  371  IM-VRSILLRGFDQDIARRIGEYMESES-----GIAFIKESVPTSIVKLENGQFQVTHTT  424
            ++  +     G D++  +   + ++ +      G       V   +VKL     +  +  
Sbjct  234  VVEFQDAACPGMDKEAVKEFTKLLKKQGLDFKFGTKVTASEVNGDVVKLTTEAAKGGNAA  293

Query  425  GQDVYDTILNATGRSPDVQKLNLDAAGVALNPKSGRIHVVNE-QTSTPNIYALGDVIDAP  483
              +  DT+L ATGR      L L+  G+  + K GRI V +  +T  P I+A+GDVI   
Sbjct  294  TIEC-DTVLVATGRRAFTAGLGLEQMGIQTD-KLGRIEVDDAFRTQVPGIFAIGDVIKGA  351

Query  484  ELTPVAIQAGKLLSRRLFGNGTTLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVE  543
             L   A + G      + G    + +Y  I   ++T  E+   G +EE+  A    E +E
Sbjct  352  MLAHKAEEEGIACVENIAGKHGHV-NYGAIPGVIYTFPEFASVGKTEEELKA----EGIE  406

Query  544  VYHQNFTPLEWSLSHDRPLAK-ECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIK  602
             Y+    P+  + S  R +A+ +   K++ D    K +LG H +  NAGE+     IA++
Sbjct  407  -YNVGKFPM-MANSRARTVAEADGLVKVLADKKTDK-MLGVHIIASNAGEMISEGVIALE  463

Query  603  LNATYDDFINTVGIHPTTAEIF  624
              A+ +D   T   HPT +E F
Sbjct  464  YGASSEDIARTCHAHPTLSEAF  485

>PPTG_09121
Length=520

 Score = 109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 124/492 (25%), Positives = 211/492 (43%), Gaps = 53/492 (11%)

Query  165  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  224
            +DLVVIG G     C+ E++K G++V ++D            LGG CV+ G IP K   +
Sbjct  32   YDLVVIGSGPSATQCALESAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFRE  83

Query  225  SSIIGEILHKDADQ----FGWSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYE  280
            +     +LH    +    +G S S  T     ++  VQ  +       R  L+  +V   
Sbjct  84   A-----VLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDVV  138

Query  281  NMLGTFKDAHTLTLT---NDAKKKGP------------TDVTFRRAVIAVGGRP--KPLS  323
                 F++ H +++    ND KKK              + +   + +IA G RP   PL 
Sbjct  139  PGFARFENEHEISIVRDDNDQKKKNGAVSGSSSNLDSLSRIRADKFLIACGTRPAHNPLI  198

Query  324  CPGWEHALSSDDIFSKP--DAPGKTLVVGASYVALECAGFLKG-QGFDVTIM-VRSILLR  379
                +  + SD I S+     P   +V+GA  + +E A  +    G  VT++  R  +L 
Sbjct  199  PIDGKVVIDSDQILSRDMHQLPRSLIVLGAGVIGMEYASMVNVVPGHTVTVVDGRPDILS  258

Query  380  GFDQDIARRIGEYMESESGIAFIKESVPTSIVKLENGQFQVTHTTGQDV-YDTILNATGR  438
              D +I   +   M+S      + E+V    V+  + + +V   +G+ +  D +L   GR
Sbjct  259  FCDSEIISNLTYEMQSNGARFLLGETVKK--VETTDKRVKVFFNSGKVLSADALLYTVGR  316

Query  439  SPDVQKLNLDAAGVALNPKSGRIHV-VNEQTSTPNIYALGDVIDAPELTPVAIQAGKLLS  497
                  LNL+A G++ N + G I+V  N QT  P+IYA GD I AP L   +++ G+L S
Sbjct  317  QAATDGLNLEAVGLSRNHR-GLINVNKNYQTDQPHIYAAGDCIGAPALASTSMEQGRLAS  375

Query  498  RRLFG-----NGTTLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPL  552
              ++        T+ ++       ++T  E    G +E+         N E+    ++  
Sbjct  376  CHMWNPDEELAATSQLENGNYPYGIYTIPEISMVGQTEQQLTKDC--VNYEIGIAKYS--  431

Query  553  EWSLSHDRPLAKECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFIN  612
            E +             K++ D    K V G H +G  A E+     +A+ ++ +   F +
Sbjct  432  ELAKGQMMGAMAGGTLKILFDPDTLK-VFGVHAIGEGATEIIHIGQVAMAMDCSLTYFRD  490

Query  613  TVGIHPTTAEIF  624
             V  +PT AE +
Sbjct  491  AVFNYPTLAEAY  502

>PHALS_10055
Length=516

 Score = 108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 124/492 (25%), Positives = 214/492 (43%), Gaps = 55/492 (11%)

Query  164  DWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMH  223
            ++DL+VIG G     C+ E++K G++V ++D            LGG CV+ G IP K   
Sbjct  31   NYDLLVIGSGPSATQCAIESAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFR  82

Query  224  QSSIIGEILHKDADQ----FGWSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKY  279
            ++     +LH    +    +G S S  T     ++  VQ  +       R  L+  +V  
Sbjct  83   EA-----VLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDV  137

Query  280  ENMLGTFKDAHTLTLTNDAKKKGPTDVT------FRRA-----VIAVGGRP--KPLSCPG  326
                  F++ H +++  D   +   +++        RA     +IA G RP   PL    
Sbjct  138  IPGFARFENEHEISILRDVDTQTKKEISASSVDSLSRAKADKFLIACGTRPAHNPLIPID  197

Query  327  WEHALSSDDIFSKPD--APGKTLVVGASYVALECAGFLKG-QGFDVTIM-VRSILLRGFD  382
             +  + SD I S+     P   +V+GA  + +E A  +    G  VT++  R  +L   D
Sbjct  198  GKVVIDSDQILSRDMHLLPRSLIVMGAGVIGMEYASMVNVVPGHSVTVVDSRPDILPFCD  257

Query  383  QDIARRIGEYMESESGIAFIKESVPTSIVKLENGQFQVTHTTGQDV-YDTILNATGRSPD  441
             +I   +   M+S      + E+V    V+    Q +V   +G+ +  D +L   GR   
Sbjct  258  LEIISNLTYEMQSNGARFLLGETVKK--VETTKNQVKVFFNSGKVLSADALLYTVGRQAA  315

Query  442  VQKLNLDAAGVALNPKSGRIHV-VNEQTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRL  500
               LNL+A G++ N + G I+V  N QT  P+IYA GD I AP L   +++ G+L S  +
Sbjct  316  TDGLNLEAVGLSRNHR-GLINVNKNYQTDRPHIYAAGDCIGAPALASTSMEQGRLASCHM  374

Query  501  FGNGTTLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDR  560
            +     L   +++ +  +    YG   + E   I+  G+   ++  +N    E  ++   
Sbjct  375  WKPNEELAATSQLESGNY---PYGIYTIPE---ISMVGQTEQQLT-KNCINYEIGIAKYS  427

Query  561  PLAKECYA--------KLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFIN  612
             LAK            K++ D  +   +LG H +G  A E      +A+ +  +   F +
Sbjct  428  ELAKGQMMGAMAGGTLKILFD-PETLSLLGVHAIGEGATETIHIGQVAMAMGCSLTYFRD  486

Query  613  TVGIHPTTAEIF  624
             V  +PT AE +
Sbjct  487  AVFNYPTLAEAY  498

>PYIR_14132
Length=513

 Score = 108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 128/499 (26%), Positives = 208/499 (42%), Gaps = 51/499 (10%)

Query  165  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  224
            +DL+VIG G  G  C+ + +K G+ V V+D            LGG C++ G +P K   +
Sbjct  11   FDLIVIGSGPAGQKCAVDHAKHGKSVAVID--------KRDMLGGVCIHTGTVPSKTFRE  62

Query  225  SSIIGEILHKDADQFGWSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYENMLG  284
            +++        +   G S     F    ++  V+   H      R  L    ++  N   
Sbjct  63   ATLHLTAYRHRSFYDGQSNPTKRFGIEDILQRVKKVEHAETDITRHQLLRNNIELINGTA  122

Query  285  TF-KDA----------HTLTLTNDAKKKGPTDVTFR-----RAVIAVGGRP--KPLSCPG  326
             F  DA           + T   DAK+    D+  R     + +IAVG RP  +P     
Sbjct  123  RFLPDAGKKMVAVLSNDSYTTATDAKRHSSADICKRVLTADKFLIAVGTRPARRPDIPFD  182

Query  327  WEHALSSDDIF--SKPDAPGKTLVVGASYVALECAGFLKG-QGFDVTIM-VRSILLRGFD  382
             +    SD +        P + +VVGA  + +E A  +    G +VTI+  R  +L   D
Sbjct  183  GQTIFDSDQLLWGGVKSVPKRLIVVGAGVIGMEYASMMSIIPGMEVTIIDGRKEILDMAD  242

Query  383  QDIARRIGEYMESESGIAFIKESVPTSIVKLENGQFQVTHTTGQD-VYDTILNATGRSPD  441
            ++++  +  Y   ++G  F  E    S+ K +NG+  V   +G+  V D +L   GR  +
Sbjct  243  REVSEALC-YSMRQTGARFFVEETIKSVEKADNGEVIVHLNSGKTLVGDGLLYTLGRQGN  301

Query  442  VQKLNLDAAGVALNPKSGRIHVVNE-QTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRL  500
             + LNL A G+  + K G I V ++ QT  P+IYA GD I  P L   +++ G+L S  +
Sbjct  302  TEGLNLAAVGLEAD-KRGLIQVDDDFQTDVPHIYAAGDCIGFPALASTSMEQGRLASVHM  360

Query  501  F--------GNGTTLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPL  552
                     G   T     +         E    G+     I+  G+   ++  QN  P 
Sbjct  361  RTSKPTNKKGESETESTDPQYMRTRMRSGEVFPFGIYTVPEISMVGKNEQQLTSQNI-PY  419

Query  553  EWSLSHDRPLAK-------ECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNA  605
            E  ++    LAK         + K+I    +  +VLG H +G  A E+     + +    
Sbjct  420  EVGVARYEELAKGQMLGGVPGFLKIIF-CPKTLQVLGVHAIGEGATEIIHIGQVVMSTGG  478

Query  606  TYDDFINTVGIHPTTAEIF  624
            T + F N V  +PT AE +
Sbjct  479  TIEYFRNAVFNYPTLAEAY  497

>PHYSO_556052
Length=500

 Score = 107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 120/443 (27%), Positives = 192/443 (43%), Gaps = 27/443 (6%)

Query  196  VKPSPVGSTWGLGGTCVNVGCIPKK-LMHQSSIIGEILHKDADQFGWSVSNATFDWSKLV  254
            +K + + S   LGGTC+NVGCIP K L+H + ++    H D   +G        ++ +++
Sbjct  57   LKTACIESRGKLGGTCLNVGCIPSKALLHSTHLLHTAQH-DFKSYGIDAPEVKANFPQMM  115

Query  255  SSVQDYIHGLNFKYRVDLRDKKVKYENMLGTFKDAHTLTLT-NDAKKKGPTDVTFRRAVI  313
             + +  +  L        +  KV Y    G       +++  ND   KG   V  +  +I
Sbjct  116  KAKEKAVKTLTGGIESLFKKNKVTYIKGFGKVSAQGEVSVALND--NKGNETVKAKNIII  173

Query  314  AVGGRPKPL-SCPGWEHA---LSSDDIFSKPDAPGKTLVVGASYVALECAGFLKGQGFDV  369
            A G    PL   P    A   + S    S    P   +VVGA  + LE     K  G  V
Sbjct  174  ATGSEVTPLPPVPVDNEAGKIIDSTGALSLKRVPEHLVVVGAGVIGLELGSVYKRLGSKV  233

Query  370  TIM-VRSILLRGFDQDIARRIGEYMESESGIAF-IKESVPTSIVKLENGQFQVTHTTGQD  427
            T++  +     G D++  +   + ++ + G+ F     V  S V  +  +     + G D
Sbjct  234  TVVEFQDAACPGMDKESVKEFTKLLKKQ-GLEFQFGTKVTASEVNGDVVKLTTEPSKGGD  292

Query  428  VY----DTILNATGRSPDVQKLNLDAAGVALNPKSGRIHVVNE-QTSTPNIYALGDVIDA  482
                  DT+L ATGR      L L+  G+  + K GRI V +  +T  P I+A+GDVI  
Sbjct  293  ASTIECDTVLVATGRRAFTAGLGLEQMGIQTD-KLGRIEVDDAFRTQVPGIFAIGDVIKG  351

Query  483  PELTPVAIQAGKLLSRRLFGNGTTLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENV  542
              L   A + G      + G    + +Y  I   ++T  E+   G +EE+  A    E +
Sbjct  352  AMLAHKAEEEGVACVENIAGKHGHV-NYGAIPGVIYTFPEFASVGKTEEELKA----EGI  406

Query  543  EVYHQNFTPLEWSLSHDRPLAK-ECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAI  601
            E Y+    P+  + S  R +A+ +   K++ D    K +LG H +  NAGE+     I I
Sbjct  407  E-YNVGKFPM-MANSRARTVAESDGLVKVLADKKTDK-LLGVHIIASNAGEMIAEGVIGI  463

Query  602  KLNATYDDFINTVGIHPTTAEIF  624
            +  A  +D   T   HPT +E F
Sbjct  464  EYGAASEDLARTCHAHPTLSEAF  486

>PPTG_00938
Length=550

 Score = 107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 132/502 (26%), Positives = 222/502 (44%), Gaps = 57/502 (11%)

Query  165  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  224
            +DL+VIG G  G  C+ +++K G+ V ++D            LGG CV+ G +P K   +
Sbjct  48   FDLIVIGSGPAGQKCAIDSAKHGKSVAIID--------KRDMLGGVCVHTGTVPSKTFRE  99

Query  225  SSI-IGEILHKD--ADQFGWSVSNATFDWSKLVSSVQ----DYIHGLNFKYRVDLRDKKV  277
            +++ +    HK     Q G S      D  + V  V+    D       +  V L +   
Sbjct  100  AALHLTGYRHKAFYNGQAGPSKRFGVEDILQRVRKVENAETDITRHQLLRNGVQLINGTA  159

Query  278  KY----ENMLGTFKDAHTLTLTNDAKKKGPTDVTFR-----RAVIAVGGRP--KPLSCPG  326
            ++    +NM+    +    T T DAK+    D+  R     + ++ VG RP  +P     
Sbjct  160  RFLPGSKNMVAVLSNESYETAT-DAKRHSSADICKRVLTADKFLVCVGTRPARRPDIPFD  218

Query  327  WEHALSSDDIF--SKPDAPGKTLVVGASYVALECAGFLKG-QGFDVTIM-VRSILLRGFD  382
             E    SD++        P + ++VGA  V +E A  +    G DVT++  R  +L   D
Sbjct  219  GETIFDSDELLWGKVKSVPRRLIIVGAGVVGMEYASMMTIIPGTDVTVIDGRQEILNMAD  278

Query  383  QDIARRIGEYMESESGIAFIKESVPTSIVKLENGQFQVTHTTGQDVY-DTILNATGRSPD  441
            + ++  +  Y  +++G  F+      S+ K   G+  V   +G+ V  D +L   GR  +
Sbjct  279  KQVSEALC-YSMTQTGTRFLTGETIKSVEKSPKGEVFVHLESGKTVVGDGLLYTVGRQGN  337

Query  442  VQKLNLDAAGVALNPKSGRIHVVNE-QTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRL  500
            V+ LNL+A G++ + K GRI V N  QT+ P+IYA GD+I  P L   +++ G+L S  +
Sbjct  338  VEGLNLEAVGLSPD-KRGRIKVDNNFQTAVPHIYAAGDIIGFPGLASTSMEQGRLASVHM  396

Query  501  FG----NGTTLMDYTKI--CTAVFTPVEYGCC---GLSEEDAIASAGRENVEVYHQNFTP  551
                  N   L D  K+     V T +  G     G+     I+  G+   ++  +   P
Sbjct  397  RTSKPLNDLELSDDKKMDDPDRVRTRMRSGEVFPFGIYTVPEISMVGKNEQQLTKEQ-VP  455

Query  552  LEWSLSHDRPLAK-------ECYAKLIV--DTTQQKRVLGFHYLGPNAGEVTQAIGIAIK  602
             E  ++    LA+         + K+I   DT    ++ G H +G  A E+     + + 
Sbjct  456  YEVGVARYEELARGQMLGGVPGFLKIIFCPDTL---KIFGVHAIGEGATEIIHIGQVVMS  512

Query  603  LNATYDDFINTVGIHPTTAEIF  624
               T + F N V  +PT AE +
Sbjct  513  TGGTLEYFRNAVFNYPTLAEAY  534

>PYAR_16840
Length=536

 Score = 107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 124/504 (25%), Positives = 212/504 (42%), Gaps = 67/504 (13%)

Query  165  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  224
            +DLVVIG G     C+ E+++ G++V V+D        +  G+GG CV+ G IP K   +
Sbjct  37   YDLVVIGSGPSATQCAVESARHGKRVAVVD--------TRGGVGGVCVHTGTIPSKTFRE  88

Query  225  SSIIGEILHKDADQ----FGWSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYE  280
            +     +LH    +    +G S S  T     ++  V+  +       +  L+  ++ Y 
Sbjct  89   A-----VLHLSGYRHHGFYGKSYSMKTVTIDDILYRVKRVVDSEVDVIKAQLKAARIDYL  143

Query  281  NMLGTFKDAHTLTLTNDAKKKGPTDVTFRRA-----VIAVGGRP--KPLSCPGWEHALSS  333
              L  F++ H +++ +D    G    +  R      +IA G RP   PL     +  L S
Sbjct  144  PGLARFENEHEISIQSDITAGGQDASSVSRVQADKFLIACGTRPAHNPLVPVDGKVILDS  203

Query  334  DDIFSKP--DAPGKTLVVGASYVALECAGFLKG-QGFDVTIM-----VRSIL--------  377
            D I S    + P   +VVGA  + +E A  L    G  VT++     VR++L        
Sbjct  204  DQILSGALRELPRSLIVVGAGVIGMEYASMLNVVPGHSVTVIDGRNDVRNLLTSRDMSLR  263

Query  378  ----------LRGFDQDIARRIGEYMESESGIAFIKESVPTSIVKLENGQFQVTHTTGQD  427
                      +  F  D    + +Y     G  F+       + K   G  +V  T+G+ 
Sbjct  264  PQGICPFLWQILSFCDDEIVSMLKYEMRVKGARFLLGETIEKVEKTATG-VKVFLTSGKV  322

Query  428  VY-DTILNATGRSPDVQKLNLDAAGVALNPKSGRIHVVNE--QTSTPNIYALGDVIDAPE  484
               D +L   GR      LNL+A G+  N +   +  VN+  QT  P+IYA+GD I AP 
Sbjct  323  TSGDALLYTVGRQASTDGLNLEAVGLGRNKRG--LLTVNKAYQTEKPHIYAVGDCIGAPS  380

Query  485  LTPVAIQAGKLLSRRLFGNG---TTLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGREN  541
            L   +++ G+L +  ++      T+ ++       ++T  E    G +E+   +   + N
Sbjct  381  LASTSMEQGRLAACHMWEKRELVTSQLENGNYPYGIYTIPEISMVGKTEQQLTSE--KVN  438

Query  542  VEVYHQNFTPLEWSLSHDRPLAKECYAKL-IVDTTQQKRVLGFHYLGPNAGEVTQAIGIA  600
             E+    ++ L         ++   +  L I+      RV G H +G  A E+     +A
Sbjct  439  YEIGLAKYSELAKG-----QMSGGAFGMLKILFDPDTLRVHGVHAIGEGATEIIHIGQVA  493

Query  601  IKLNATYDDFINTVGIHPTTAEIF  624
            I +  +   F + V  +PT AE +
Sbjct  494  IAMGCSLTYFRDAVFNYPTLAEAY  517

>PHYCA_123621
Length=495

 Score = 107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 123/457 (27%), Positives = 196/457 (43%), Gaps = 35/457 (8%)

Query  182  EASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKK-LMHQSSIIGEILHKDADQFG  240
            +A++LG K   ++        S   LGGTC+NVGCIP K L+H + ++    H D   +G
Sbjct  46   KAAQLGMKTACIE--------SRGKLGGTCLNVGCIPSKALLHSTHLLHTAQH-DFKSYG  96

Query  241  WSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYENMLGTFKDAHTLTLT-NDAK  299
                    ++ +++ + +  +  L        +  KV Y    G       +++  ND  
Sbjct  97   IDAPEVKANFPQMMKAKEKAVTTLTGGIESLFKKNKVTYIKGFGKVSAQGEVSVALND--  154

Query  300  KKGPTDVTFRRAVIAVGGRPKPLSCPGWEHA----LSSDDIFSKPDAPGKTLVVGASYVA  355
             KG   V  +  +IA G    PL     ++A    + S    S    P   +VVGA  + 
Sbjct  155  NKGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKIIDSTGALSLTRVPEHLVVVGAGVIG  214

Query  356  LECAGFLKGQGFDVTIM-VRSILLRGFDQDIARRIGEYMESESGIAF-IKESVPTSIVKL  413
            LE     K  G  VT++        G D+   +   + ++ + G+ F     V  S V  
Sbjct  215  LELGSVYKRLGSKVTVVEYLDAACPGMDKGAVKEFTKLLKKQ-GLDFKFSTKVTASEVNG  273

Query  414  ENGQFQVTHTTGQDVY----DTILNATGRSPDVQKLNLDAAGVALNPKSGRIHVVNE-QT  468
            +  +     + G D      DT+L ATGR      L L+  G+  + K GRI V +  +T
Sbjct  274  DVVKLTTEPSKGGDASSIECDTVLVATGRRAFTAGLGLEQMGIQTD-KLGRIEVDDAFRT  332

Query  469  STPNIYALGDVIDAPELTPVAIQAGKLLSRRLFGNGTTLMDYTKICTAVFTPVEYGCCGL  528
              P I+A+GDVI    L   A + G      + G    + +Y  I   ++T  E+   G 
Sbjct  333  QVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAGKHGHV-NYGAIPGVIYTFPEFASVGK  391

Query  529  SEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAK-ECYAKLIVDTTQQKRVLGFHYLG  587
            +EE+  A    E VE Y+    P+  + S  R +A+ +   K++ D    K +LG H + 
Sbjct  392  TEEELKA----EGVE-YNVGKFPM-MANSRARTVAEADGLVKVLADKKTDK-LLGVHIIA  444

Query  588  PNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIF  624
             NAGE+     I I+  A  +D   T   HPT +E F
Sbjct  445  SNAGEMISEGVIGIEYGAASEDLARTCHAHPTLSEAF  481

>PITG_15359
Length=496

 Score = 106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 122/457 (27%), Positives = 196/457 (43%), Gaps = 35/457 (8%)

Query  182  EASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKK-LMHQSSIIGEILHKDADQFG  240
            +A++LG K   ++        S   LGGTC+NVGCIP K L+H + ++    H D   +G
Sbjct  47   KAAQLGMKTACIE--------SRGKLGGTCLNVGCIPSKALLHSTHLLHTAQH-DFKSYG  97

Query  241  WSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYENMLGTFKDAHTLTLT-NDAK  299
                    ++ +++ S +  +  L        +  KV Y    G       +++  ND  
Sbjct  98   IDAPEVKANFPQMMKSKEKAVKTLTGGIESLFKKNKVTYIKGHGKISAQGEISVALND--  155

Query  300  KKGPTDVTFRRAVIAVGGRPKPLSCPGWEHA----LSSDDIFSKPDAPGKTLVVGASYVA  355
             KG   V  +  +IA G    PL     ++A    + S         P   +VVGA  + 
Sbjct  156  NKGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKIIDSTGALELKRVPEHLVVVGAGVIG  215

Query  356  LECAGFLKGQGFDVTIM-VRSILLRGFDQDIARRIGEYMESESGIAF-IKESVPTSIVKL  413
            LE     K  G  VT++        G D++  +   + ++ + G+ F     V  S V  
Sbjct  216  LELGSVYKRLGAKVTVVEFLDAACPGSDKEAVKEFTKLLKKQ-GLDFQFNTKVTASEVNG  274

Query  414  ENGQFQVTHTTGQDVY----DTILNATGRSPDVQKLNLDAAGVALNPKSGRIHVVNE-QT  468
            +  +     + G D      DT+L ATGR      L L+  G+  + K GRI V +  +T
Sbjct  275  DVVKLTTEPSKGGDASSIECDTVLVATGRRAFTSGLGLEQMGIQTD-KLGRIEVDDAFRT  333

Query  469  STPNIYALGDVIDAPELTPVAIQAGKLLSRRLFGNGTTLMDYTKICTAVFTPVEYGCCGL  528
              P I+A+GDVI    L   A + G      + G    + +Y  I   ++T  E+   G 
Sbjct  334  QVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAGKHGHV-NYGAIPGVIYTFPEFASVGK  392

Query  529  SEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAK-ECYAKLIVDTTQQKRVLGFHYLG  587
            +EE+  A    E +E Y+    P+  + S  R +A+ +   K++ D    K +LG H + 
Sbjct  393  TEEELKA----EGIE-YNVGKFPM-MANSRARTIAEADGLVKVLADKKTDK-LLGVHIIA  445

Query  588  PNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIF  624
             NAGE+     I I+  A  +D   T   HPT +E F
Sbjct  446  GNAGEMIAEGVIGIEYGAASEDLARTCHAHPTLSEAF  482

>PHALS_12028
Length=579

 Score = 105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 132/504 (26%), Positives = 225/504 (45%), Gaps = 61/504 (12%)

Query  165  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  224
            +DL+VIG G  G  C+ +++K G+ V ++D            LGG CV+ G IP K   +
Sbjct  36   FDLIVIGSGPAGQKCAIDSAKHGKSVAIIDKRDM--------LGGVCVHTGTIPSKTFRE  87

Query  225  SSI-IGEILHK--------DADQFGWSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDK  275
            +++ +    HK         + +FG  V +      K+ S+  D       +  V L + 
Sbjct  88   AALHLTGYRHKAFYNGQGGPSKRFG--VEDILQRVKKVESAETDITRHQLLRNGVQLING  145

Query  276  KVKY----ENMLGTFKDAHTLTLTNDAKKKGPTDVTFR-----RAVIAVGGRP-KPLSCP  325
              ++    ++M+    +    T T DA++    D+  R     + ++ VG RP +    P
Sbjct  146  TARFLPGSKHMIAVLSNESYETAT-DAQRHSSADICKRVLTADKFLLCVGTRPARRADIP  204

Query  326  -GWEHALSSDDIF--SKPDAPGKTLVVGASYVALECAGFLKG-QGFDVTIM-VRSILLRG  380
               E    SD +        P + +VVGA  + +E A  +    G DVT++  R  +L  
Sbjct  205  FDGETIFDSDQLLWGKVKSVPRRLIVVGAGVIGMEYASMMTIIPGTDVTVIDARKEILNM  264

Query  381  FDQDIARRIGEYMESESGIAFIKESVPTSIVKLENGQFQVTHTTGQDVY-DTILNATGRS  439
             D +++  +   M +++G  F+   V  S+ K   G+  V   +G+ V  D +L   GR 
Sbjct  265  ADNEVSEALCFSM-AQTGTRFLTGEVIKSVEKSAMGEVFVHLESGKTVVGDGLLYTVGRQ  323

Query  440  PDVQKLNLDAAGVALNPKSGRIHVVNE-QTSTPNIYALGDVIDAPELTPVAIQAGKLLSR  498
             +V+ LNL+A G+  + K G+I V N  QT+ P+IYA GD+I  P L   +++ G+L S 
Sbjct  324  GNVEGLNLEAVGIVPD-KRGQIKVDNNFQTAVPHIYAAGDIIGFPGLASTSMEQGRLASV  382

Query  499  RLFG----NGTTLMDYTKI--CTAVFTPVEYGCC---GLSEEDAIASAGRENVEVYHQNF  549
             +      N   + D  K+     V T +  G     G+     I+  G+   ++  +  
Sbjct  383  HMRTSQPLNDQKISDDKKMDDPDRVRTRMRSGEVFPFGIYTVPEISMVGKNEQQLTKEG-  441

Query  550  TPLEWSLSHDRPLAK-------ECYAKLIV--DTTQQKRVLGFHYLGPNAGEVTQAIGIA  600
             P E  ++    LAK         + K+I   DT    +VLG H +G  A E+     + 
Sbjct  442  VPYEVGVARYEELAKGQMLGGVPGFLKIIFCPDTL---KVLGVHAIGEGATEIIHIGQVL  498

Query  601  IKLNATYDDFINTVGIHPTTAEIF  624
            +  + T + F N V  +PT AE +
Sbjct  499  MSTDGTLEYFRNAVFNYPTLAEAY  522

>PHYKE_9680
Length=498

 Score = 103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 112/441 (25%), Positives = 191/441 (43%), Gaps = 27/441 (6%)

Query  196  VKPSPVGSTWGLGGTCVNVGCIPKK-LMHQSSIIGEILHKDADQFGWSVSNATFDWSKLV  254
            +K + + S   LGGTC+NVGCIP K L+H + ++    H D   +G        ++ +++
Sbjct  55   LKTACIESRGKLGGTCLNVGCIPSKALLHSTHLLHTAQH-DFKSYGIDAPGVKANFPQMM  113

Query  255  SSVQDYIHGLNFKYRVDLRDKKVKYENMLG--TFKDAHTLTLTNDAKKKGPTDVTFRRAV  312
             + +  +  L     +  +  KV Y    G  + +   ++ LT++   KG   V  +  +
Sbjct  114  KAKEKAVKTLTGGIEMLFKKNKVTYIKGFGKVSAQGEVSVALTDN---KGNETVKAKNII  170

Query  313  IAVGGRPKPL-SCPGWEHA---LSSDDIFSKPDAPGKTLVVGASYVALECAGFLKGQGFD  368
            IA G    PL   P    A   + S         P   +VVGA  + LE     K  G  
Sbjct  171  IATGSEVTPLPPVPVDNEAGKIIDSTGALVLKRVPEHLVVVGAGVIGLELGSVYKRLGSK  230

Query  369  VTIM-VRSILLRGFDQDIARRIGEYMESES-----GIAFIKESVPTSIVKLENGQFQVTH  422
            VT++  +     G D++  +   + ++ +      G       V   +VKL     +   
Sbjct  231  VTVVEFQDAACPGMDKECVKEFTKLLKKQGLDFKFGTKVTASEVNGDVVKLTTEAAKGGD  290

Query  423  TTGQDVYDTILNATGRSPDVQKLNLDAAGVALNPKSGRIHVVNE-QTSTPNIYALGDVID  481
                +  DT+L ATGR      L L+  G+  + K GR+ V +  +T  P I+A+GDVI 
Sbjct  291  EASIEC-DTVLVATGRRAYTAGLGLEQMGIQTD-KLGRVEVDDAFRTQVPGIFAIGDVIK  348

Query  482  APELTPVAIQAGKLLSRRLFGNGTTLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGREN  541
               L   A + G      + G    + +Y  I   ++T  E+   G +EE+  A    E 
Sbjct  349  GAMLAHKAEEEGIACVENIAGKHGHV-NYGAIPGVIYTFPEFASVGKTEEELKA----EG  403

Query  542  VEVYHQNFTPLEWSLSHDRPLAKECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAI  601
            +E Y+    P+  + S  R +A+      ++   +  ++LG H +  NAGE+     IA+
Sbjct  404  IE-YNVGKFPM-MANSRARTVAEADGLVKVLSDKKTDKMLGVHIIASNAGEMIAEGVIAL  461

Query  602  KLNATYDDFINTVGIHPTTAE  622
            +  A+ +D   T   HPT +E
Sbjct  462  EYGASSEDIARTCHAHPTLSE  482

>PHYCA_555180
Length=521

 Score = 103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 125/496 (25%), Positives = 212/496 (43%), Gaps = 59/496 (12%)

Query  165  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  224
            +DLVVIG G     C+ E++K G++V ++D            LGG CV+ G IP K   +
Sbjct  31   YDLVVIGSGPSATQCALESAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFRE  82

Query  225  SSIIGEILHKDADQ----FGWSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYE  280
            +     +LH    +    +G S S  T     ++  VQ  +       R  L+  +V   
Sbjct  83   A-----VLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDVI  137

Query  281  NMLGTFKDAHTLTLTND---AKKKGP---------------TDVTFRRAVIAVGGRP--K  320
                 F++ H +++  D    KK G                + V   + +IA G RP   
Sbjct  138  PGFARFENQHEISIIRDDADVKKNGAVGANASGSSCNLDSLSRVHADKFLIACGTRPAHN  197

Query  321  PLSCPGWEHALSSDDIFSKP--DAPGKTLVVGASYVALECAGFLKG-QGFDVTIM-VRSI  376
            PL     +  + SD I S+     P   +V+GA  + +E A  +    G  VT++  R  
Sbjct  198  PLVPIDGKVIIDSDQILSRDMHQLPRSLIVMGAGVIGMEYASMVNVVPGHSVTVVDGRPD  257

Query  377  LLRGFDQDIARRIGEYMESESGIAFIKESVPTSIVKLE-NGQFQVTHTTGQDV-YDTILN  434
            +L   D++I   +   M+S      + E+V     K+E   + +V   +G+ +  D +L 
Sbjct  258  ILSFCDREIISNLTYEMQSNGARFLLGETVK----KVEVTDRVKVFFDSGKVLSADALLY  313

Query  435  ATGRSPDVQKLNLDAAGVALNPKSGRIHV-VNEQTSTPNIYALGDVIDAPELTPVAIQAG  493
              GR      LNL+A G++ N + G I+V  N QT  P+IYA GD I AP L   +++ G
Sbjct  314  TVGRQAATDGLNLEAVGLSRNHR-GLINVNKNYQTDQPHIYAAGDCIGAPALASTSMEQG  372

Query  494  KLLSRRLFGNGTTLMDYTKICT-----AVFTPVEYGCCGLSEEDAIASAGRENVEVYHQN  548
            +L S  ++     L   +++        ++T  E    G +E+    +    N E+    
Sbjct  373  RLASCHMWNPDEELAVTSQLENGNYPYGIYTIPEISMVGQTEQQLTKAC--INYEIGVAK  430

Query  549  FTPLEWSLSHDRPLAKECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYD  608
            ++  E +             K++ D    K V G H +G  A E+     +A+ ++ +  
Sbjct  431  YS--ELAKGQMMGAMAGGTLKILFDPDTLK-VFGVHAIGEGATEIIHIGQVAMAMDCSLT  487

Query  609  DFINTVGIHPTTAEIF  624
             F + V  +PT AE +
Sbjct  488  YFRDAVFNYPTLAEAY  503

>SDRG_06945
Length=492

 Score = 102 bits (254),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 130/484 (27%), Positives = 205/484 (42%), Gaps = 53/484 (11%)

Query  164  DWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMH  223
            D+DLVV+GGG GG   + +A++LG        +K + V S   LGGTC+NVGCIP K + 
Sbjct  25   DYDLVVVGGGPGGYVAAIKAAQLG--------LKTACVESRGTLGGTCLNVGCIPSKALL  76

Query  224  QSSIIGEILHKDADQFGWSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYENML  283
             ++        D    G  V     D++KL++S    +  L        +  K+ Y    
Sbjct  77   SATHKYHAAQHDFKNVGIEVDGLRIDFAKLMASKDKSVKILTGGIEGLFKKNKIDYIKGF  136

Query  284  GTFKDAHTLTLT-NDAKKKGPTDVTFRRAVIAVGGRPKPL-SCPGWEHA---LSSDDIFS  338
            G     + +++  ND    G   V+ +  +IA G    PL   P    A   + S    S
Sbjct  137  GKIVAKNQVSVALNDG---GNKTVSTKNILIATGSEVTPLPPVPVDNEAGKIIDSTGALS  193

Query  339  KPDAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGEYMESESG  398
                P   +V+G   + LE        G  +T++           + A +I   M+ E+G
Sbjct  194  LKRIPEHLVVIGGGVIGLEMGSVYGRLGAKITVV-----------EYADKICPTMDFETG  242

Query  399  IAFIK------------ESVPTSIVKLENGQFQVTHTTGQDVY----DTILNATGRSPDV  442
              F K            + V  S V+ +     V    G +      DT+L ATGR P  
Sbjct  243  REFQKLLKKQGMNFQLGQKVTASKVEGDKVTLTVEPAAGGEATTIECDTVLVATGRRPFT  302

Query  443  QKLNLDAAGVALNPKSGRIHV--VNEQTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRL  500
            + L L+  G+  + K GRI V   N +T+  NI+A+GD I+   L   A + G      +
Sbjct  303  KGLGLEEMGIQTD-KFGRIQVDLSNFKTNVDNIFAIGDCIEGAMLAHKAEEEGISCVESI  361

Query  501  FGNGTTLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDR  560
             G G   ++Y  I   V+T  E    G +EE+  A+    NV  +     P+  + S  R
Sbjct  362  AG-GHGHVNYNAIPGVVYTFPEVASVGKTEEELKAAGVAYNVGKF-----PM-MANSRAR  414

Query  561  PLAKECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTT  620
             + +      I+      ++LG H +  NAGE+     + ++  A+ +D   T   HPT 
Sbjct  415  TVGETDGFVKILAAKDDDKILGIHIIASNAGEMISEGVLGLEYGASAEDIGRTCHAHPTL  474

Query  621  AEIF  624
            +E F
Sbjct  475  SEAF  478

>PYU1_G005699
Length=550

 Score = 102 bits (255),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 124/503 (25%), Positives = 215/503 (43%), Gaps = 62/503 (12%)

Query  165  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  224
            +DL+VIG G  G  C+ +++K G+ V ++D             GG CV+ G +P K   +
Sbjct  50   FDLIVIGSGPAGQKCAIDSAKHGKSVAIIDKRDMH--------GGVCVHTGTVPSKTFRE  101

Query  225  SSIIGEILHKDADQFGWSVSNATFDWSKLVSSVQDYIHGLN-------FKYRVDLRDKKV  277
            +++        +   G S     F    ++  V+   H           +  V+L +   
Sbjct  102  ATLHLTAYRHRSFYDGQSSPTKRFGIEDILQRVKKVEHAETDITRHQLLRNGVELINGTA  161

Query  278  KY-----ENMLGTFKDAHTLTLTNDAKKKGPTDVTFR-----RAVIAVGGRP--KPLSCP  325
            ++     +NM+    +  + T   DAK+    D+  R     + +IAVG RP  +P    
Sbjct  162  RFLPDANKNMIAVLSN-DSYTTATDAKRHASADICKRVLTADKFLIAVGTRPARRPDIPF  220

Query  326  GWEHALSSDDIF--SKPDAPGKTLVVGASYVALECAGFLKG-QGFDVTIM-VRSILLRGF  381
              +    SD +        P + +VVGA  + +E A  +    G +VTI+  R  +L   
Sbjct  221  DGQAVFDSDQLLWGGVKTVPKRLIVVGAGVIGMEYASMMSIIPGMEVTIIDGRKEILDMA  280

Query  382  DQDIARRIGEYMESESGIAFIKESVPTSIVKLENGQFQVTHTTGQD-VYDTILNATGRSP  440
            D++++  +   M       F++E++ +  V+  NG+  V   +G+  V D +L   GR  
Sbjct  281  DREVSEALCYSMRQTGARFFVEETIKS--VEKVNGEVIVHLNSGKTLVGDGLLYTLGRQG  338

Query  441  DVQKLNLDAAGVALNPKSGRIHV-VNEQTSTPNIYALGDVIDAPELTPVAIQAGKLLSRR  499
            +   LNL A G+  + K G I V  N QT+ P+IYA GD I  P L   +++ G+L S  
Sbjct  339  NTDGLNLPAVGLEAD-KRGLIQVDENFQTAVPHIYAAGDCIGFPALASTSMEQGRLASVH  397

Query  500  LFGNGTT-----------LMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQN  548
            +     T               T++ +    P  +G   + E   I+  G+   ++  +N
Sbjct  398  MRTEKPTNKTGDSESTDPQFMRTRMRSGDVFP--FGIYTVPE---ISMVGKNEQQLTKEN  452

Query  549  FTPLEWSLSHDRPLAK-------ECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAI  601
              P E  L+    LAK         + K+I    +  ++LG H +G  A E+     + +
Sbjct  453  -VPYEVGLARYEELAKGQMLGGVPGFLKIIF-CPKTLQLLGVHAIGEGATEIIHIGQVVM  510

Query  602  KLNATYDDFINTVGIHPTTAEIF  624
                T + F N V  +PT AE +
Sbjct  511  STGGTIEYFRNAVFNYPTLAEAY  533

>SPRG_09825
Length=492

 Score = 101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 130/483 (27%), Positives = 206/483 (43%), Gaps = 51/483 (11%)

Query  164  DWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMH  223
            D+DLVV+GGG GG   + +A++LG        +K + V S   LGGTC+NVGCIP K + 
Sbjct  25   DYDLVVVGGGPGGYVAAIKAAQLG--------LKTACVESRGTLGGTCLNVGCIPSKALL  76

Query  224  QSSIIGEILHKDADQFGWSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYENML  283
             ++        D    G  V     D++KL++S    +  L        +  KV Y    
Sbjct  77   SATHKYHAAQHDFKNVGIEVDGLRIDFAKLMASKDKSVKILTGGIEGLFKKNKVDYIKGF  136

Query  284  GTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPL-SCPGWEHA---LSSDDIFSK  339
            G     + +++  +  + G   V+ +  +IA G    PL   P    A   + S    S 
Sbjct  137  GKIVAKNQVSVALN--EGGNKTVSTKNILIATGSEVTPLPPVPVDNEAGKIIDSTGALSL  194

Query  340  PDAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGEYMESESGI  399
               P   +V+G   + LE        G  +T++           + A +I   M+ E+G 
Sbjct  195  KRIPEHLVVIGGGVIGLEMGSVYGRLGAKITVV-----------EYADKICPTMDFETGR  243

Query  400  AFIK------------ESVPTSIVKLENGQFQVTHTTGQDVY----DTILNATGRSPDVQ  443
             F K            + V  S V+ +     V    G +      DT+L ATGR P  +
Sbjct  244  EFQKLLKKQGMNFQLGQKVTASKVEGDKVTLTVEPAAGGEATTIECDTVLVATGRRPFTK  303

Query  444  KLNLDAAGVALNPKSGRIHV--VNEQTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLF  501
             L L+  G+  + K GRI V   N +T+  NI+A+GD I+   L   A + G      + 
Sbjct  304  GLGLEEMGIQTD-KFGRIQVDLSNFKTNVDNIFAIGDCIEGAMLAHKAEEEGISCVESIA  362

Query  502  GNGTTLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRP  561
            G G   ++Y  I   V+T  E    G +EE+  A+    NV  Y+    P+  + S  R 
Sbjct  363  G-GHGHVNYNAIPGVVYTFPEVASVGKTEEELKAA----NV-AYNVGKFPM-MANSRART  415

Query  562  LAKECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTA  621
            + +      I+      ++LG H +  NAGE+     + ++  A+ +D   T   HPT +
Sbjct  416  VGETDGFVKILAAKDDDKILGIHIIASNAGEMISEGVLGLEYGASAEDIGRTCHAHPTLS  475

Query  622  EIF  624
            E F
Sbjct  476  EAF  478

>PYAP_19280
Length=512

 Score = 100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 121/488 (25%), Positives = 211/488 (43%), Gaps = 52/488 (11%)

Query  165  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  224
            +DLVVIG G     C+ E+++ G++V V+D  K S V      GG CV+ G IP K   +
Sbjct  30   YDLVVIGSGPSATQCAVESARHGKRVAVVD--KGSSV------GGVCVHTGTIPSKTFRE  81

Query  225  SSIIGEILHKDADQ----FGWSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYE  280
            +     +LH    +    +G S S  T     ++  V+  +       +  L+  +V Y 
Sbjct  82   A-----VLHLSGYRHHGFYGKSYSMKTVTIDDILYRVKRVVDSEVDVIKAQLKAARVDYI  136

Query  281  NMLGTFKDAHTLTLTN---------DAKKKGPTDVTFRRAVIAVGGRP--KPLSCPGWEH  329
                 F++ H +++           +   +  T +   + +IA G RP   PL     + 
Sbjct  137  PGFARFENDHEISIVREPTETNPEEEEPARLATRLQADKFLIACGTRPAHSPLVPIDGKV  196

Query  330  ALSSDDIFSKP--DAPGKTLVVGASYVALECAGFLK-GQGFDVTIM-VRSILLRGFDQDI  385
               SD I S    + P   +VVGA  + +E A  L    G  VT++  R  +L   D ++
Sbjct  197  VFDSDQILSGDIRELPRSLIVVGAGVIGMEYASMLNVVPGHSVTVIDGRQDILSFCDNEV  256

Query  386  ARRIGEYMESESGIAFIKESVPTSIVKLENGQFQVTHTTGQDVYDTILNATGRSPDVQKL  445
               +   M  +     + ES+   + K   G   + ++      D +L   GR  +   L
Sbjct  257  VSMLQHEMRVKGARFLLGESI-QKVEKTAKGVKVLLNSGKVTSADALLYTVGRQANTDGL  315

Query  446  NLDAAGVALNPKSGRIHVVNE-QTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLF-GN  503
            N++A G++ N + G ++V    QT   +IYA+GD I AP L   +++ G+L +  ++ GN
Sbjct  316  NIEAVGLSRNQR-GLLNVNKSYQTDKAHIYAVGDCIGAPALASTSMEQGRLAACHMWDGN  374

Query  504  ---GTTLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSL----  556
                T+ ++       ++T  E    G +E+   A   + N E+    ++ L        
Sbjct  375  CDIATSQLENGNYPYGIYTIPEISMVGKTEQQLTAE--KVNYEIGIAKYSELAKGQMGGG  432

Query  557  SHDRPLAKECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGI  616
            SH+  L      K++ D    K + G H +G  A E+     +AI +  +   F + V  
Sbjct  433  SHNGIL------KILFDPDTLK-LHGVHAIGEGATEIIHIGQVAIAMGCSLTYFRDAVFN  485

Query  617  HPTTAEIF  624
            +PT AE +
Sbjct  486  YPTLAEAY  493

>H310_07641
Length=548

 Score = 100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 132/510 (26%), Positives = 226/510 (44%), Gaps = 71/510 (14%)

Query  165  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  224
            +DLVVIG G  G  C+ +++K G+KV ++D             GG CV+ G IP K   +
Sbjct  41   FDLVVIGSGPAGQKCAIDSAKHGKKVAIIDKKDMH--------GGVCVHTGTIPSKTFRE  92

Query  225  SSIIGEILHKDADQFGWSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYENML-  283
             +++    H+    +G + + +T      +  + D +  +  +   DL   ++    ++ 
Sbjct  93   -AVLHLTAHRHKGFYGNAYTASTTGKRLSLEEILDRVKKVE-EAETDLTRNQLTRNGIIL  150

Query  284  --GTFK-----DAHTL-TLTN-------DAKKKGPTDVTFR-----RAVIAVGGRPKPLS  323
              GT +     D  T+  L+N       DA++    ++  R     + +IAVG RP    
Sbjct  151  INGTARFLQTEDKKTIAVLSNDSYTEKTDAQRHNDANICKRVLTADKVLIAVGTRPA--R  208

Query  324  CPGWEH----ALSSDDIF--SKPDAPGKTLVVGASYVALECAGFLK-GQGFDVTIM-VRS  375
             P  E+       SD +        P + +VVGA  + +E A  +    G  VT++  R 
Sbjct  209  HPDLEYDGRLIFDSDQLLWGGVDIVPKRLIVVGAGVIGMEYASMISIIPGTQVTVIDGRK  268

Query  376  ILLRGFDQDIARRIGEYMESESGIAFIKESVPTSIVKLE---NGQFQVTHTTGQDVY-DT  431
             +L   D++++  +  YM  + G  F+ E    SI+K+E   + +  V  T+G+ +  D 
Sbjct  269  EILDMADKEVSDALCYYMR-QRGSRFLTEE---SILKVETKDDSEVVVHLTSGKVIMGDA  324

Query  432  ILNATGRSPDVQKLNLDAAGVALNPKSGRIHVVNE-QTSTPNIYALGDVIDAPELTPVAI  490
            +L   GR  +V  L+L+A G++ N K G + V N  QT+ P+IYA GD I  P L   ++
Sbjct  325  LLYTQGRQGNVAGLDLEAVGLSAN-KRGILEVNNNFQTAVPHIYAAGDCIGYPALASTSM  383

Query  491  QAGKLLSRRLFGNGTTLMDYTKICTAVFTPV---------EYGCCGLSEEDAIASAGREN  541
            + G+L S  +  +  T  +  +    V  P          E    G+     I+  G+  
Sbjct  384  EQGRLASVHMRTSEPT--NKLRPDAEVHDPAHPRTRMRSGEVFPFGIYTVPEISMVGKSE  441

Query  542  VEVYHQNFTPLEWSLSHDRPLAK-------ECYAKLIVDTTQQKRVLGFHYLGPNAGEVT  594
             ++  +N  P E  ++    LAK         + KLI   T  K +LG H +G  A E+ 
Sbjct  442  QQLSKENI-PYEVGIARYEELAKGQMLGGMPGFLKLIFCPTTLK-LLGVHAIGEGATEII  499

Query  595  QAIGIAIKLNATYDDFINTVGIHPTTAEIF  624
                + +    T + F N V  +PT AE +
Sbjct  500  HIGQVVMSTGGTMEYFRNAVFNYPTLAEAY  529

>PYVX_23499
Length=519

 Score = 100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 129/522 (25%), Positives = 218/522 (42%), Gaps = 71/522 (14%)

Query  165  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  224
            +DL+V+G G  G  C+ +++K G+ V ++D            LGG CV+ G +P K   +
Sbjct  15   FDLIVVGSGPAGQKCAIDSAKHGKSVAIIDKRDM--------LGGVCVHTGTVPSKTFRE  66

Query  225  SSIIGEILHKDADQFGWSVSNATFDWSKLVSSVQ-------DYIHGLNFKYRVDLRDKKV  277
            +++        A     SVS+   +   ++  V        D       +  V+L     
Sbjct  67   ATLHLTGYRHRAFYDSASVSSRRLEIDDILQRVHKVEGAETDITRHQLMRNNVELIHGTA  126

Query  278  KY-----ENMLGTFKDAHTLTLTNDAKKKGPTDVTFR-----RAVIAVGGRP-KPLSCP-  325
            ++      NM+    +A   T T DAK+    D+  R     + +I VG RP +    P 
Sbjct  127  RFLPDEKRNMVAVLSNAKYDTPT-DAKRHTSADICKRVLTADKFLICVGTRPARREDIPF  185

Query  326  GWEHALSSDDIF--SKPDAPGKTLVVGASYVALECAGFLKG-QGFDVTIM-VRSILLRGF  381
              +    SD +       AP + +VVGA  + +E A  +    G +VT++  R  +L   
Sbjct  186  DGKTIFDSDQLLWGGVKAAPRRLIVVGAGVIGMEYASMMSIIPGTEVTVIDGRKEILDMA  245

Query  382  DQDIARRIGEYMESESGIAFIKESVPTSIVKLENGQFQVTHTTGQDVY-DTILNATGRSP  440
            D++++  +  Y   ++G  F  E     + K ENG+      +G+ +  D +L   GR  
Sbjct  246  DKEVSESLC-YSMRQTGTRFYTEESIKKVEKRENGEVVAHLNSGKVIVGDGLLYTLGRQG  304

Query  441  DVQKLNLDAAGVALNPKSGRIHVVNE-QTSTPNIYALGDVIDAPELTPVAIQAGKLLSRR  499
            +   LNL A G+  + K G ++V ++ QT  P+IYA GD I  P L   +++ G+L S  
Sbjct  305  NTDGLNLQAVGLETD-KRGFLNVNDDFQTEVPHIYAAGDCIGYPALASTSMEQGRLASVH  363

Query  500  L----------------FGNGTTLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVE  543
            +                 G     + +      VF    +G   + E   I+  G+   +
Sbjct  364  MRTESPTNKVGEEASDELGGDANRIRWRMRSGEVFP---FGIYTIPE---ISMVGKNEQQ  417

Query  544  VYHQNFTPLEWSLSHDRPLAK-------ECYAKLIV--DTTQQKRVLGFHYLGPNAGEVT  594
            +  +N  P E  L+    LAK         + K+I   DT    +VLG H +G  A E+ 
Sbjct  418  LTKEN-VPYEVGLARYEELAKGQMLGGVPGFLKIIFCPDTL---KVLGVHAIGEGATEII  473

Query  595  QAIGIAIKLNATYDDFINTVGIHPTTAEIFTTLEITKESGVD  636
                + +    T + F N V  +PT AE +    +     VD
Sbjct  474  HIGQVVMSTGGTIEYFRNAVFNYPTLAEAYRVAALNGLRKVD  515

>PHYCA_504445
Length=548

 Score = 99.8 bits (247),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 126/500 (25%), Positives = 213/500 (43%), Gaps = 53/500 (11%)

Query  165  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  224
            +DL+VIG G  G  C+ +++K G+ V ++D            +GG CV+ G +P K   +
Sbjct  46   FDLIVIGSGPAGQKCAIDSAKSGKSVAIID--------KRDMMGGVCVHTGTVPSKTFRE  97

Query  225  SSIIGEILHKDADQFGWSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYENMLG  284
            +++        A   G    +  F    ++  V+          R  L    V+  N   
Sbjct  98   AALHLTGYRHKAFYNGHGGPSKRFGVEDILQRVRKVEDAETDITRHQLMRNGVQLINGTA  157

Query  285  TF---KDAHTLTLTN-------DAKKKGPTDVTFR-----RAVIAVGGRP--KPLSCPGW  327
             F    +     L+N       DA++    D+  R     + ++ VG RP  +P      
Sbjct  158  RFLPGNNHMVAVLSNESYETATDAQRHSSADICKRVLTADKFLVCVGTRPARRPDIPFDG  217

Query  328  EHALSSDDIF--SKPDAPGKTLVVGASYVALECAGFLKG-QGFDVTIM-VRSILLRGFDQ  383
            E    SD +        P + ++VGA  V +E A  +    G DVT++  R  +L   D+
Sbjct  218  ETIFDSDQLLWGKVKTVPRRLIIVGAGVVGMEYASMMTIIPGTDVTVIDGRQEILNMADK  277

Query  384  DIARRIGEYMESESGIAFIKESVPTSIVKLENGQFQVTHTTGQDVY-DTILNATGRSPDV  442
            +++  +  Y  +++G  F+      S+ K   G+  V   +G+ V  D +L   GR  +V
Sbjct  278  EVSEALC-YSMAQTGTRFLTGETIKSVEKTAKGEVFVHLESGKTVVGDGLLYTVGRQGNV  336

Query  443  QKLNLDAAGVALNP-KSGRIHVVNE-QTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRL  500
            + LNL+A G  L P K GRI V N  QT+ P+IYA GD+I  P L   +++ G+L S  +
Sbjct  337  EGLNLEAVG--LEPDKRGRIKVDNNFQTAVPHIYAAGDIIGFPGLASTSMEQGRLASVHM  394

Query  501  FGNGT----TLMDYTKI--CTAVFTPVEYGCC---GLSEEDAIASAGRENVEVYHQNFTP  551
              + T     L D  K+     V T +  G     G+     I+  G+   ++  +   P
Sbjct  395  RTSKTLNTKELSDDKKMDDPDRVRTRMRSGEVFPFGIYTVPEISMVGKNEQQLTKEQ-VP  453

Query  552  LEWSLSHDRPLAK-------ECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLN  604
             E   +    LA+         + K+I    +  ++LG H +G  A E+     + +   
Sbjct  454  YEVGKARYEELARGQMLGGVPGFLKIIF-CPETLKILGVHAIGEGATEIIHIGQVVMSTG  512

Query  605  ATYDDFINTVGIHPTTAEIF  624
               + F N V  +PT AE +
Sbjct  513  GDLEYFRNAVFNYPTLAEAY  532

>PHALS_09942
Length=496

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 117/456 (26%), Positives = 193/456 (42%), Gaps = 33/456 (7%)

Query  182  EASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKK-LMHQSSIIGEILHKDADQFG  240
            +A++LG K   ++        S   LGGTC+NVGCIP K L+H + ++    H +   +G
Sbjct  47   KAAQLGMKTACIE--------SRGKLGGTCLNVGCIPSKALLHSTHLLHTAQH-EFKNYG  97

Query  241  WSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYENMLGTFKDAHTLTLTNDAKK  300
                  T ++ +++ +    +  L        +  KV Y    G       +++      
Sbjct  98   IDAPEVTANFPQMMKAKDKAVKTLTSGIESLFKKNKVTYIKGSGKISAQGEVSVALH-DH  156

Query  301  KGPTDVTFRRAVIAVGGRPKPLSCPGWEHA----LSSDDIFSKPDAPGKTLVVGASYVAL  356
            KG   V  +  +IA G    PL     ++A    + S         P   +VVGA  + L
Sbjct  157  KGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKIVDSTGALELKRIPDHLVVVGAGVIGL  216

Query  357  ECAGFLKGQGFDVTIM-----VRSILLRGFDQDIARRIGEY-MESESGIAFIKESVPTSI  410
            E     K  G  VT++       + + +G  +D  + + +  +E + G       +   +
Sbjct  217  ELGSVYKRLGAKVTVVEYLDDACTGMDKGSVKDFIKLLKKQGLEFKFGTKVTASEINGDV  276

Query  411  VKLENGQFQVTHTTGQDVYDTILNATGRSPDVQKLNLDAAGVALNPKSGRIHVVNE-QTS  469
            VKL     Q       +  DT+L ATGR      L L+  G+  + K GRI V    +T 
Sbjct  277  VKLTTEPSQGGDAASIEC-DTVLVATGRRAFTAGLGLEQMGIQTD-KFGRIEVDEAFRTQ  334

Query  470  TPNIYALGDVIDAPELTPVAIQAGKLLSRRLFGNGTTLMDYTKICTAVFTPVEYGCCGLS  529
             P I+A+GDVI    L   A + G   +  + G    + +Y  I   ++T  E+   G +
Sbjct  335  VPGIFAIGDVIKGAMLAHKAEEEGIACAEIIAGKHGHV-NYGAIPGVIYTFPEFASVGKT  393

Query  530  EEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAK-ECYAKLIVDTTQQKRVLGFHYLGP  588
            EE+  A    E +E Y+    P+  + S  R + + +   K++ D    K +LG H +  
Sbjct  394  EEELKA----EGIE-YNVGKFPM-MANSRARTVGESDGMVKVLADKKTDK-LLGVHIIAS  446

Query  589  NAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIF  624
            NAGE+     I I+  A  +D   T   HPT +E F
Sbjct  447  NAGEMISEGVIGIEYGAASEDVARTSHAHPTLSEAF  482

>SDRG_05060
Length=559

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 136/521 (26%), Positives = 222/521 (43%), Gaps = 93/521 (18%)

Query  165  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  224
            +DLVVIG G  G  C+ +++K G+KV ++D             GG CV+ G IP K   +
Sbjct  50   FDLVVIGSGPSGQKCAIDSAKHGKKVAIIDKKDMH--------GGVCVHTGTIPSKTFRE  101

Query  225  SSIIGEILHKDADQFGWSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYENML-  283
            +     +LH  A +      NA    S    S+QD    L+   +V+  +  +    +L 
Sbjct  102  A-----VLHLTAHRHKGFYGNAYSATSGKRMSIQDI---LDRVQKVESAEMDLTRNQLLR  153

Query  284  -GTFKDAHTLTLTNDAKKKG-----------PTD-------------VTFRRAVIAVGGR  318
             G +    T     DA KK             TD             +T  + +I+VG R
Sbjct  154  NGIYLINGTARFLPDADKKTVAVLSNDSYTEATDGQRHSDANICKRVLTADKFLISVGTR  213

Query  319  PK--PLSCPGWEHALSSDDIF--SKPDAPGKTLVVGASYVALECAGFLKG-QGFDVTIM-  372
            P   P      E    SD +   +  + P + +VVGA  + +E A  +    G  VT++ 
Sbjct  214  PARHPNMDFDGELIFDSDQLLWGALTNVPKRLIVVGAGVIGMEYAAMISIIPGTQVTVID  273

Query  373  VRSILLRGFDQDIA-------RRIGEYMESESGIAFIKESVPTS--IVKLENGQFQVTHT  423
             R  +L   D++++       R+ G    +E  I F+++ +     +V L++G+  V   
Sbjct  274  GRKEILEMADKEVSDALCYSMRQRGTRFLTEETIDFVEKRLDEKEVVVHLKSGKIIVG--  331

Query  424  TGQDVYDTILNATGRSPDVQKLNLDAAGVALNPKSGRIHVVNE-QTSTPNIYALGDVIDA  482
                  D +L   GR  +V  L+L+A G+  N + G + V N  QTS P+IYA GD I  
Sbjct  332  ------DALLYTQGRQGNVTGLDLEAVGLEANNR-GYLEVNNNFQTSVPHIYAAGDCIGY  384

Query  483  PELTPVAIQAGKLLSRRLF------GNGTTLMDY------TKICTAVFTPVEYGCCGLSE  530
            P L  V+++ G+L S  +        N T L  Y      T++ +    P  +G   + E
Sbjct  385  PALASVSMEQGRLASVHMRTSEPTNKNRTDLDPYETSHFRTRMRSGEVFP--FGIYTVPE  442

Query  531  EDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAK-------ECYAKLIVDTTQQKRVLGF  583
               I+  G+   ++  +N  P E  ++    LAK         + K+I   +  K +LG 
Sbjct  443  ---ISMVGKSEQQLTKEN-VPYEVGVARYEELAKGQMLGGTPGFLKIIFCPSTLK-LLGV  497

Query  584  HYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIF  624
            H +G  A E+     + +    T + F N V  +PT AE +
Sbjct  498  HAIGEGATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  538

>SPRG_12054
Length=558

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 136/521 (26%), Positives = 222/521 (43%), Gaps = 93/521 (18%)

Query  165  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  224
            +DLVVIG G  G  C+ +++K G+KV ++D             GG CV+ G IP K   +
Sbjct  49   FDLVVIGSGPSGQKCAIDSAKHGKKVAIIDKKDMH--------GGVCVHTGTIPSKTFRE  100

Query  225  SSIIGEILHKDADQFGWSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYENML-  283
            +     +LH  A +      NA    S    S+QD    L+   +V+  +  +    +L 
Sbjct  101  A-----VLHLTAHRHKGFYGNAYSATSGKRMSIQDI---LDRVQKVESAEMDLTRNQLLR  152

Query  284  -GTFKDAHTLTLTNDAKKKG-----------PTD-------------VTFRRAVIAVGGR  318
             G +    T     DA KK             TD             +T  + +I+VG R
Sbjct  153  NGIYLINGTARFLPDADKKTVAVLSNDSYTEATDGQRHSDANICKRVLTADKFLISVGTR  212

Query  319  PK--PLSCPGWEHALSSDDIF--SKPDAPGKTLVVGASYVALECAGFLKG-QGFDVTIM-  372
            P   P      E    SD +   +  + P + +VVGA  + +E A  +    G  VT++ 
Sbjct  213  PARHPNMDFDGELIFDSDQLLWGALTNVPKRLIVVGAGVIGMEYAAMISIIPGTQVTVID  272

Query  373  VRSILLRGFDQDIA-------RRIGEYMESESGIAFIKESVPTS--IVKLENGQFQVTHT  423
             R  +L   D++++       R+ G    +E  I F+++ +     +V L++G+  V   
Sbjct  273  GRKEILEMADKEVSDALCYSMRQRGTRFLTEETIDFVEKRLDEKEVVVHLKSGKIIVG--  330

Query  424  TGQDVYDTILNATGRSPDVQKLNLDAAGVALNPKSGRIHVVNE-QTSTPNIYALGDVIDA  482
                  D +L   GR  +V  L+L+A G+  N + G + V N  QTS P+IYA GD I  
Sbjct  331  ------DALLYTQGRQGNVTGLDLEAVGLEANNR-GYLEVNNNFQTSVPHIYAAGDCIGY  383

Query  483  PELTPVAIQAGKLLSRRLF------GNGTTLMDY------TKICTAVFTPVEYGCCGLSE  530
            P L  V+++ G+L S  +        N T L  Y      T++ +    P  +G   + E
Sbjct  384  PALASVSMEQGRLASVHMRTSEPTNKNRTDLDPYETSHFRTRMRSGEVFP--FGIYTVPE  441

Query  531  EDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAK-------ECYAKLIVDTTQQKRVLGF  583
               I+  G+   ++  +N  P E  ++    LAK         + K+I   +  K +LG 
Sbjct  442  ---ISMVGKSEQQLTKEN-VPYEVGVARYEELAKGQMLGGTPGFLKIIFCPSTLK-LLGV  496

Query  584  HYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIF  624
            H +G  A E+     + +    T + F N V  +PT AE +
Sbjct  497  HAIGEGATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  537

>PYIW_20257
Length=503

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 127/485 (26%), Positives = 204/485 (42%), Gaps = 72/485 (15%)

Query  165  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  224
            +DL+VIG G  G  C+ + +K G+ V V+D            LGG C++ G +P K   +
Sbjct  50   FDLIVIGSGPAGQKCAIDHAKHGKTVAVID--------KRDMLGGVCIHTGTVPSKTFRE  101

Query  225  SSIIGEILHKDADQFGWSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYENMLG  284
            ++     LH  A                       Y H  +F        K+   E++L 
Sbjct  102  AT-----LHLTA-----------------------YRH-RSFYEGQSTPAKRFGIEDILQ  132

Query  285  TFKDAHTLTLTNDAKKKGPTDVTFRRA-VIAVGGRP--KPLSCPGWEHALSSDDIF--SK  339
              K  H     +   ++ P +    +A +IAVG RP  +P      E    SD +     
Sbjct  133  RVKKLH-----DRHGRQTPLERRHLQAFLIAVGTRPARRPDIPFDGETIFDSDQLLWGGV  187

Query  340  PDAPGKTLVVGASYVALECAGFLKG-QGFDVTIM-VRSILLRGFDQDIARRIGEYMESES  397
               P + +VVGA  + +E A  +    G +VTI+  R  +L   D++++  +  Y   ++
Sbjct  188  KSVPKRLIVVGAGVIGMEYASMMSIIPGMEVTIVDGRREILDMADREVSEALC-YSMRQT  246

Query  398  GIAFIKESVPTSIVKLENGQFQVTHTTGQD-VYDTILNATGRSPDVQKLNLDAAGVALNP  456
            G  F  E    S+ K +NG+  V   +G+  V D +L   GR  + + LNL+A G+  + 
Sbjct  247  GARFFVEETIKSVEKADNGEVIVHLNSGKTLVGDGLLYTLGRQGNTEGLNLEAIGLKAD-  305

Query  457  KSGRIHVVNE-QTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLF--------GNGTTL  507
            K G I V ++ QT+ P+IYA GD I  P L   +++ G+L S  +         G+  T 
Sbjct  306  KRGLIEVDDDFQTAVPHIYAAGDCIGFPALASTSMEQGRLASVHMRTAKPTNKKGDSETE  365

Query  508  MDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAK---  564
                          E    G+     I+  G+   ++  Q   P E  ++    LAK   
Sbjct  366  STDPAFMRTRMRSGEVFPFGIYTVPEISMVGKNEQQLTSQCI-PYEVGVARYEELAKGQM  424

Query  565  ----ECYAKLIV-DTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPT  619
                  + K+I   TT Q  VLG H +G  A E+     + +    T + F N V  +PT
Sbjct  425  LGGVPGFLKIIFCPTTLQ--VLGVHAIGEGATEIIHIGQVVMSTGGTIEYFRNAVFNYPT  482

Query  620  TAEIF  624
             AE +
Sbjct  483  LAEAY  487

>HYAP_04149
Length=564

 Score = 96.7 bits (239),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 133/512 (26%), Positives = 225/512 (44%), Gaps = 68/512 (13%)

Query  165  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  224
            +DL+VIG G  G  C+ +++K G  V ++D            LGG CV+ G +P K   +
Sbjct  53   FDLIVIGSGPAGQKCAIDSAKHGYSVAIVD--------KRDMLGGVCVHTGTVPSKTFRE  104

Query  225  SSI-IGEILHKD--ADQFGWSVSNATFDWSKLVSSVQ----DYIHGLNFKYRVDLRDKKV  277
            +++ +    H+     Q G S      D  + V+ V+    D       +  V L     
Sbjct  105  AALHLTGYRHRAFYNGQAGPSKRVGVEDILQRVNKVEKAETDITRHQLMRNGVQLITGTA  164

Query  278  KY----ENMLGTFKDAHTLTLTNDAKKKGPTDVTFR-----RAVIAVGGRP-KPLSCP-G  326
            ++     +M+    +    T T DAK+    ++  R       ++ VG RP +    P  
Sbjct  165  RFMPGNSHMIAVLSNESYETAT-DAKRHSSANICKRVLTADNFLVCVGTRPARRADIPFD  223

Query  327  WEHALSSDDIF-SKPDA-PGKTLVVGASYVALECAGFLKG-QGFDVTIM-VRSILLRGFD  382
             E    SD +   K  A P + +VVGA  V +E A  +    G DVT++  R  +L   D
Sbjct  224  GETIFDSDQLLWGKVKAVPRRLIVVGAGVVGMEYASMMSIIPGTDVTVIDGRKEILEMAD  283

Query  383  QDIARRIGEYMESESGIAFIKESVPTSIVKLENGQFQVTHTTGQDVY-DTILNATGRSPD  441
            ++++  +  Y  +++G  F+ + V  S+ K   G+  V   +G+ V  D +L   GR  +
Sbjct  284  KEVSEALC-YSMAQTGTRFLVDEVIKSVEKSAKGEVGVHLESGKTVVGDGLLYTVGRQGN  342

Query  442  VQKLNLDAAGVALNPKSGRIHVVNE-QTSTPNIYA---------LGDVIDAPELTPVAIQ  491
            V+ LNL+A G+A + K GRI V N  QT+ P++YA          GD+I  P L   +++
Sbjct  343  VEGLNLEAVGLAPD-KRGRIIVDNNFQTAVPHMYAQSRLIADQNAGDIIGFPALASTSME  401

Query  492  AGKLLSRRLFGNGTTLMDYTKICT---------AVFTPVEYGCC---GLSEEDAIASAGR  539
             G+L S  +    T+   YTK  +          V T +  G     G+     I+  G+
Sbjct  402  QGRLASVHMR---TSKSFYTKEISDDKKMDDPDRVRTRMRSGEVFPFGIYTVPEISMVGK  458

Query  540  ENVEVYHQNFTPLEWSLSHDRPLAK-------ECYAKLIVDTTQQKRVLGFHYLGPNAGE  592
               ++  +   P E  ++    LAK         + K+I    +  ++LG H +G  A E
Sbjct  459  NEQQLTREQ-VPYEVGIARYEELAKGQMLGGVPGFLKIIF-CPKTLKLLGVHAIGEGATE  516

Query  593  VTQAIGIAIKLNATYDDFINTVGIHPTTAEIF  624
            +     + +  + T + F N V  +PT AE +
Sbjct  517  IIHIGQVVMSTDGTLEYFRNAVFNYPTLAEAY  548

>H257_07450
Length=567

 Score = 93.6 bits (231),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 139/545 (26%), Positives = 234/545 (43%), Gaps = 94/545 (17%)

Query  165  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  224
            +DLVVIG G  G  C+ +++K G+KV ++D             GG CV+ G IP K   +
Sbjct  39   FDLVVIGSGPAGQKCAIDSAKHGKKVAIIDKKDMH--------GGVCVHTGTIPSKTFRE  90

Query  225  SSIIGEILHKDADQFGWSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYENML-  283
             +++    H+    +G + + +T      +  + D +  +      DL   ++    ++ 
Sbjct  91   -AVLHLTAHRHKGFYGNAYTASTTGKRLSLEEILDRVKKVE-DAETDLTRNQLTRNGIIL  148

Query  284  --GTFK-----DAHTL-TLTN-------DAKKKGPTDVTFR-----RAVIAVGGRPKPLS  323
              GT +     D  T+  L+N       DA++    ++  R     + +IAVG RP    
Sbjct  149  INGTARFLPTEDKKTIAVLSNDSYTEKTDAQRHNDANICKRVLTADKVLIAVGTRPARRP  208

Query  324  CPGWEHAL--SSDDIF--SKPDAPGKTLVVGASYVALECAGFLK-GQGFDVTIM-VRSIL  377
               ++  L   SD +        P + +VVGA  + +E A  +    G  VT++  R  +
Sbjct  209  DLDYDGRLIFDSDQLLWGGVDIVPKRLIVVGAGVIGMEYASMISIIPGTQVTVIDGRKEI  268

Query  378  LRGFDQDIARRIGEYMESESGIAFIKESVPTSIVKLE---NGQFQVTHTTGQDVY-DTIL  433
            L   D++++  +  YM  + G  F+ E    SIVK+E   N +  V  T+G+ +  D +L
Sbjct  269  LDMADKEVSDALCYYMR-KRGSRFLTEE---SIVKVETKDNSEVLVYLTSGKVIVGDALL  324

Query  434  NATGRSPDVQKLNLDAAGVALNPKSGRIHVVNE-QTSTPNIYALGDVIDAPELTPVAIQA  492
               GR  +V  L+L+A G+A N K G + V N  QT  P+IYA GD I  P L   +++ 
Sbjct  325  YTQGRQGNVAGLDLEAVGLAAN-KRGVLDVNNNFQTDVPHIYAAGDCIGYPALASTSMEQ  383

Query  493  GKLLSRRLFGNGTT------------LMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRE  540
            G+L S  +  +  T                T++ +    P  +G   + E   I+  G+ 
Sbjct  384  GRLASVHMRTSEPTNKLRPDAEAHDPAHPRTRMRSGEVFP--FGIYTVPE---ISMVGKS  438

Query  541  NVEVYHQNFTPLEWSLSHDRPLAK-------ECYAKLIVDTTQQKRVLGFHYLGPNA---  590
              ++  +N  P E  ++    LAK         + KLI   T  K +LG H +G  A   
Sbjct  439  EQQLSRENI-PYEVGIARYEELAKGQMMGGMPGFLKLIFCPTTLK-LLGVHAIGEGATEI  496

Query  591  ---GEVTQAIGIAIK---------------LNATYDDFINTVGIHPTTAEIFTTLEITKE  632
               G+V  + G  I                +  T + F N V  +PT AE +    +   
Sbjct  497  IHIGQVVMSTGTLIGRLSPTPSLQHVVVGCVGGTMEYFRNAVFNYPTLAEAYRVAGLNGL  556

Query  633  SGVDA  637
            S ++A
Sbjct  557  SKIEA  561

>PHYKE_2864
Length=486

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 118/488 (24%), Positives = 194/488 (40%), Gaps = 81/488 (17%)

Query  165  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  224
            +DLVVIG G     C+ E++K G++V ++D            LGG CV+ G IP K   +
Sbjct  34   YDLVVIGSGPSATQCALESAKQGKRVAIVD--------KKTSLGGVCVHTGTIPSKTFRE  85

Query  225  SSIIGEILHKDADQ----FGWSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYE  280
            +     +LH    +    +G S S  T     ++  VQ  +       R  L+  +V   
Sbjct  86   A-----VLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSETDVVRAQLKAARVDVI  140

Query  281  NMLGTFKDAHTLTLTN--DAKKK--------GPTDVTFRRA---VIAVGGRP--KPLSCP  325
                 F++ H +++    D K K        G   ++  RA   +IA G RP   PL   
Sbjct  141  PGFARFENEHEISIVRGEDEKSKAVGASASNGLDSLSRVRADKFLIACGTRPAHNPLVPI  200

Query  326  GWEHALSSDDIFSKP--DAPGKTLVVGASYVALECAGFLK-GQGFDVTIMVRSILLRGFD  382
              +  + SD I S+     P   +VVGA  + +E A  +    G  VT+      + G  
Sbjct  201  DGKVIIDSDQILSRDMHQLPRSLIVVGAGVIGMEYASMVNVVPGHSVTV------VDGRP  254

Query  383  QDIARRIGEYMESESGIAFIKESVPTSIVKLENGQFQVTHTTGQDVYDTILNATGRSPDV  442
                +R+  +  S   ++                             D +L   GR    
Sbjct  255  DTTDKRVKVFFNSGKVLS----------------------------ADALLYTVGRQAST  286

Query  443  QKLNLDAAGVALNPKSGRIHV-VNEQTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLF  501
              LNL+A G++ N + G I+V  N QT  P+IYA GD I AP L   +++ G+L S  ++
Sbjct  287  DGLNLEAVGLSRNHR-GLINVNKNYQTDQPHIYAAGDCIGAPALASTSMEQGRLASCHMW  345

Query  502  G-----NGTTLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSL  556
                    T+ ++       ++T  E    G +E+         N E+    ++  E + 
Sbjct  346  NPDEELAATSQLESGNYPYGIYTIPEISMVGQTEQQLTKDC--VNYEIGIAKYS--ELAK  401

Query  557  SHDRPLAKECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGI  616
                        K++ D    K V G H +G  A E+     +A+ +  +   F + V  
Sbjct  402  GQMMGAMAGGTLKILFDPDTLK-VFGVHAIGEGATEIIHIGQVAMAMGCSLTYFRDAVFN  460

Query  617  HPTTAEIF  624
            +PT AE +
Sbjct  461  YPTLAEAY  468

>H310_02523
Length=494

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 113/443 (26%), Positives = 185/443 (42%), Gaps = 27/443 (6%)

Query  196  VKPSPVGSTWGLGGTCVNVGCIPKK-LMHQSSIIGEILHKDADQFGWSVSNATFDWSKLV  254
            +K + V +   LGGTC+NVGCIP K L+H + +     H D    G  V N + D+++L+
Sbjct  51   LKTACVEARGTLGGTCLNVGCIPSKALLHGTHLYHAAQH-DFKSVGIKVDNVSIDFNQLM  109

Query  255  SSVQDYIHGLNFKYRVDLRDKKVKYENMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIA  314
             S +  +  L        +  KV Y    G       L++  +    G   +  +  +IA
Sbjct  110  KSKEKTVKILTGGIEGLFKKNKVDYVKGFGKIVAKGQLSVALNG--GGNQTLHTKNILIA  167

Query  315  VGGR-----PKPLSCPGWEHALSSDDIFSKPDAPGKTLVVGASYVALECAGFLKGQGFDV  369
             G       P P+   G +  + S    S    P   +VVG   + LE        G  +
Sbjct  168  TGSEVTPLPPVPVDNEGGK-IVDSTGALSLKRIPNHLVVVGGGVIGLEMGSVYGRLGSKI  226

Query  370  TIMVRS-ILLRGFDQDIARRIGEYMESESGIAF-IKESVPTSIVKLENGQFQVTHTTGQD  427
            T++  +  +    D ++ +   + + ++ G+ F + + V  S V  +     V    G D
Sbjct  227  TVVEYADKICPTMDHELTKEFQKLL-TKQGMTFKLGQKVTASKVDGDTVTLTVEPAAGGD  285

Query  428  V----YDTILNATGRSPDVQKLNLDAAGVALNPKSGRIHV--VNEQTSTPNIYALGDVID  481
                  D +L ATGR P    L L+  G+  + + GRI V   N QT+   IYA+GDVI+
Sbjct  286  ATTIEADCVLVATGRRPYTAGLGLEDMGIQTD-RFGRIKVNLSNFQTNVDGIYAIGDVIE  344

Query  482  APELTPVAIQAGKLLSRRLFGNGTTLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGREN  541
               L   A + G  +   + G    + +Y  I   ++T  E    G +EE+  A+    N
Sbjct  345  GAMLAHKAEEEGIAVVETIAGKHGHV-NYDAIPGVIYTFPEVASVGKTEEELKAANVAYN  403

Query  542  VEVYHQNFTPLEWSLSHDRPLAKECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAI  601
            V  +         ++       K   AK         ++LG H +  NAGE+     + I
Sbjct  404  VGKFPMMANSRARAVGETDGFVKVLAAK------DDDKILGIHIIASNAGEMISEGVLGI  457

Query  602  KLNATYDDFINTVGIHPTTAEIF  624
            +  A+ +D   T   HPT +E F
Sbjct  458  EYGASAEDIGRTCHAHPTLSEAF  480

>PYU1_G001737
Length=133

 Score = 85.1 bits (209),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 3/95 (3%)

Query  41   YHVVGWKQCPYYVKAASVASSMQHLFPSQVKATIHEHPNKESFVNWLNESQTEFAHQFDN  100
            YH+ GW+ C ++ KA  V S+MQ L+P  ++ T+HE  ++++F  WL+ S+ +FA  F  
Sbjct  38   YHIAGWRGCSFFQKACDVGSAMQVLYPDHLQFTVHEFADRDAFRAWLDVSKDDFATHFGA  97

Query  101  DARPLKHKSSPFCYLEQDDTPKFVGGCDDTLAFFR  135
             +  L H SSPF +    +  +FVGGCD  LA  R
Sbjct  98   TSPALTHTSSPFVW---SNAGEFVGGCDALLATIR  129

>PYAP_19148
Length=535

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 131/518 (25%), Positives = 218/518 (42%), Gaps = 79/518 (15%)

Query  165  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  224
            +DL+VIG G  G  C+ + +K G+ V ++D             GG CV+ G +P K   +
Sbjct  11   FDLIVIGSGPAGQKCAIDHAKHGKSVAIIDKKDMH--------GGVCVHTGTVPSKTFRE  62

Query  225  SSIIGEILH--------------KDADQFGWS--------VSNATFDWSK--LVSSVQDY  260
            +     ILH              K   +FG          V NA  D ++  L+ +  + 
Sbjct  63   A-----ILHLTAHRHRSFYDGASKPKKRFGIEDILQRVRKVENAETDITRHQLLRNGIEL  117

Query  261  IHGLNFKYRVDLRDKKVKY--ENMLGTFKDAHTLTLTNDAKKKGPTD-------VTFRRA  311
            I+G   ++  D   K V     +   T  D    T  +  K+ G          +T  + 
Sbjct  118  ING-TARFLPDPSKKMVAVLSNDSYETATDTKRHTSADICKRTGADSSILLISVLTADKF  176

Query  312  VIAVGGRP-KPLSCP-GWEHALSSDDIF-SKPDA-PGKTLVVGASYVALECAGFLKG-QG  366
            ++AVG RP +    P   +    SD I     DA P + +VVGA  + +E A  +    G
Sbjct  177  LVAVGTRPARRADIPFDGKTIFDSDQILWGGVDAVPKRLIVVGAGVIGMEYASMMSIIPG  236

Query  367  FDVTIM-VRSILLRGFDQDIARRIGEYMESESGIAFIKESVPTSIVKLENGQFQVTHTTG  425
             +VT++  R  +L   D+++A  + +Y   ++G  F  +    ++ K  NG+  V   +G
Sbjct  237  SEVTVIDGRKEILDMADKEVAEAL-KYAMRQTGTRFYTDETINTVEKAANGEVIVKLNSG  295

Query  426  QDVY-DTILNATGRSPDVQKLNLDAAGVALNPKSGRIHVV-NEQTSTPNIYALGDVIDAP  483
            + +  D +L   GR  +   LNL A G+  + K G + V  N +TS P+IYA GD I  P
Sbjct  296  KTIVGDGLLYTVGRQGNTDGLNLAAVGLEAD-KRGLLKVDDNFRTSVPHIYAAGDCIGYP  354

Query  484  ELTPVAIQAGKLLS----------RRLFGNGTTLMDYTKICTAVFTPVEYGCCGLSEEDA  533
             L   +++ G+L S          ++   N  +   Y +          +G   + E   
Sbjct  355  ALASTSMEQGRLASVHMRSEKPVNKKRADNEPSDPSYQRTRMRSGEVFPFGIYTVPE---  411

Query  534  IASAGRENVEVYHQNFTPLEWSLSHDRPLAK-------ECYAKLIVDTTQQKRVLGFHYL  586
            I+  G+   ++  +N  P E  ++    LAK         + K IV   +  +VLG H +
Sbjct  412  ISMVGKSEQQLTRENI-PYEVGVARYEELAKGQMLGGVPGFLK-IVFCPKSLQVLGVHAI  469

Query  587  GPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIF  624
            G  A E+     + +    T + F N V  +PT AE +
Sbjct  470  GEGATEIIHIGQVVMSTGGTIEYFRNAVFNYPTLAEAY  507

>PYIW_24688
Length=259

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 77/257 (30%), Positives = 115/257 (45%), Gaps = 43/257 (17%)

Query  177  LACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGEILHKDA  236
            +A ++ A+  G KVLV++  +    G   GLGGTCV+ GC+PKK+M  ++   E L++ A
Sbjct  19   MASARRAATFGAKVLVVE--RGRKYGGA-GLGGTCVHYGCVPKKIMFNAATHVEHLNRAA  75

Query  237  D-----------QFGWSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYENMLGT  285
            D           QFG       FDW+ + +    YI  LN  Y  +L + +V        
Sbjct  76   DYSITTNGAHKYQFG------DFDWANMKTKRDAYILRLNGIYERNLGNAQVD------L  123

Query  286  FKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDDIFSKPDAPGK  345
             +    L   N  +  G    T +  ++AVGG+P              D  F     P K
Sbjct  124  VEGVAKLVAKNQVEVDGVV-YTGKHILVAVGGKP--------------DGFFKLEAQPKK  168

Query  346  TLVVGASYVALECAGFLKGQGFDVTIMVR-SILLRGFDQDIARRIGEYMESESGIAFIKE  404
              VVGA Y+A+E AG       D ++  R   +LR FD  +   I E  E ++GI F++ 
Sbjct  169  VAVVGAGYIAIEIAGIFNTLKSDTSLFCRFDHVLRTFDPIVRDLINEEGE-KAGINFVRN  227

Query  405  SVPTSIVKLENGQFQVT  421
            S    I K  +G   +T
Sbjct  228  SRIERIEKQADGSLTIT  244

>PHYSO_489418
Length=471

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 118/457 (26%), Positives = 200/457 (44%), Gaps = 43/457 (9%)

Query  207  LGGTCVNVGCIPKKLMHQSSI-IGEILHKD--ADQFGWSVSNATFDWSKLVSSVQDYIHG  263
            +GG CV+ G +P K   ++++ +    HK     Q G S      D  + V  V+D    
Sbjct  2    MGGVCVHTGTVPSKTFREAALHLTGYRHKAFYNGQAGPSKRFGVEDILQRVKKVEDAETD  61

Query  264  LN----FKYRVDLRDKKVKY----ENMLGTFKDAHTLTLTNDAKKKGPTDVTFR-----R  310
            +      +  V L +   ++     +M+    +    T T DAK+    D+  R     +
Sbjct  62   ITRHQLMRNGVQLINGTARFLPGNNHMVAVLSNESYETAT-DAKRHTSADICKRVLTADK  120

Query  311  AVIAVGGRP--KPLSCPGWEHALSSDDIF--SKPDAPGKTLVVGASYVALECAGFLKG-Q  365
             ++ VG RP  +P      E    SD +        P + +VVGA  V +E A  +    
Sbjct  121  FLVCVGTRPARRPDIPFDGETIFDSDQLLWGKVKTVPRRLIVVGAGVVGMEYASMMTIIP  180

Query  366  GFDVTIM-VRSILLRGFDQDIARRIGEYMESESGIAFIKESVPTSIVKLENGQFQVTHTT  424
            G DVT++  R  +L   D++++  +  Y  +++G  F+      S+ K   G+  V   +
Sbjct  181  GTDVTVIDGRQEILNMADKEVSEALC-YSMAQTGTRFLVGETIKSVEKTPKGEVFVHLES  239

Query  425  GQDVY-DTILNATGRSPDVQKLNLDAAGVALNPKSGRIHVVNE-QTSTPNIYALGDVIDA  482
            G+ V  D +L   GR  +V+ LNL+A G+  + K GRI V N  QT+ P+IYA GD+I  
Sbjct  240  GKTVVGDGLLYTVGRQGNVEGLNLEAVGLVPD-KRGRIKVDNNFQTAVPHIYAAGDIIGF  298

Query  483  PELTPVAIQAGKLLSRRLFG----NGTTLMDYTKI--CTAVFTPVEYGCC---GLSEEDA  533
            P L   +++ G+L S  +      N   L D  K+     V T +  G     G+     
Sbjct  299  PGLASTSMEQGRLASVHMRTSKPLNNKELSDDKKMDDPDRVRTRMRSGEVFPFGIYTVPE  358

Query  534  IASAGRENVEVYHQNFTPLEWSLSHDRPLAK-ECYAKL-----IVDTTQQKRVLGFHYLG  587
            I+  G+   ++  +   P E  ++    LA+ +    L     I+   +  ++LG H +G
Sbjct  359  ISMVGKNEQQLTKEQ-VPYEVGMARYEELARGQMLGGLPGFLKIIFCPETLKILGVHAIG  417

Query  588  PNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIF  624
              A E+     + +    T + F N V  +PT AE +
Sbjct  418  EGATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  454

>PITG_01778
Length=470

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 120/460 (26%), Positives = 201/460 (44%), Gaps = 49/460 (11%)

Query  207  LGGTCVNVGCIPKKLMHQSSI-IGEILHKD--ADQFGWSVSNATFDWSKLVSSVQDYIHG  263
            LGG CV+ G +P K   ++++ +    HK     Q G S      D  + V  V+D    
Sbjct  2    LGGVCVHTGTVPSKTFREAALHLTGYRHKAFYNGQAGPSRRFGVEDILQRVRKVEDAETD  61

Query  264  LN----FKYRVDLRDKKVKY----ENMLGTFKDAHTLTLTNDAKKKGPTDVTFR-----R  310
            +      +  V L +   ++    +NM+    +    T T DAK+    D+  R     +
Sbjct  62   ITRHQLLRNGVQLINGTARFLTGNKNMVAVLSNESYETAT-DAKRHTSADICKRVLTADK  120

Query  311  AVIAVGGRP--KPLSCPGWEHALSSDDIF--SKPDAPGKTLVVGASYVALECAGFLKG-Q  365
             ++ VG RP  +P      E    SD +   +    P + ++VGA  V +E A  +    
Sbjct  121  FLVCVGTRPARRPDIPFDGETIFDSDQLLWGNVKSVPRRLIIVGAGVVGMEYASMMTIIP  180

Query  366  GFDVTIM-VRSILLRGFDQDIARRIGEYMESESGIAFIKESVPTSIVKLENGQFQVTHTT  424
            G DVT++  R  +L   D+ ++  +  Y  +++G  F+      S+ K   G+      +
Sbjct  181  GTDVTVIDGRQEILNMADKQVSEALC-YSMAQTGTRFLTGETIKSVEKSPKGEVFAHLES  239

Query  425  GQDVY-DTILNATGRSPDVQKLNLDAAGVALNPKSGRIHVVNE-QTSTPNIYALGDVIDA  482
            G+ V  D +L   GR  +V+ LNL+A G+A + K GRI V N  QT+ P+IYA GD+I  
Sbjct  240  GKTVVGDGLLYTVGRQGNVEGLNLEAVGLAPD-KRGRIKVDNNFQTAVPHIYAAGDIIGF  298

Query  483  PELTPVAIQAGKLLSRRLFG----NGTTLMDYTKI--CTAVFTPVEYGCC---GLSEEDA  533
            P L   +++ G+L S  +      N   L D  K+     V T +  G     G+     
Sbjct  299  PGLASTSMEQGRLASVHMRTSKPLNDLELSDDKKMDDPDRVRTRMRSGEVFPFGIYTVPE  358

Query  534  IASAGRENVEVYHQNFTPLEWSLSHDRPLAK-------ECYAKLIV--DTTQQKRVLGFH  584
            I+  G+   ++  +   P E  ++    LA+         + K+I   DT    ++ G H
Sbjct  359  ISMVGKNEQQLTKEQ-VPYEVGVARYEELARGQMLGGVPGFLKIIFCPDTL---KIFGVH  414

Query  585  YLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIF  624
             +G  A E+     + +    T + F N V  +PT AE +
Sbjct  415  AIGEGATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  454

>CCA14030
Length=560

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 125/516 (24%), Positives = 216/516 (42%), Gaps = 73/516 (14%)

Query  158  DADVKYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCI  217
            D      +DL+V+G G  G  C+ +++K G+ V ++D  +          GG CV+ G +
Sbjct  48   DLKASEHYDLIVVGSGPAGQKCAIDSAKHGKSVAIIDKNEMH--------GGVCVHTGTV  99

Query  218  PKKLMHQSSIIGEILHKDADQF-----GWSVSNATFDWSKLVSSVQ-------DYIHGLN  265
            P K   ++     ILH  A +      G S     F    +++ V+       D      
Sbjct  100  PSKTFREA-----ILHLTAHRHRNFYTGMSSPKKRFGIEDILTRVRKVENAETDITRHQL  154

Query  266  FKYRVDLRDKKVKY-----ENMLGTFKDAHTLTLTNDAKKKGPTDVTFR-----RAVIAV  315
             +  V+L +   ++     +NM+    ++   T T D  +    ++  R     + +IAV
Sbjct  155  VRNNVELINGTARFLPDPSKNMVAVLSNSSYETAT-DGNRHFRANICQRILTADKFLIAV  213

Query  316  GGRPKPLSCPGWEHAL--SSDDIF--SKPDAPGKTLVVGASYVALECAGFLKG-QGFDVT  370
            G RP       ++  +   SD I        P + +VVGA  + +E A  +    G  VT
Sbjct  214  GTRPARRDDVVFDGQMIFDSDQILWGGVKSVPKRLIVVGAGVIGMEYASMMSIIPGAQVT  273

Query  371  IM-VRSILLRGFDQDIARRIGEYMESESGIAFIKESVPTSIVKLENGQFQVTH-TTGQDV  428
            ++  R  +L   D+++   +   M       +++E++    V+L N    +TH  +G+ V
Sbjct  274  VIDGRKEILEMADREVVEALTYAMRQTGSRFYMEETI--KCVELSNKDEVITHLNSGKTV  331

Query  429  Y-DTILNATGRSPDVQKLNLDAAGVALNPKSGRIHV-VNEQTSTPNIYALGDVIDAPELT  486
              D +L   GR  + + L+L A G+  + K G I V  N QTS P+IYA GD    P L 
Sbjct  332  VGDGLLYTVGRQGNTEGLDLSAIGLETD-KRGLIKVNENFQTSVPHIYAAGDCTGFPALA  390

Query  487  PVAIQAGKLLS---RRLFGNGTT--------LMDYTKICTAVFTPVEYGCCGLSEEDAIA  535
              +++ G+L S   R      TT            T++ +  F P  +G   + E   I+
Sbjct  391  STSMEQGRLASVHMRTSMPTNTTGHAEPTDPQHMRTRMRSGDFFP--FGIYTVPE---IS  445

Query  536  SAGRENVEVYHQNFTPLEWSLSHDRPLAK-------ECYAKLIVDTTQQKRVLGFHYLGP  588
              G+   ++  +     E  ++    LAK         + K+I   T    +LG H +G 
Sbjct  446  MVGKNEHQLTKEGIA-YEVGVARYEELAKGQMLGGVPGFLKIIFCPTTLN-ILGVHAIGE  503

Query  589  NAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIF  624
             A E+     + +    T + F N V  +PT AE +
Sbjct  504  GATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  539

>SPRG_04114
Length=376

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 96/367 (26%), Positives = 170/367 (46%), Gaps = 26/367 (7%)

Query  269  RVDLRDKKVKYENMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRP--KPLSCPG  326
            +  L+  +V     L  F++ + +++  D  +  PT +  ++ ++A G RP   PL    
Sbjct  5    QAQLKAARVDLVPGLARFENENEVSVEGDDGQ--PTRLRGKKFLVACGTRPAHSPLVPCD  62

Query  327  WEHALSSDDIFSK--PDAPGKTLVVGASYVALECAGFLKG-QGFDVTIM-VRSILLRGFD  382
             +  L SD I +      P   +VVGA  + +E A  L    G +VT++  R+ +L   D
Sbjct  63   GKIILDSDQILNHDTTKLPKSWIVVGAGVIGMEYASMLNVLPGINVTVVDGRAEILSFCD  122

Query  383  QDIARRIGEYMESESGIAFIKESVPTSIVKLENGQFQVTHTTGQDVY-DTILNATGRSPD  441
             +I   +   M  +     + ES+  S+   +NG  +V   +G+ ++ + +L   GR  +
Sbjct  123  DEIVSSLKMEMRHKGARFLLGESI-KSVEHFKNG-VKVEFNSGKAMFAEALLYCVGRQAN  180

Query  442  VQKLNLDAAGVALNPKSGRIHVVNEQ--TSTPNIYALGDVIDAPELTPVAIQAGKLLSRR  499
               LNL+A G++ N +   +  VNEQ  TS P+IYA GD I AP L   +++ G+L +  
Sbjct  181  TDGLNLEAVGLSKNHRG--LITVNEQYQTSHPHIYAAGDCIGAPSLASTSMEQGRLAACD  238

Query  500  LFGNG---TTLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPL-EWS  555
            ++ +    T+ ++       ++T  E    G +E+         N  V    F+ L +  
Sbjct  239  MWSDKDQTTSQLESGNYPYGIYTIPEISMVGKTEQQLTKEGA--NYAVGLAKFSELAKGQ  296

Query  556  LSHDRPLAKECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVG  615
            +S D     E   KL+ D    + +LG H +G  A E+     +A+ +N     F + V 
Sbjct  297  MSGD----IEGILKLLFDPVSLQ-LLGVHAIGHGATEIIHIGQVAMAMNCKITYFRDAVF  351

Query  616  IHPTTAE  622
             +PT AE
Sbjct  352  NYPTLAE  358

>PHYKE_9807
Length=557

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 127/516 (25%), Positives = 208/516 (40%), Gaps = 86/516 (17%)

Query  165  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKL-MH  223
            +DL+VIG G  G  C+ +++K G+ V ++D            LGG CV+ G   ++  MH
Sbjct  56   FDLIVIGSGPAGQKCAIDSAKHGKSVAIVD--------KRDMLGGVCVHTGTTFREAAMH  107

Query  224  ------------QSSIIGEILHKDADQFGWSVSNATFDWSK---------LVSSVQDYIH  262
                           I   I  +D  Q    V  A  D ++         L+S    ++ 
Sbjct  108  LTGYRHRAFYNGHGGISKRIGVEDILQRVKKVEAAETDITRHQLQRNGVQLISGTARFLA  167

Query  263  GLNFKYRVDLRDKKVKYENMLGTFKDAHTLTLTNDAKKKGPTDVTFR-----RAVIAVGG  317
            G +               +ML    +    T T DAK+    D+  R     + ++ VG 
Sbjct  168  GDS---------------HMLAVLSNEEYETAT-DAKRHTEADICKRVLTADKFLVCVGT  211

Query  318  RPK--PLSCPGWEHALSSDDIF--SKPDAPGKTLVVGASYVALECAGFLKG-QGFDVTIM  372
            RP   P      E    SD +        P + ++VG   V +E A  +    G DVT++
Sbjct  212  RPARHPDIPFDGETIFDSDQLLWGKVKMVPRRLIIVGGGVVGMEYASMMTIIPGTDVTVI  271

Query  373  -VRSILLRGFDQDIARRIGEYMESESGIAFIKESVPTSIVKLENGQFQVTHTTGQDVY-D  430
              R  +L   D++++  +  Y  +++G  F+       + K   G+  V   +G+ V  D
Sbjct  272  DGRKEILNMADKEVSEALC-YSMAQTGTRFLVGETIKKVEKNSKGEVLVRLDSGKTVVGD  330

Query  431  TILNATGRSPDVQKLNLDAAGVALNPKSGRIHVVNE-QTSTPNIYALGDVIDAPELTPVA  489
             +L   GR  +V+ L+L++ G+  + K GRI V N  QT  P+IYA GD+I  P L   +
Sbjct  331  GLLYTVGRQGNVEGLHLESVGIHPD-KRGRIKVDNNFQTEVPHIYAAGDIIGFPGLASTS  389

Query  490  IQAGKLLSRRLFGNGTT------------LMDYTKICTAVFTPVEYGCCGLSEEDAIASA  537
            ++ G+L S  +                  LMD            E    G+     I+  
Sbjct  390  MEQGRLASVHMRTASPVATKPSKELPDDKLMDDPDRMRTRMRSGEVFPFGIYTVPEISMV  449

Query  538  GRENVEVYHQNFTPLEWSLSHDRPLAK-------ECYAKLIV--DTTQQKRVLGFHYLGP  588
            G+ N +   Q   P E  ++    LA+         + K+I   +T Q   +LG H +G 
Sbjct  450  GK-NEQQLTQEQVPYEVGMARYEELARGQMLGGVPGFLKIIFCPNTLQ---ILGVHAIGE  505

Query  589  NAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIF  624
             A E+     + +    T + F N V  +PT AE +
Sbjct  506  GATEIIHIGQVVMSTGGTLEYFRNAVMNYPTLAEAY  541

>H257_16541
Length=494

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 110/443 (25%), Positives = 183/443 (41%), Gaps = 27/443 (6%)

Query  196  VKPSPVGSTWGLGGTCVNVGCIPKK-LMHQSSIIGEILHKDADQFGWSVSNATFDWSKLV  254
            +K + + S   LGGTC+NVGCIP K L+H + +     H +    G  V N + D+ +L+
Sbjct  51   LKTACIESRGSLGGTCLNVGCIPSKALLHGTHLYHSAQH-NFKSVGIKVDNVSIDFDQLM  109

Query  255  SSVQDYIHGLNFKYRVDLRDKKVKYENMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIA  314
             S    +  L        +  KV Y    G       +++  +A   G   V  +  +IA
Sbjct  110  KSKDKTVKILTGGIEGLFKKNKVDYIKGYGKVVAKGQVSVALNA--GGNQTVNTKNILIA  167

Query  315  VGGR-----PKPLSCPGWEHALSSDDIFSKPDAPGKTLVVGASYVALECAGFLKGQGFDV  369
             G       P P+   G +  + S    +    P   +VVG   + LE        G  +
Sbjct  168  TGSEVTPLPPVPVDNEGGK-IIDSTGALALKRVPKHLVVVGGGVIGLEMGSVYGRLGSKI  226

Query  370  TIMVRS-ILLRGFDQDIARRIGEYMESESGIAF-IKESVPTSIVKLENGQFQVTHTTGQD  427
            T++  +  +    D ++ +   + + ++ G+ F + + V  S V  +     V    G +
Sbjct  227  TVVEYADKICPTMDHEVTKEFQKLL-TKQGMTFKLGQKVTASKVDGDVVTLTVEPAAGGE  285

Query  428  V----YDTILNATGRSPDVQKLNLDAAGVALNPKSGRIHV--VNEQTSTPNIYALGDVID  481
                  D +L ATGR P    L L+  G+  + K GRI V   N QT+   I+A+GDVI+
Sbjct  286  ATTIEADCVLVATGRRPFTAGLGLEEMGIQTD-KFGRIKVNLSNFQTNVDGIFAIGDVIE  344

Query  482  APELTPVAIQAGKLLSRRLFGNGTTLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGREN  541
               L   A + G  +   + G    + +Y  I   ++T  E    G +EE+   +    N
Sbjct  345  GAMLAHKAEEEGIAVVETIAGKHGHV-NYDAIPGVIYTFPEVASVGKTEEELKTANVAYN  403

Query  542  VEVYHQNFTPLEWSLSHDRPLAKECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAI  601
            V  +         ++       K   AK         ++LG H +  NAGE+     + I
Sbjct  404  VGKFPMMANSRARAVGETDGFVKVLAAK------DDDKILGIHIIASNAGEMISEGVLGI  457

Query  602  KLNATYDDFINTVGIHPTTAEIF  624
            +  A+ +D   T   HPT +E F
Sbjct  458  EYGASAEDIGRTCHAHPTLSEAF  480

>CCI39993
Length=550

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 124/518 (24%), Positives = 213/518 (41%), Gaps = 77/518 (15%)

Query  158  DADVKYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCI  217
            D      +DL+VIG G  G  C+ +++K G+ V ++D  +          GG CV+ G +
Sbjct  38   DLKASEHYDLIVIGSGPAGQKCAIDSAKHGKSVAIIDKNEMH--------GGVCVHTGTV  89

Query  218  PKKLMHQSSIIGEILHKDA--------------DQFGWS--------VSNATFDWSK--L  253
            P K   ++     ILH  A               +FG          V NA  D ++  L
Sbjct  90   PSKTFREA-----ILHLTAHRHRNFYTGLSSPKKRFGIEDILTRVRKVENAETDITRHQL  144

Query  254  VSSVQDYIHGLNFKYRVDLRDKKVKYENMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVI  313
            V +  + I+G   ++  D   K + Y+  +   K         +        +T  + +I
Sbjct  145  VRNNVELING-TARFLPDPSKKMLYYQ--IAHLKQQRMEIAIFELIFVNGKILTADKFLI  201

Query  314  AVGGRPKPLSCPGWEHAL--SSDDIF--SKPDAPGKTLVVGASYVALECAGFLKG-QGFD  368
            AVG RP       ++  +   SD I        P + +VVGA  + +E A  +    G  
Sbjct  202  AVGTRPARRDDIVFDGQMIFDSDQILWGGVKSVPKRLIVVGAGVIGMEYASMMSIIPGAQ  261

Query  369  VTIM-VRSILLRGFDQDIARRIGEYMESESGIAFIKESVPTSIVKLENGQFQVTH-TTGQ  426
            VT++  R  +L   D+++   +   M       +++E++    V+L N    + H  +G+
Sbjct  262  VTVIDGRKEILEMADREVVEALTYAMRQTGSRFYMEETI--KCVELSNKDEVIIHLNSGK  319

Query  427  DVY-DTILNATGRSPDVQKLNLDAAGVALNPKSGRIHV-VNEQTSTPNIYALGDVIDAPE  484
             +  D +L   GR  + + L+L A G+  + K G I V  N QTS P+IYA GD    P 
Sbjct  320  TIVGDGLLYTVGRQGNTEGLDLSAIGLQTD-KRGLIKVNENFQTSVPHIYAAGDCTGFPA  378

Query  485  LTPVAIQAGKLLSRRLFGNGTTLMD-----------YTKICTAVFTPVEYGCCGLSEEDA  533
            L   +++ G+L S  +  +  T               T++ +  F P  +G   + E   
Sbjct  379  LASTSMEQGRLASVHMRTSMPTNTSGHAEPTDPQHMRTRMRSGDFFP--FGIYTVPE---  433

Query  534  IASAGRENVEVYHQNFTPLEWSLSHDRPLAK-------ECYAKLIVDTTQQKRVLGFHYL  586
            I+  G+   ++  +     E  ++    LAK         + K+I   T    +LG H +
Sbjct  434  ISMVGKNEYQLTKEGIA-YEVGVARYEELAKGQMLGGVPGFLKIIFCPTTLN-ILGVHAI  491

Query  587  GPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIF  624
            G  A E+     + +    T + F N V  +PT AE +
Sbjct  492  GEGATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  529

>PYIR_21896
Length=518

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 122/499 (24%), Positives = 208/499 (42%), Gaps = 74/499 (15%)

Query  164  DWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMH  223
            ++DLVVIG G     C+ E++K G++V V+D         T+ +GG CV+ G IP K   
Sbjct  37   NYDLVVIGSGPSATQCAIESAKKGKRVAVVDK-------KTF-VGGVCVHTGTIPSKTFR  88

Query  224  QSSIIGEILHKDADQ----FGWSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKY  279
            ++     +LH    +    +G S S  T     ++  V+  ++       VD+   +   
Sbjct  89   EA-----VLHLSGYRHHGFYGKSYSMKTVTIDDILYRVKRVVNS-----EVDISIVRDTP  138

Query  280  ENMLGTFKDAHTLTLTNDAKKKGPTDVTFRRA---VIAVGGRP--KPLSCPGWEHALSSD  334
            +   G   DA       D+       V+  RA   +IA G RP   PL     +    SD
Sbjct  139  DAAGG---DA------GDSDHDAANTVSRLRADKFLIACGTRPAHNPLVPIDGKVIFDSD  189

Query  335  DIFSKP--DAPGKTLVVGASYVALECAGFLKG-QGFDVTIM-VRSILLRGFDQDIARRIG  390
             I S    + P   +VVGA  + +E A  +    G  VT++  RS +L   D +I   + 
Sbjct  190  QILSGDIRELPRSLIVVGAGVIGMEYASMMNVVPGHSVTVVDGRSEILSFCDDEIISNLT  249

Query  391  EYMESESGIAFIKESVPTSIVKLENGQFQVTHTTGQ-DVYDTILNATGRSPDVQKLNLDA  449
              M S+     + E++   + K E+G   V   +G+    D +L   GR      LNL+A
Sbjct  250  YEMRSKGARFLLGETIK-HVEKTESG-VTVHFNSGKITSADALLYTVGRQAATDGLNLEA  307

Query  450  AGVALNPKSGRIHVVNE--QTSTPNI------------------YALGDVIDAPELTPVA  489
              ++ NP+   +  VN+  QT+ P++                  YA GD I AP L   +
Sbjct  308  VDLSRNPRG--LLTVNKSYQTNQPHMPVLQMGFAHSISDENVCSYAAGDCIGAPSLASTS  365

Query  490  IQAGKLLSRRLFGNG----TTLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVY  545
            ++ G+L +  ++       T+ ++       ++T  E    G +E+         N E+ 
Sbjct  366  MEQGRLAACHMWDQEEQLVTSQLENGNYPYGIYTIPEISMVGKTEQQLTKEG--LNFEIG  423

Query  546  HQNFTPLEWSLSHDRPLAKECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNA  605
               ++  E +             K++ D T  K + G H +G  A E+     +A+ +  
Sbjct  424  IAKYS--ELAKGQMSGSTAGGMLKILFDPTTLK-LFGVHAIGEGATEIIHIGQVAMAMGC  480

Query  606  TYDDFINTVGIHPTTAEIF  624
            +   F + V  +PT AE +
Sbjct  481  SITYFRDAVFNYPTLAEAY  499

>HYAP_08069
Length=255

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/214 (29%), Positives = 99/214 (46%), Gaps = 15/214 (7%)

Query  164  DWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKK-LM  222
            D+DLVVIGGG GG   + +A++LG K   ++        S   LGGTC+NVGCIP K L+
Sbjct  34   DYDLVVIGGGPGGYVAAIKAAQLGLKTACVE--------SRGKLGGTCLNVGCIPSKALL  85

Query  223  HQSSIIGEILHKDADQFGWSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYENM  282
            H + ++    H +   +G    N T ++ +++ + +  +  L           KV Y   
Sbjct  86   HSTHLLHTAQH-EFKSYGIDAPNVTANFPQMMKAKEKAVRTLTAGIESLFSKNKVTYIKG  144

Query  283  LGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPL-SCPGWEHA---LSSDDIFS  338
            +G       +++T  A ++G   +T +  ++A G    PL   P    A   + S    +
Sbjct  145  VGKLAAKGQVSVTL-ADRQGNGTLTAKNIILATGSEVTPLPPVPVDNDAGKIVDSTGALA  203

Query  339  KPDAPGKTLVVGASYVALECAGFLKGQGFDVTIM  372
                P   +VVGA  + LE     K  G  VT++
Sbjct  204  LTRVPEHLVVVGAGVIGLELGSVYKRLGAKVTVV  237

>PYAR_16664
Length=577

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 102/383 (27%), Positives = 168/383 (44%), Gaps = 61/383 (16%)

Query  165  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLM--  222
            +DL+VIG G  G  C+ + +K G+ V ++D            +GG C++ G +P K    
Sbjct  64   FDLIVIGSGPAGQKCAIDHAKHGKSVAIID--------KRDMVGGVCIHTGTVPSKTFRE  115

Query  223  ---------HQSSIIGEILHK------DADQFGWSVSNATFDWSK--LVSSVQDYIHG--  263
                     H+S   GE   K      D  Q    V +A  D ++  L+ +  + I+G  
Sbjct  116  AILHLTAHRHRSFYDGESEPKKRFGIEDVLQRVRKVESAETDITRHQLLRNGIELINGTA  175

Query  264  -----------LNFKYRVDLRDKKVKY-----ENMLGTFKDAHTLTLTNDAKKKGPTDVT  307
                       +  +  ++L +   ++       M+    +    T T D K+    D+ 
Sbjct  176  RFXXXXCDRALILLRNGIELINGTARFLPDPSMKMVAVLSNDSYDTPT-DTKRHTSADIC  234

Query  308  FR-----RAVIAVGGRP-KPLSCP-GWEHALSSDDIF-SKPDA-PGKTLVVGASYVALEC  358
             R     + +IAVG RP +    P   +    SD I     DA P + +VVGA  + +E 
Sbjct  235  KRVLTADKFLIAVGTRPARREDIPFDGKTIFDSDQILWGGVDAVPKRLIVVGAGVIGMEY  294

Query  359  AGFLKG-QGFDVTIM-VRSILLRGFDQDIARRIGEYMESESGIAFIKESVPTSIVKLENG  416
            A  +    G +VT++  R  +L   D+++A  + +Y   +SG  F  +    S+ K  NG
Sbjct  295  ASMMSIIPGSEVTVIDGRKEILDMADKEVAEAL-KYAMRQSGTRFYTDETIKSVEKAANG  353

Query  417  QFQVTHTTGQDVY-DTILNATGRSPDVQKLNLDAAGVALNPKSGRIHVV-NEQTSTPNIY  474
            +  V   +G+ +  D +L   GR      LNL A G+  + K G + V  N +TS P+IY
Sbjct  354  EVIVKLNSGKTIIGDGLLYTVGRQGSTDGLNLAAVGLETD-KRGLLQVDDNFRTSVPHIY  412

Query  475  ALGDVIDAPELTPVAIQAGKLLS  497
            A GD I  P L   +++ G+L S
Sbjct  413  AAGDCIGYPALASTSMEQGRLAS  435

>PITG_19065
Length=416

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 100/409 (24%), Positives = 175/409 (43%), Gaps = 41/409 (10%)

Query  242  SVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYENMLGTFKDAHTLTLTNDAK-K  300
            ++ +  +   ++VSS +D +       R  L+  +V        F++ H +++  D   K
Sbjct  5    TIEDILYRVQRVVSSEEDVV-------RAQLKAARVDVVPGFARFENEHEISIVRDEDDK  57

Query  301  KGPTDVTFRRAV------------IAVGGRP--KPLSCPGWEHALSSDDIFSKP--DAPG  344
            K  + VT R  V            IA G RP   PL     +  + SD I S+     P 
Sbjct  58   KKNSSVTGRSNVDSLSRIKADKFLIACGTRPAHNPLIPIDGKVVIDSDQILSRDMHQLPR  117

Query  345  KTLVVGASYVALECAGFLKG-QGFDVTIM-VRSILLRGFDQDIARRIGEYMESESGIAFI  402
              +V+GA  + +E A  +    G  VT++  R  +L   D++I   +   M+S      +
Sbjct  118  SLIVLGAGVIGMEYASMVNVVPGHTVTVVDGRPDILSFCDREIISNLTYEMQSNGARFLL  177

Query  403  KESVPTSIVKLENGQFQVTHTTGQDV-YDTILNATGRSPDVQKLNLDAAGVALNPKSGRI  461
             E+V    V+  + + +V   +G+ +  D +L   GR      LNL+A G++ N + G I
Sbjct  178  GETVKK--VETTDKRVKVFFNSGKALSADALLYTVGRQAATDGLNLEAVGLSRNHR-GLI  234

Query  462  HV-VNEQTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLFG-----NGTTLMDYTKICT  515
            +V  N QT  P+IYA GD I AP L   +++ G+L S  ++        T+ ++      
Sbjct  235  NVNKNYQTDQPHIYAAGDCIGAPALASTSMEQGRLASCHMWNPDEELAATSQLENGNYPY  294

Query  516  AVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAKECYAKLIVDTT  575
             ++T  E    G +E+         N E+    ++  E +             K++ D  
Sbjct  295  GIYTIPEISMVGQTEQQLTKDC--VNYEIGIAKYS--ELAKGQMMGAMAGGTLKILFDPD  350

Query  576  QQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIF  624
              K V G H +G  A E+     +A+ +  +   F + V  +PT AE +
Sbjct  351  TLK-VFGVHAIGEGATEIIHIGQVAMAMGCSLTYFRDAVFNYPTLAEAY  398

>PPTG_13000
Length=387

 Score = 76.6 bits (187),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 91/336 (27%), Positives = 145/336 (43%), Gaps = 22/336 (7%)

Query  301  KGPTDVTFRRAVIAVGGRPKPLSCPGWEHA----LSSDDIFSKPDAPGKTLVVGASYVAL  356
            KG   V  +  +IA G    PL     ++A    + S         P   +VVGA  + L
Sbjct  48   KGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKIIDSTGALELKRVPEHLVVVGAGVIGL  107

Query  357  ECAGFLKGQGFDVTIM-VRSILLRGFDQDIARRIGEYMESESGIAF-IKESVPTSIVKLE  414
            E     K  G  VT++        G D++  +   + ++ + G+ F     V +S V  +
Sbjct  108  ELGSVYKRLGAKVTVVEFLDAACPGMDKEAVKEFTKLLKKQ-GLDFKFGTKVTSSEVNGD  166

Query  415  NGQFQVTHTTGQDVY----DTILNATGRSPDVQKLNLDAAGVALNPKSGRIHVVNE-QTS  469
              +     + G D      DT+L ATGR      L L+  G+  + K GRI V +  +T 
Sbjct  167  VVKLTTEPSKGGDASTIECDTVLVATGRRAFTAGLGLEQMGIQTD-KLGRIEVDDAFRTQ  225

Query  470  TPNIYALGDVIDAPELTPVAIQAGKLLSRRLFGNGTTLMDYTKICTAVFTPVEYGCCGLS  529
             P I+A+GDVI    L   A + G      + G    + +Y  +   ++T  E+   G +
Sbjct  226  VPGIFAIGDVIKGAMLAHKAEEEGIACVENIAGKHGHV-NYGAVPGVIYTFPEFASVGKT  284

Query  530  EEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAK-ECYAKLIVDTTQQKRVLGFHYLGP  588
            EE+  A    E +E Y+    P+  + S  R +A+ +   K++ D    K +LG H +  
Sbjct  285  EEELKA----EGIE-YNVGKFPM-MANSRARTVAESDGLVKVLADKKTDK-LLGVHIIAS  337

Query  589  NAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIF  624
            NAGE+     I I+  A  +D   T   HPT +E F
Sbjct  338  NAGEMIAEGVIGIEYGAASEDLARTCHAHPTLSEAF  373

>PHYSO_562795
Length=415

 Score = 70.9 bits (172),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 97/408 (24%), Positives = 171/408 (42%), Gaps = 40/408 (10%)

Query  242  SVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYENMLGTFKDAHTLTLTND---A  298
            ++ +  +   ++V S +D +       R  L+  +V        F+  H +++  D   A
Sbjct  5    TIEDILYRVQRVVRSEEDVV-------RAQLKAARVDVIPGFARFESEHEISVVRDEADA  57

Query  299  KKKGPTD---------VTFRRAVIAVGGRP--KPLSCPGWEHALSSDDIFSKP--DAPGK  345
            K+              V   + +IA G RP   PL     +  + SD I S+     P  
Sbjct  58   KRSSSNSSSNLDSLSRVMADKFLIACGTRPAHNPLVPIDGKVIIDSDQILSRDMHQLPRS  117

Query  346  TLVVGASYVALECAGFLKG-QGFDVTIM-VRSILLRGFDQDIARRIGEYMESESGIAFIK  403
             +V+GA  + +E A  +    G  VT++  R  +L   D++I   +   M+S      + 
Sbjct  118  LIVMGAGVIGMEYASMVNVVPGHSVTVVDGRPDILSFCDREIISNLTYEMQSNGARFLLG  177

Query  404  ESVPTSIVKLENGQFQVTHTTGQDV-YDTILNATGRSPDVQKLNLDAAGVALNPKSGRIH  462
            E+V    V+    + +V   +G+ +  D +L   GR      LNL+A G++ N + G I+
Sbjct  178  ETVKK--VETTENRVKVFFDSGKVLSADALLYTVGRQASTDGLNLEAVGLSRNHR-GLIN  234

Query  463  V-VNEQTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLFG-----NGTTLMDYTKICTA  516
            V  N QT  P+IYA GD I AP L   +++ G+L S  ++        T+ +D       
Sbjct  235  VNQNYQTDQPHIYAAGDCIGAPALASTSMEQGRLASCHMWNPDEELKVTSQLDNGNYPYG  294

Query  517  VFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAKECYAKLIVDTTQ  576
            ++T  E    G +E+         N EV    ++  E +             K++ D   
Sbjct  295  IYTIPEISMVGQTEQQLTKDC--VNYEVGIAKYS--ELAKGQMMGAMAGGTLKILFDPDT  350

Query  577  QKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIF  624
             K + G H +G  A E+     +A+ +  +   F + V  +PT AE +
Sbjct  351  LK-LFGVHAIGEGATEIIHIGQVAMAMGCSLTYFRDAVFNYPTLAEAY  397

>HYAP_13613
Length=423

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 54/219 (25%), Positives = 89/219 (41%), Gaps = 34/219 (16%)

Query  165  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQ  224
            +DLVVIG G     C+ +++K G++V ++D            LGG CV+ G IP K   +
Sbjct  33   YDLVVIGSGPSATQCALDSAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFRE  84

Query  225  SSIIGEILHKDADQ----FGWSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYE  280
            +     +LH    +    +G S S  T     ++  VQ  +       R  L+  +V   
Sbjct  85   A-----VLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDVI  139

Query  281  NMLGTFKDAHTLTLTNDAKKK-------------GPTDVTFRRAVIAVGGRP--KPLSCP  325
                 F+ AH +++  +   K               T V   + ++A G RP   PL   
Sbjct  140  PGFARFESAHEISIVKEGAAKDKAETGQCSNNMDARTRVRADKFLVACGTRPAHNPLVPI  199

Query  326  GWEHALSSDDIFSK--PDAPGKTLVVGASYVALECAGFL  362
              +  + SD I  +     P   +VVGA  + +E A  +
Sbjct  200  DGKIVIDSDQILKRGMQQLPRSLIVVGAGVIGMEYASMI  238

>PPTG_24712
Length=67

 Score = 50.1 bits (118),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 46/67 (69%), Gaps = 5/67 (7%)

Query  160  DVKYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPK  219
            DV YD+  +VIGGGSGG+A ++ A+  G KVLV++  +        GLGGTCVN GC+PK
Sbjct  4    DVVYDY--MVIGGGSGGMASARRAATFGAKVLVVERGREF---DGMGLGGTCVNFGCVPK  58

Query  220  KLMHQSS  226
            K+M  ++
Sbjct  59   KVMFNTA  65

>PITG_19802
Length=185

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 46/157 (29%), Positives = 71/157 (45%), Gaps = 9/157 (6%)

Query  469  STPNIYALGDVIDAPELTPVAIQAGKLLSRRLFGNGTTLMDYTKICTAVFTPVEYGCCGL  528
            S P I+A+GDVI    L   A + G      + G    + +Y  I   ++T  E+   G 
Sbjct  23   SVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAGKHGHV-NYGAIPGVIYTFPEFASVGK  81

Query  529  SEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAK-ECYAKLIVDTTQQKRVLGFHYLG  587
            +EE+  A     NV  +     P+  + S  R +A+ +   K++ D    K +LG H + 
Sbjct  82   TEEELKAEGIEYNVGKF-----PM-MANSRARTIAEADGLVKVLADKKTDK-LLGVHIIA  134

Query  588  PNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIF  624
             NAGE+     I I+  A  +D   T   HPT +E F
Sbjct  135  GNAGEMIAEGVIGIEYGAASEDLARTCHAHPTLSEAF  171

>SPRG_04231
Length=90

 Score = 47.8 bits (112),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 22/52 (42%), Positives = 30/52 (58%), Gaps = 0/52 (0%)

Query  576  QQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIFTTL  627
            + K V+G H  G  A E+ Q  G+A+K+ A   DF N V IHPT +E   T+
Sbjct  9    KDKTVVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  60

>PITG_18935
Length=480

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/143 (27%), Positives = 63/143 (44%), Gaps = 13/143 (9%)

Query  182  EASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKK-LMHQSSIIGEILHKDADQFG  240
            +A++LG K   ++        S   LGGTC+NVGCIP K L+H + ++    H D   +G
Sbjct  47   KAAQLGMKTACIE--------SRGKLGGTCLNVGCIPSKALLHSTHLLHTAQH-DFKSYG  97

Query  241  WSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYENMLGTFKDAHTLTLT-NDAK  299
                    ++ +++ S +  +  L     +  +  KV Y    G       +++  ND  
Sbjct  98   IDAPEVKANFPQMMKSKEKAVKTLTGGIELLFKKNKVTYIKGHGKISAQGEISVALND--  155

Query  300  KKGPTDVTFRRAVIAVGGRPKPL  322
             KG   V  +  +IA G    PL
Sbjct  156  NKGNETVKAKNIIIATGSEVTPL  178

>PHALS_10960
Length=702

 Score = 40.8 bits (94),  Expect = 0.025, Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 76/180 (42%), Gaps = 31/180 (17%)

Query  232  LHKDADQFGWSVSNATFDWSKLVSSVQDYIHGLN-FKYRVDLRDKKVKYENMLGTFKDAH  290
            L  +AD  G       F+ +K++   +++   L  F+ ++ L    VK+    G   DA 
Sbjct  402  LFDEADVIG-----GQFNMAKIIPGKEEFHETLRYFQKQLKLNGVNVKH----GRRVDAA  452

Query  291  TLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEH--ALSSDDIFSKPDAPGKTL-  347
             LT  +           F + V+A G  P+PL  PG +H   LS  D+  K    G+ + 
Sbjct  453  DLTAGD-----------FDKVVMASGVLPRPLKIPGADHPMVLSYMDVLKKKSKVGQRVA  501

Query  348  VVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGEYMESESGIAFIKESVP  407
            ++GA  +  + A FL   G   +  V  +  R +  D    +        G+A IK SVP
Sbjct  502  IIGAGGIGFDVAEFLTHVGESTSSSV-EVFAREWGIDTTNSV------RGGVAGIKSSVP  554

>PHYCA_524942
Length=1028

 Score = 39.7 bits (91),  Expect = 0.064, Method: Compositional matrix adjust.
 Identities = 70/289 (24%), Positives = 119/289 (41%), Gaps = 27/289 (9%)

Query  305  DVTFRRAVIAVGGRPKPLSCPGWEHALSSDDIFSKPDAPGKTLVVGASYVALECAGFLKG  364
            +V + R VIA G        PG +  L    ++         +  G     +E AG  K 
Sbjct  105  EVPYDRIVIATGASALVPRLPGTK--LRGVFVYRSIADLNNIIEHGEKQAKIEAAGAAKA  162

Query  365  QGFDVTIMVRSI------LLRGFDQDIARRIGEYMESESGIAFIKESVPTSIV-KLENGQ  417
               D+ + VR I      + R  D D A+ +   + ++ GI  + E     I+   ENG 
Sbjct  163  V-HDLNVSVRIINRGTQLMSRQLDADGAKVLHNEIVNKFGIDVLYEKSTQEIIGSQENGV  221

Query  418  FQVTHTTGQDVYD--TILNATGRSPDVQKLNLDAAGVALNPKSGRIHVVNEQTSTPNIYA  475
              V  T G+   D   I+ ATG  P  +  +  ++G+ L  + G +     + S P++YA
Sbjct  222  EAVQFTNGERFDDICMIIFATGIKPRDELAH--SSGLELGNRGGILINDFLECSVPDVYA  279

Query  476  LGDVIDAPELTPVAIQAGKLLSRRLFGNGTTLMDYTKICTAVFTPVEYGCCGLSEEDAIA  535
            LG+ I   +LT   +  G  ++  L  N T        C ++   + +    +S +  + 
Sbjct  280  LGECISHRDLTYGLVAPGYEMADVLAKNFT--------CGSLENRIPFPGGDISTKLKLM  331

Query  536  SAGRENVEVYHQNFT--PLEWSLSHDRPLAKECYAKLIVDTTQQKRVLG  582
                 +   Y   F   P E +L+++ PL K  Y KL   +   K++LG
Sbjct  332  GMEVGSFGDYFPEFIKEPFE-TLTYNNPLEK-VYKKLFF-SADGKKLLG  377

>HYAP_08068
Length=100

 Score = 36.2 bits (82),  Expect = 0.080, Method: Composition-based stats.
 Identities = 20/56 (36%), Positives = 28/56 (50%), Gaps = 1/56 (2%)

Query  569  KLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIF  624
            K++ D    K +LG H +  NAGE+     I I+  A  +D   T   HPT +E F
Sbjct  17   KVLADKKTDK-LLGVHIIASNAGEMISEGVIGIEYGAASEDLARTCHAHPTLSEAF  71

>PYIW_27568
Length=128

 Score = 36.6 bits (83),  Expect = 0.12, Method: Composition-based stats.
 Identities = 31/120 (26%), Positives = 52/120 (43%), Gaps = 12/120 (10%)

Query  508  MDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLA---K  564
            ++Y  I   ++T  E    G +EE       +E    Y+    P+   +++ R  A    
Sbjct  4    VNYNAIPGVIYTFPEVASVGKTEEQL-----KEEGVAYNVGKFPM---MANSRARAVGEA  55

Query  565  ECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIF  624
            +   K+I D    K +LG H +  NAGE+     + ++  A  +D   T   HPT +E F
Sbjct  56   DGLVKVIADKATDK-ILGVHIIASNAGEMISEGVLGMEYGAASEDIARTCHAHPTLSEAF  114

>CCI40989
Length=552

 Score = 38.1 bits (87),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 38/84 (45%), Gaps = 8/84 (10%)

Query  156  TSDADVKYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVG  215
            T D  ++  WD V+IGGG  GL  +   +K G++V VL+            +GG  V   
Sbjct  5    TIDHIIRKKWDAVIIGGGHNGLVAAAYLAKAGKQVCVLE--------KRHVIGGAAVTEE  56

Query  216  CIPKKLMHQSSIIGEILHKDADQF  239
              P  L  ++S +  +   D  ++
Sbjct  57   IFPGFLFSRASYVFSLFRPDIIEY  80

>SPRG_17626
Length=148

 Score = 36.2 bits (82),  Expect = 0.18, Method: Composition-based stats.
 Identities = 30/117 (26%), Positives = 52/117 (44%), Gaps = 6/117 (5%)

Query  508  MDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAKECY  567
            ++Y  I   V+T  E    G +EE+  A+    NV  +     P+  + S  R + +   
Sbjct  24   VNYNAIPGVVYTFPEVASVGKTEEELKAANVAYNVGKF-----PM-MANSRARTVGETDG  77

Query  568  AKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIF  624
               I+      ++LG H +  NAGE+     + ++  A+ +D   T   HPT +E F
Sbjct  78   FVKILAAKDDDKILGIHIIASNAGEMISEGVLGLEYGASAEDIGRTCHAHPTLSEAF  134

>PITG_00703
Length=703

 Score = 37.7 bits (86),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 44/165 (27%), Positives = 70/165 (42%), Gaps = 28/165 (17%)

Query  248  FDWSKLVSSVQDYIHGLN-FKYRVDLRDKKVKYENMLGTFKDAHTLTLTNDAKKKGPTDV  306
            F+ +K +   +++   L  F+ ++ L+  KVK    LG   +A  LT             
Sbjct  413  FNMAKTIPGKEEFYETLRYFEKQLKLKGVKVK----LGQHVEAADLTTG-----------  457

Query  307  TFRRAVIAVGGRPKPLSCPGWEH--ALSSDDIFSKPDAP--GKTLVVGASYVALECAGFL  362
             F + VIA G  P+ L  PG +H   LS  D+  K  AP   K  ++GA  +  + A FL
Sbjct  458  AFDKVVIATGVLPRALKIPGADHPKVLSYLDVL-KNKAPVGNKVAIIGAGGIGFDVAEFL  516

Query  363  KGQGFDVTIMVRSILLRGFDQDIARRIGEYMESESGIAFIKESVP  407
               G   +  V  +  R +  D    +        G+A +K S+P
Sbjct  517  AHVGESTSSSV-DVFAREWGIDTTNSV------RGGVAGVKPSIP  554

>PPTG_08060
Length=725

 Score = 37.7 bits (86),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 60/247 (24%), Positives = 100/247 (40%), Gaps = 41/247 (17%)

Query  232  LHKDADQFGWSVSNATFDWSKLVSSVQDYIHGLN-FKYRVDLRDKKVKYENMLGTFKDAH  290
            L   AD  G       F+ +K +   +++   L  F+ ++ L+   VK    LG   +A 
Sbjct  424  LFDQADAIG-----GQFNMAKTIPGKEEFYETLRYFEKQLKLKGVNVK----LGQHVEAA  474

Query  291  TLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEH--ALSSDDIFSKPDAPGKTL-  347
             LT              F + VIA G  P+ L  PG +H   LS  D+       GK + 
Sbjct  475  DLTTG-----------AFDKVVIATGVLPRTLKIPGADHPKVLSYIDVLKHKAPVGKKVA  523

Query  348  VVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGEYMESESGIAFIKESVP  407
            ++GA  +  + A FL   G   +  V  +  R +  D    +        G+A IK S+P
Sbjct  524  IIGAGGIGFDVAEFLSHVGESTSSSV-DVFAREWGIDTTNSV------RGGVAGIKPSIP  576

Query  408  TSIVKLENGQFQVTHTTGQDVYDT---ILNATGRSPDVQKL------NLDAAGVALNPKS  458
                ++   Q + T   G+D+  T   I   + +  DV+ +       +D  G+    K 
Sbjct  577  PQAREIYLMQRKSTK-HGKDLGKTTGWIHRLSLKHRDVKMIGGVSYDKVDDEGLHYTDKK  635

Query  459  GRIHVVN  465
            G+ HV++
Sbjct  636  GKKHVLD  642

>H257_05020
Length=713

 Score = 37.4 bits (85),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 32/115 (28%), Positives = 56/115 (49%), Gaps = 5/115 (4%)

Query  343  PGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGEYMESESGIAFI  402
            P K  VVGA    L CA     +G DVT+  +   + G   ++A++I    E    + + 
Sbjct  382  PLKVAVVGAGPAGLACASVAAERGHDVTLYDKHEEIGG-QFNLAKQIPGKEEFYETLRYF  440

Query  403  KESVPTSIVKLENGQFQVTHTTGQDVYDTILNATGRSPDVQKLNLDAAGVALNPK  457
             + +    VK++ GQ+        + +D ++ ATG +P  +KL ++  G A +PK
Sbjct  441  GKQIKKHGVKVQLGQYVDAQHLIDNQFDRVVMATGITP--RKLTIE--GAASSPK  491

>H257_05019
Length=713

 Score = 37.4 bits (85),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 32/115 (28%), Positives = 56/115 (49%), Gaps = 5/115 (4%)

Query  343  PGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGEYMESESGIAFI  402
            P K  VVGA    L CA     +G DVT+  +   + G   ++A++I    E    + + 
Sbjct  382  PLKVAVVGAGPAGLACASVAAERGHDVTLYDKHEEIGG-QFNLAKQIPGKEEFYETLRYF  440

Query  403  KESVPTSIVKLENGQFQVTHTTGQDVYDTILNATGRSPDVQKLNLDAAGVALNPK  457
             + +    VK++ GQ+        + +D ++ ATG +P  +KL ++  G A +PK
Sbjct  441  GKQIKKHGVKVQLGQYVDAQHLIDNQFDRVVMATGITP--RKLTIE--GAASSPK  491

>HYAP_03065
Length=701

 Score = 37.0 bits (84),  Expect = 0.44, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 61/140 (44%), Gaps = 26/140 (19%)

Query  232  LHKDADQFGWSVSNATFDWSKLVSSVQDYIHGLN-FKYRVDLRDKKVKYENMLGTFKDAH  290
            L   AD  G       F+ +K+V   +++   L  F+ ++ LR   VK    LG   +A 
Sbjct  400  LFDQADAIG-----GQFNMAKIVPGKEEFYETLRYFEKQLKLRGVNVK----LGHRVEAA  450

Query  291  TLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEH--ALSSDDIFSKPDAP--GKT  346
             L               F + VIA G  P+ L+ PG +H   LS  D+  K +AP   K 
Sbjct  451  ELM-----------SGAFDKVVIATGVVPRSLTIPGADHPKVLSYIDVL-KNEAPVGQKV  498

Query  347  LVVGASYVALECAGFLKGQG  366
             ++GA  +  + A FL  +G
Sbjct  499  AIIGAGGIGFDVAEFLTHEG  518

>SPRG_18643
Length=85

 Score = 33.9 bits (76),  Expect = 0.45, Method: Composition-based stats.
 Identities = 14/30 (47%), Positives = 22/30 (73%), Gaps = 0/30 (0%)

Query  165  WDLVVIGGGSGGLACSKEASKLGQKVLVLD  194
            +DLVVIG G  G  C+ +++K G+KV ++D
Sbjct  49   FDLVVIGSGPSGQKCAIDSAKHGKKVAIID  78

>PYAR_15823
Length=705

 Score = 37.0 bits (84),  Expect = 0.46, Method: Compositional matrix adjust.
 Identities = 72/296 (24%), Positives = 122/296 (41%), Gaps = 57/296 (19%)

Query  232  LHKDADQFGWSVSNATFDWSKLVSSVQDYIHGLN-FKYRVDLRDKKVKYENMLGTFKDAH  290
            L++ A++ G       F+ +K++   +++   L  F  ++ L+  KVK    LG    A 
Sbjct  415  LYEQANEIG-----GQFNMAKVIPGKEEFHETLRYFGQQLKLKGVKVK----LGQRVSAD  465

Query  291  TLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEH--ALSSDDIFSKPDAP--GKT  346
             L               F R V+A G  P+ L  PG +H   +S  D+  K +AP   K 
Sbjct  466  DLIAGG-----------FDRVVVATGVEPRELKIPGADHPKVVSYIDVL-KHNAPVGKKV  513

Query  347  LVVGASYVALECAGFLKGQG----FDVTIMVRSILLRGFDQDIARRIGEYMESESGIAFI  402
             VVGA  +  + + F+   G     D+ +  +     GFD     R         GIA +
Sbjct  514  AVVGAGGIGFDVSEFVTHHGKSPSLDINLFAKEW---GFDLTNTAR--------GGIAGV  562

Query  403  KESVPTSIVKLENGQFQVTHTTGQDVYDTILNATG--RSPDVQKLNLDAAGVALNPKSGR  460
            K  +P    ++   Q + T   G+D+  T    TG      ++  N+D AG+ +  K G+
Sbjct  563  KPELPPVPRQVYLLQRKST-KHGKDLGKT----TGWIHRASLKSRNVDDAGLHITDKKGQ  617

Query  461  IHVVNEQT-----STPNIYALGDVIDAPELTPVAI----QAGKLLSRRLFGNGTTL  507
              V++  T         +  L + +    +T   I    +AG+L ++R    GT L
Sbjct  618  EKVLDVDTVIVCAGQVPLRELEEPLKKAGITVFRIGGADEAGELDAKRAIDQGTRL  673

>PHYRA_82908
Length=305

 Score = 35.8 bits (81),  Expect = 0.77, Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 71/156 (46%), Gaps = 25/156 (16%)

Query  476  LGDVIDAPELTPVAIQAGKLLSRR-----LFGNGTTLMDYTKICTAVFTPVEYGC----C  526
            LG+ +D       A+Q  K LS R     L  +   L+ + ++  A     +Y       
Sbjct  70   LGEALDE------ALQLHKTLSERVHLLYLDTDDRQLLQFAEVPLATTFDEKYVSERRQL  123

Query  527  GLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAKECYAKLI--VDTTQQKRVLGFH  584
            G  E +A+ SA  E ++   Q  T  +  +SH   LAK  YA+ I   +T      LG+H
Sbjct  124  GEQESEALTSA-LELIQSASQLLTSHDMDMSHKTRLAKAYYAESIKLFETADAHAFLGWH  182

Query  585  -YLGPNAGEVTQAIGI---AIKLNATYDDFINTVGI  616
             YL    GEV QA+     AI+L+ T+ +  N +G+
Sbjct  183  LYLD---GEVEQAVTECEHAIRLDPTFGNPYNDLGL  215

>PYAP_15943
Length=139

 Score = 33.5 bits (75),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (65%), Gaps = 0/34 (0%)

Query  161  VKYDWDLVVIGGGSGGLACSKEASKLGQKVLVLD  194
            ++  WD VV+GGG  GL  +   +K G++V VL+
Sbjct  10   LQRKWDAVVVGGGHNGLVAAAYLAKAGKRVCVLE  43

>PHYSO_507629
Length=703

 Score = 34.7 bits (78),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 73/180 (41%), Gaps = 31/180 (17%)

Query  232  LHKDADQFGWSVSNATFDWSKLVSSVQDYIHGLN-FKYRVDLRDKKVKYENMLGTFKDAH  290
            L   AD  G       F+ +K +   +++   L  F+ ++ L+  KVK    LG   ++ 
Sbjct  402  LFDQADAIG-----GQFNMAKTIPGKEEFYETLRYFEKQLKLKGVKVK----LGQRVESA  452

Query  291  TLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEH--ALSSDDIFSKPDAPGKTL-  347
             L               F + VIA G  P+ L  PG +H   LS  D+       GK + 
Sbjct  453  DLAAGG-----------FDKVVIATGVLPRELKIPGADHPKVLSYIDVLKNKAPVGKKVA  501

Query  348  VVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGEYMESESGIAFIKESVP  407
            V+GA  +  + A F+   G   +  V +   R +  D+   +        G+A IK S+P
Sbjct  502  VIGAGGIGFDVAEFITHVGESTSSSVDA-FAREWGIDMTNSV------RGGVAGIKPSIP  554

>H310_06296
Length=590

 Score = 34.3 bits (77),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 22/31 (71%), Gaps = 0/31 (0%)

Query  164  DWDLVVIGGGSGGLACSKEASKLGQKVLVLD  194
            D D++VIG G GGL  +   +K G++VLVL+
Sbjct  62   DLDVIVIGSGMGGLTVAAALAKEGKRVLVLE  92

>PITG_02760
Length=165

 Score = 33.1 bits (74),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 14/36 (39%), Positives = 22/36 (61%), Gaps = 0/36 (0%)

Query  159  ADVKYDWDLVVIGGGSGGLACSKEASKLGQKVLVLD  194
            A ++  WD +V+GGG  GL  +   +K G+ V VL+
Sbjct  6    ALLRKKWDAIVVGGGHNGLVAASYLAKAGKSVCVLE  41

>PYU1_G014369
Length=703

 Score = 33.9 bits (76),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 74/173 (43%), Gaps = 28/173 (16%)

Query  308  FRRAVIAVGGRPKPLSCPGWEHA--LSSDDIFSKPDAPGKTL-VVGASYVALECAGFL--  362
            F + VIA G  P+ L  PG +H+  LS  D+       GK + V+GA  +  + + FL  
Sbjct  459  FDKVVIATGVLPRDLKIPGGDHSKVLSYIDVLKHKAPVGKRVAVIGAGGIGFDVSEFLTH  518

Query  363  --KGQGFDVTIMVRSILLRGFDQDIARRIGEYMESESGIAFIKESVPTSIVKLENGQFQV  420
              K    DV +  +     G D   + R         G+  +K+ VP    ++   Q + 
Sbjct  519  IGKSASLDVNLFAKEW---GIDTSNSVR--------GGVQGVKQEVPAPEREVYLMQRKS  567

Query  421  THTTGQDVYDT---ILNATGRSPDVQKL------NLDAAGVALNPKSGRIHVV  464
            T   G+D+  T   I   + +  DV+ +       +D AG+    K G+ HV+
Sbjct  568  TK-HGKDLGKTTGWIHRLSLKHRDVKMIGGVNYDKVDDAGLHYTDKEGKKHVL  619

>SPRG_14085
Length=340

 Score = 33.5 bits (75),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 25/102 (25%), Positives = 48/102 (47%), Gaps = 13/102 (13%)

Query  199  SPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGEILHKDADQFGWSVSNATFDWSKLVSSVQ  258
            S VG+TW    T +++ C+  + M    +   +  +DA         A+F WS  ++ +Q
Sbjct  133  SLVGATWN---TPMDLQCV-MEYMDAGDLRDHLSRQDA---------ASFPWSAKITCLQ  179

Query  259  DYIHGLNFKYRVDLRDKKVKYENMLGTFKDAHTLTLTNDAKK  300
              +HGL + + + +  + +K  N+L   K  + L     AK+
Sbjct  180  AVVHGLGYLHSLSIIHRDLKSRNVLLDTKKGYKLVDFGIAKE  221

>H257_04036
Length=1049

 Score = 33.9 bits (76),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 57/122 (47%), Gaps = 19/122 (16%)

Query  157  SDADVKYD--WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNV  214
            SD+ +  D   D+V+ GGG+G  +C  +  + G     ++++   P G+T  + G  + V
Sbjct  431  SDSKMSRDKGADVVLFGGGAGAASCELQVPEPG----TVEFMVAMP-GTTCLINGLPLTV  485

Query  215  GCIPKKLMHQSSI------IGEILHKDA-----DQFGWSV-SNATFDWSKLVSSVQDYIH  262
            G  P+ L H  ++      +  +++ +A     D     V SN+  DW    + +Q Y H
Sbjct  486  GAAPRPLAHGDTLTCGRRNVFRVVNPNAPSQEDDHDNQHVRSNSRKDWLDRGAVLQSYRH  545

Query  263  GL  264
             L
Sbjct  546  PL  547

>CCA19519
Length=372

 Score = 33.5 bits (75),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 33/79 (42%), Gaps = 1/79 (1%)

Query  409  SIVKLENGQFQVTHTTGQDVYDTIL-NATGRSPDVQKLNLDAAGVALNPKSGRIHVVNEQ  467
            +I K    Q  +THT   DV D IL N T   P  + L         NP S R+    + 
Sbjct  258  NIFKAIPKQLVITHTGRMDVIDAILGNQTASIPHGKDLQSGLIMTGWNPPSARLKQKLDL  317

Query  468  TSTPNIYALGDVIDAPELT  486
             + P IY   D  D+  LT
Sbjct  318  ANIPCIYVSPDKADSYTLT  336

>PHYKE_5677
Length=211

 Score = 32.7 bits (73),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 21/34 (62%), Gaps = 0/34 (0%)

Query  161  VKYDWDLVVIGGGSGGLACSKEASKLGQKVLVLD  194
            ++  WD +V+GGG  GL  +   +K G+ V VL+
Sbjct  8    LRKKWDAIVVGGGHNGLVAAAYLAKAGKNVCVLE  41

>PHYKE_6590
Length=1054

 Score = 33.5 bits (75),  Expect = 5.3, Method: Compositional matrix adjust.
 Identities = 31/108 (29%), Positives = 53/108 (49%), Gaps = 5/108 (5%)

Query  376  ILLRGFDQDIARRIGEYMESESGIAFIKESVPTSIVKL-ENGQFQVTHTTGQDVYDT--I  432
            ++ R  D+D A+ +   + ++ GI  + E     I+   ENG   V  T G+   D   I
Sbjct  204  LMSRQLDEDGAKVLHNEIVNKFGIDVLYEKSTQGILGTKENGVEGVEFTNGETFDDVCMI  263

Query  433  LNATGRSPDVQKLNLDAAGVALNPKSGRIHVVNEQTSTPNIYALGDVI  480
            + ATG  P  +  +  ++G+ L  + G +     + ST N+YALG+ I
Sbjct  264  IFATGIKPRDELAH--SSGLELAKRGGILINDYLECSTSNVYALGECI  309

>PYAR_16461
Length=526

 Score = 33.1 bits (74),  Expect = 6.3, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 25/43 (58%), Gaps = 2/43 (5%)

Query  165  WDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGL  207
            W  V++GG +  LAC+K++ KL  K+   DY K  PV   W L
Sbjct  331  WGEVILGGEAQMLACNKDSGKL--KIWSSDYPKEMPVCGRWIL  371

>PYVX_18330
Length=558

 Score = 33.1 bits (74),  Expect = 6.7, Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 20/30 (67%), Gaps = 0/30 (0%)

Query  165  WDLVVIGGGSGGLACSKEASKLGQKVLVLD  194
            WD +V+GGG  GL  +   +K G++V VL+
Sbjct  13   WDAIVVGGGHNGLVAASYLAKAGKQVCVLE  42

>PYU1_G004385
Length=562

 Score = 33.1 bits (74),  Expect = 6.8, Method: Compositional matrix adjust.
 Identities = 14/36 (39%), Positives = 22/36 (61%), Gaps = 0/36 (0%)

Query  159  ADVKYDWDLVVIGGGSGGLACSKEASKLGQKVLVLD  194
            A  +  WD +V+GGG  GL  +   +K G++V VL+
Sbjct  7    ALTRKKWDAIVVGGGHNGLVAAAYLAKAGKQVCVLE  42

>PPTG_05518
Length=554

 Score = 32.7 bits (73),  Expect = 7.6, Method: Compositional matrix adjust.
 Identities = 14/36 (39%), Positives = 22/36 (61%), Gaps = 0/36 (0%)

Query  159  ADVKYDWDLVVIGGGSGGLACSKEASKLGQKVLVLD  194
            A ++  WD +V+GGG  GL  +   +K G+ V VL+
Sbjct  6    ALLRKKWDAIVVGGGHNGLVAAAYLAKAGKSVCVLE  41

>SDRG_06501
Length=623

 Score = 32.7 bits (73),  Expect = 8.6, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 22/31 (71%), Gaps = 0/31 (0%)

Query  164  DWDLVVIGGGSGGLACSKEASKLGQKVLVLD  194
            D D+++IGGG+ G A +   +K G+KVLV +
Sbjct  124  DADVIIIGGGTTGCAMAMGLAKQGKKVLVFE  154

>SPRG_11641
Length=623

 Score = 32.7 bits (73),  Expect = 8.9, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 22/31 (71%), Gaps = 0/31 (0%)

Query  164  DWDLVVIGGGSGGLACSKEASKLGQKVLVLD  194
            D D+++IGGG+ G A +   +K G+KVLV +
Sbjct  124  DADVIIIGGGTTGCAMAMGLAKQGKKVLVFE  154

Lambda      K        H        a         alpha
   0.318    0.134    0.408    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 50223783480

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40