Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
H257_06305147571099109955570.0
H310_09212147571113111548110.0
SDRG_01764147571092110235370.0
SPRG_063541475788488728660.0
PYAP_17746147571169115121310.0
PYU1_G0017341475780081519500.0
PYIW_187931475799779619450.0
PYIR_1345314757118679819290.0
PHYRA_95901147571075112918420.0
PHALS_06477147571166117018320.0
PHYSO_32115714757118079216190.0
PITG_1845714757117081315850.0
PPTG_1712814757117781715490.0
PHYCA_344751475769273814550.0
CCA18898147571147111813945e-173
CCI4512214757110575613201e-162
PYAR_13581147577303176575e-72
PHYKE_8394147574282674788e-51
PYAP_17482108131354131850.72
HYAP_04567108131275143821.5
PITG_1563712613203693821.7
PHYRA_75591143671574105793.1
PITG_023442052121087793.8
PYIW_180598335209561794.0
PHYSO_298246864542575775.1
SPRG_1827513299436753757.6
PHYRA_8341813529174748.3
PHYRA_8341611946029174748.3
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= H257_06305

Length=1099
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

H257_06305                                                            2145       0.0   
H310_09212                                                            1857       0.0   
SDRG_01764                                                            1367       0.0   
SPRG_06354                                                            1108       0.0   
PYAP_17746                                                            825        0.0   
PYU1_G001734                                                          755        0.0   
PYIW_18793                                                            753        0.0   
PYIR_13453                                                            747        0.0   
PHYRA_95901                                                           714        0.0   
PHALS_06477                                                           710        0.0   
PHYSO_321157                                                          628        0.0   
PITG_18457                                                            615        0.0   
PPTG_17128                                                            601        0.0   
PHYCA_34475                                                           565        0.0   
CCA18898                                                              541        5e-173
CCI45122                                                              513        1e-162
PYAR_13581                                                            257        5e-72 
PHYKE_8394                                                            188        8e-51 
PYAP_17482                                                            37.4       0.72  
HYAP_04567                                                            36.2       1.5   
PITG_15637                                                            36.2       1.7   
PHYRA_75591                                                           35.0       3.1   
PITG_02344                                                            35.0       3.8   
PYIW_18059                                                            35.0       4.0   
PHYSO_298246                                                          34.3       5.1   
SPRG_18275                                                            33.5       7.6   
PHYRA_83418                                                           33.1       8.3   
PHYRA_83416                                                           33.1       8.3   

>H257_06305
Length=1099

 Score = 2145 bits (5557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1099/1099 (100%), Positives = 1099/1099 (100%), Gaps = 0/1099 (0%)

Query  1     MDKLCQQYHAEDVGRILLQAQDELRSMRekvneknnvdvneinAILERAEADLRAKAEIV  60
             MDKLCQQYHAEDVGRILLQAQDELRSMREKVNEKNNVDVNEINAILERAEADLRAKAEIV
Sbjct  1     MDKLCQQYHAEDVGRILLQAQDELRSMREKVNEKNNVDVNEINAILERAEADLRAKAEIV  60

Query  61    LNGVVNNSMKMLPAIEAPGGKTSLSKFSSKLAQKRELAATMTRDSSYEPASPTYRQEDRE  120
             LNGVVNNSMKMLPAIEAPGGKTSLSKFSSKLAQKRELAATMTRDSSYEPASPTYRQEDRE
Sbjct  61    LNGVVNNSMKMLPAIEAPGGKTSLSKFSSKLAQKRELAATMTRDSSYEPASPTYRQEDRE  120

Query  121   PRFGGPIEPMERDRAPGRRPVGRIIKAGSLVKKKTTKPHRLLPKMNRTDPTAPSPDLVEE  180
             PRFGGPIEPMERDRAPGRRPVGRIIKAGSLVKKKTTKPHRLLPKMNRTDPTAPSPDLVEE
Sbjct  121   PRFGGPIEPMERDRAPGRRPVGRIIKAGSLVKKKTTKPHRLLPKMNRTDPTAPSPDLVEE  180

Query  181   DARGGVHNLVTRGFLPPSVDVTPAFTHGTSVIQNSRVKIYDRASQPVKSMPYTNPSGFNM  240
             DARGGVHNLVTRGFLPPSVDVTPAFTHGTSVIQNSRVKIYDRASQPVKSMPYTNPSGFNM
Sbjct  181   DARGGVHNLVTRGFLPPSVDVTPAFTHGTSVIQNSRVKIYDRASQPVKSMPYTNPSGFNM  240

Query  241   ASLKFDMsttpatstpspvaavvsGGDVSKMVVTPIDISFDAPSSSHPPVEQPKggatgg  300
             ASLKFDMSTTPATSTPSPVAAVVSGGDVSKMVVTPIDISFDAPSSSHPPVEQPKGGATGG
Sbjct  241   ASLKFDMSTTPATSTPSPVAAVVSGGDVSKMVVTPIDISFDAPSSSHPPVEQPKGGATGG  300

Query  301   ddtnggdsstIHNLRRNVEKIRGYNELLDTYSLHQFIIRKGKTLSDTPEFISFQRTTEDL  360
             DDTNGGDSSTIHNLRRNVEKIRGYNELLDTYSLHQFIIRKGKTLSDTPEFISFQRTTEDL
Sbjct  301   DDTNGGDSSTIHNLRRNVEKIRGYNELLDTYSLHQFIIRKGKTLSDTPEFISFQRTTEDL  360

Query  361   WGSVSTSIQELETMLTSYSVPLAYVDGQKLMKIAAMDATTRGTTELLSCILNMDEVSSLM  420
             WGSVSTSIQELETMLTSYSVPLAYVDGQKLMKIAAMDATTRGTTELLSCILNMDEVSSLM
Sbjct  361   WGSVSTSIQELETMLTSYSVPLAYVDGQKLMKIAAMDATTRGTTELLSCILNMDEVSSLM  420

Query  421   RRPGQRYKGSQGPDLAVVLIQSVWRMFLTKKRLKNHHGNEDAAVIQRIYRSYRCFSQLQQ  480
             RRPGQRYKGSQGPDLAVVLIQSVWRMFLTKKRLKNHHGNEDAAVIQRIYRSYRCFSQLQQ
Sbjct  421   RRPGQRYKGSQGPDLAVVLIQSVWRMFLTKKRLKNHHGNEDAAVIQRIYRSYRCFSQLQQ  480

Query  481   RLKLVREADLRIWDAQMQRFRANWDTMKMQRRVVVHVPSFASDDRTRLKMDNFSIRQNLQ  540
             RLKLVREADLRIWDAQMQRFRANWDTMKMQRRVVVHVPSFASDDRTRLKMDNFSIRQNLQ
Sbjct  481   RLKLVREADLRIWDAQMQRFRANWDTMKMQRRVVVHVPSFASDDRTRLKMDNFSIRQNLQ  540

Query  541   MARMCAIADPNVDIIYISPFELSPDIQRYQVRLLQLGGITDPQTRIRMLHPENVDRFPEH  600
             MARMCAIADPNVDIIYISPFELSPDIQRYQVRLLQLGGITDPQTRIRMLHPENVDRFPEH
Sbjct  541   MARMCAIADPNVDIIYISPFELSPDIQRYQVRLLQLGGITDPQTRIRMLHPENVDRFPEH  600

Query  601   FSLTTLLLYSPHCLKKIKRFVRGKNAYIVTGNVGPEDKRLAIALQIPLLGMDPDKALLYG  660
             FSLTTLLLYSPHCLKKIKRFVRGKNAYIVTGNVGPEDKRLAIALQIPLLGMDPDKALLYG
Sbjct  601   FSLTTLLLYSPHCLKKIKRFVRGKNAYIVTGNVGPEDKRLAIALQIPLLGMDPDKALLYG  660

Query  661   TRSGGKRIFMAADVNIPMGAHDIYDEDELIQSLSKLIAADVDQNEWLVKIDADQSDTGIA  720
             TRSGGKRIFMAADVNIPMGAHDIYDEDELIQSLSKLIAADVDQNEWLVKIDADQSDTGIA
Sbjct  661   TRSGGKRIFMAADVNIPMGAHDIYDEDELIQSLSKLIAADVDQNEWLVKIDADQSDTGIA  720

Query  721   SINVQQMQSVAKVRAEKRDMKHMAAEYFQQPDVRDAVLRSIFNELTESYFAANITPCFPD  780
             SINVQQMQSVAKVRAEKRDMKHMAAEYFQQPDVRDAVLRSIFNELTESYFAANITPCFPD
Sbjct  721   SINVQQMQSVAKVRAEKRDMKHMAAEYFQQPDVRDAVLRSIFNELTESYFAANITPCFPD  780

Query  781   VYASWAELRPVALRVGVVIEAYPSKVLSQVRANVFIEPSGGVHITSAHDLFMSPANKHLP  840
             VYASWAELRPVALRVGVVIEAYPSKVLSQVRANVFIEPSGGVHITSAHDLFMSPANKHLP
Sbjct  781   VYASWAELRPVALRVGVVIEAYPSKVLSQVRANVFIEPSGGVHITSAHDLFMSPANKHLP  840

Query  841   QCALFPQTSVPYQAIRGASLAIASSMFIKGIIGYASIDYMSFADPKTLVGGGRPRQRLWA  900
             QCALFPQTSVPYQAIRGASLAIASSMFIKGIIGYASIDYMSFADPKTLVGGGRPRQRLWA
Sbjct  841   QCALFPQTSVPYQAIRGASLAIASSMFIKGIIGYASIDYMSFADPKTLVGGGRPRQRLWA  900

Query  901   MQVVPGLTNTAVSFVMFAFLSCSQFNPITGKCHLQVAAPPPIAASATVAPITQAQKAVET  960
             MQVVPGLTNTAVSFVMFAFLSCSQFNPITGKCHLQVAAPPPIAASATVAPITQAQKAVET
Sbjct  901   MQVVPGLTNTAVSFVMFAFLSCSQFNPITGKCHLQVAAPPPIAASATVAPITQAQKAVET  960

Query  961   ILSARPPNGAVVCGPERTYMVLDYIYHPNMATLHFSTFFNTCRLNGVSFDLQRAIGAAFI  1020
             ILSARPPNGAVVCGPERTYMVLDYIYHPNMATLHFSTFFNTCRLNGVSFDLQRAIGAAFI
Sbjct  961   ILSARPPNGAVVCGPERTYMVLDYIYHPNMATLHFSTFFNTCRLNGVSFDLQRAIGAAFI  1020

Query  1021  LADSLTAGVMGLMCIGENDKEAFRIARQAVELIGDQVGVQALPDSLSGERLGNFPHLLAI  1080
             LADSLTAGVMGLMCIGENDKEAFRIARQAVELIGDQVGVQALPDSLSGERLGNFPHLLAI
Sbjct  1021  LADSLTAGVMGLMCIGENDKEAFRIARQAVELIGDQVGVQALPDSLSGERLGNFPHLLAI  1080

Query  1081  VRNKSDDPADRRKRRGALK  1099
             VRNKSDDPADRRKRRGALK
Sbjct  1081  VRNKSDDPADRRKRRGALK  1099

>H310_09212
Length=1113

 Score = 1857 bits (4811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 924/1115 (83%), Positives = 999/1115 (90%), Gaps = 22/1115 (2%)

Query  1     MDKLCQQYHAEDVGRILLQAQDELRSMRekvneknnvdvneinAILERAEADLRAKAEIV  60
             M+KLCQQYHAEDVGRILLQAQDELRSMREKV+E NN+DVN+I+AILERAEADLRAKAEIV
Sbjct  1     MEKLCQQYHAEDVGRILLQAQDELRSMREKVHENNNLDVNQIHAILERAEADLRAKAEIV  60

Query  61    LNGVVNNSMKMLPAIEAPGGKTSLSKFSSKLAQKRELAATMTRDSSYEPASPTYRQED--  118
             LNGVVNNSMKMLPAI+APGG+  LSKFSSKLAQKR+LAATM R+++YEP SPTY  +   
Sbjct  61    LNGVVNNSMKMLPAIDAPGGQRYLSKFSSKLAQKRDLAATMARENTYEPGSPTYGHDTSY  120

Query  119   -REPRFGGPIEPMERDRAPGRRPVGRIIKAGSLVKKKTTKPHRLLPKMNRTDPTAPSPDL  177
                P   GPIEPMERDR PGRRPVGRI+KAGSLVK KTTKP R+LPKMNR DPTAP P L
Sbjct  121   REHPSLSGPIEPMERDRTPGRRPVGRIVKAGSLVKHKTTKPRRILPKMNRLDPTAPPPAL  180

Query  178   VEEDARGGVHNLVTRGFLPPSVDVTPAFTHGTSVIQNSRVKIYDRASQPVKSMPYTNPSG  237
             +++DARGGVHNL+TRGFLPPSVDVTPAFTHGTSVIQN+RVKIYDRASQPVKSMPYTNPSG
Sbjct  181   LDDDARGGVHNLLTRGFLPPSVDVTPAFTHGTSVIQNTRVKIYDRASQPVKSMPYTNPSG  240

Query  238   FNMASLKFDMsttpatstpspvaavvsGGDV--SKMVV-TPIDISFDAPSSSHPPV--EQ  292
             FNMASLKFDM T    +  +       GGD+  SK  + TPIDI+FD  +++  P   EQ
Sbjct  241   FNMASLKFDMVTPTPPTVANVPINQ--GGDIPPSKTSIPTPIDITFDGHANNAVPFRPEQ  298

Query  293   PKggatggddtnggd--------sstIHNLRRNVEKIRGYNELLDTYSLHQFIIRKGKTL  344
             PKGG                   S++IHNLRRNVEKIRGYNELLDTYSLHQFIIRKGKTL
Sbjct  299   PKGGNDPSGKDCASADDGAGGNDSTSIHNLRRNVEKIRGYNELLDTYSLHQFIIRKGKTL  358

Query  345   SDTPEFISFQRTTEDLWGSVSTSIQELETMLTSYSVPLAYVDGQKLMKIAAMDATTRGTT  404
             +DTPEFISFQRTTEDLWGSVS SIQELE MLT+YSVPLAYVDGQKLMKIAAMD T RGT 
Sbjct  359   ADTPEFISFQRTTEDLWGSVSKSIQELEAMLTNYSVPLAYVDGQKLMKIAAMDGTARGTM  418

Query  405   ELLSCILNMDEVSSLMRRPGQRYKGSQGPDLAVVLIQSVWRMFLTKKRLKNHHGNEDAAV  464
             ELLSCILNMDEVSSLMRRPGQR+KG  GPDLA VL+QSVWRM++TKKRLKNHHGNEDAAV
Sbjct  419   ELLSCILNMDEVSSLMRRPGQRFKGKSGPDLAAVLLQSVWRMYITKKRLKNHHGNEDAAV  478

Query  465   IQRIYRSYRCFSQLQQRLKLVREADLRIWDAQMQRFRANWDTMKMQRRVVVHVPSFASDD  524
             IQRIYRSYRCFSQLQQRLK VREADLRIWDAQMQRFRANWD++KMQRRVVVHVPSF+S++
Sbjct  479   IQRIYRSYRCFSQLQQRLKSVREADLRIWDAQMQRFRANWDSIKMQRRVVVHVPSFSSEE  538

Query  525   RTRLKMDNFSIRQNLQMARMCAIADPNVDIIYISPFELSPDIQRYQVRLLQLGGITDPQT  584
             RTRLKM+NFSI+QNLQMARMCAIADPNVDIIYISPFELSPDIQ+YQVRLLQLGGI DPQT
Sbjct  539   RTRLKMENFSIQQNLQMARMCAIADPNVDIIYISPFELSPDIQKYQVRLLQLGGIADPQT  598

Query  585   RIRMLHPENVDRFPEHFSLTTLLLYSPHCLKKIKRFVRGKNAYIVTGNVGPEDKRLAIAL  644
             RIRMLHPENVDRFPEHFSLTT+LLYSPHCLKKIKRFVRGK+AYIVTGNVGPEDKRLAIAL
Sbjct  599   RIRMLHPENVDRFPEHFSLTTVLLYSPHCLKKIKRFVRGKDAYIVTGNVGPEDKRLAIAL  658

Query  645   QIPLLGMDPDKALLYGTRSGGKRIFMAADVNIPMGAHDIYDEDELIQSLSKLIAADVDQN  704
             Q+PLLGMDPDKALLYGTRSGGKRIFMAADVNIPMGAHDIYDEDELIQSLSKLIAAD+DQ 
Sbjct  659   QLPLLGMDPDKALLYGTRSGGKRIFMAADVNIPMGAHDIYDEDELIQSLSKLIAADIDQT  718

Query  705   EWLVKIDADQSDTGIASINVQQMQSVAKVRAEKRDMKHMAAEYFQQPDVRDAVLRSIFNE  764
             EWL+KIDADQS+TGIAS+NV +MQSVAK RAEKR+MKH AAEYFQQPDVRDAVLRS+++E
Sbjct  719   EWLIKIDADQSNTGIASLNVDKMQSVAKFRAEKREMKHGAAEYFQQPDVRDAVLRSVYSE  778

Query  765   LTESYFAANITPCFPDVYASWAELRPVALRVGVVIEAYPSKVLSQVRANVFIEPSGGVHI  824
             L ESYFAAN+TPCFP++YASWA +RP+ALRVGVVIEAYPSKVLS VR N+FIEPSGGVHI
Sbjct  779   LNESYFAANVTPCFPEMYASWAAMRPIALRVGVVIEAYPSKVLSHVRTNIFIEPSGGVHI  838

Query  825   TSAHDLFMSPANKHLPQCALFPQTSVPYQAIRGASLAIASSMFIKGIIGYASIDYMSFAD  884
             TSAHD+FM P NKHLPQCA+FPQ+SVPYQAIRGASLAIASSMFIKGIIGYASIDY+SFAD
Sbjct  839   TSAHDVFMCPVNKHLPQCAVFPQSSVPYQAIRGASLAIASSMFIKGIIGYASIDYISFAD  898

Query  885   PKTLVGGGRPRQRLWAMQVVPGLTNTAVSFVMFAFLSCSQFNPITGKCHLQVAAPPPIAA  944
             PK +V  GRPRQRLWAMQVVPGLTNTAVSFVMFAFLSCSQFNPITGK HLQVA  P    
Sbjct  899   PKAMV-SGRPRQRLWAMQVVPGLTNTAVSFVMFAFLSCSQFNPITGKSHLQVAPAPVATL  957

Query  945   SATVAPITQAQKAVETIL-SARPPNGAVVCGPERTYMVLDYIYHPNMATLHFSTFFNTCR  1003
             S   APIT  Q+ + TIL        A VCGPERTYMVLDYIYHPNMATL F+TFFNTCR
Sbjct  958   STANAPITPTQQEIATILSPPSSAAAASVCGPERTYMVLDYIYHPNMATLQFATFFNTCR  1017

Query  1004  LNGVSFDLQRAIGAAFILADSLTAGVMGLMCIGENDKEAFRIARQAVELIGDQVGVQALP  1063
             L+GVSFDLQRAIGAA+ILADSLTAGV+GL+CIGE+DKEAFRIARQAVELIGDQVGVQALP
Sbjct  1018  LHGVSFDLQRAIGAAYILADSLTAGVVGLICIGESDKEAFRIARQAVELIGDQVGVQALP  1077

Query  1064  DSLSGERLGNFPHLLAIVRNKSDDP--ADRRKRRG  1096
             +SLSGERLGNFPHLLAIVRNKSDDP  ADRRKRRG
Sbjct  1078  NSLSGERLGNFPHLLAIVRNKSDDPAAADRRKRRG  1112

>SDRG_01764
Length=1092

 Score = 1367 bits (3537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 676/1102 (61%), Positives = 849/1102 (77%), Gaps = 23/1102 (2%)

Query  1     MDKLCQQYHAEDVGRILLQAQDELRSMRekvneknnvdvneinAILERAEADLRAKAEIV  60
             MD+L QQYH EDVGRILLQAQDELR+MRE+V   NN+D++ + AILERAE DLR+KAEIV
Sbjct  1     MDRLAQQYHVEDVGRILLQAQDELRNMREQVLTSNNIDIDALQAILERAELDLRSKAEIV  60

Query  61    LNGVVNNSMKMLPAIEAPGG-KTSLSKFSSKLAQKRELAATMTRDSSYEP----ASPTYR  115
             LNGVVNN+MK LP IEAPGG + S+SKFSSKLA++RELA  M RD S +     +SP  R
Sbjct  61    LNGVVNNTMKTLPVIEAPGGGQPSVSKFSSKLAKQRELADAMARDGSLDDHRTRSSPVER  120

Query  116   QEDREPRFGGPIEPMERDRAPGRRPVGRIIKAGSLVKKKTTKPHRLLPKMNRTDPTAPSP  175
                +    G P+ P+ERDR PG+RP+GR ++ G L+KKK T P RLLPK+NR DP AP P
Sbjct  121   LRQQ---LGQPVVPVERDRPPGKRPIGRTMQVGRLIKKKVTGPQRLLPKVNRIDPLAPVP  177

Query  176   DLVEEDARGGVHNLVTRGFLPPSVDVTPAFTHGTSVIQNSRVKIYDRASQPVKSMPYTNP  235
             DL ++DA+ GV NLV RGF+P S D++ AFTHG  +IQNS++++YDR+ QPVKS PY N 
Sbjct  178   DLEDDDAKRGVLNLVNRGFIPTSADLSLAFTHGDGIIQNSKLRLYDRSEQPVKSQPYMNS  237

Query  236   SGFNMASLKFDMsttpatstpspvaavvsGGDVSKMVVTPIDISFDAPSSSHP--PVEQP  293
             S FN+ASLK D++  P    P+P+  +    +  K  V  + ++F          PVE P
Sbjct  238   SSFNVASLKLDLAPPPTEPDPTPLTRLAVARN-KKSAVATVQLTFPGAKDEGDVVPVEDP  296

Query  294   KggatggddtnggdsstIHNLRRNVEKIRGYNELLDTYSLHQFIIRKGKTLSDTPEFISF  353
                    DD     + TI  LR NVEKIRGYN+LLDTYSLHQFIIRKG+TL++TPEFISF
Sbjct  297   -----TTDDGPIEPTDTIDELRNNVEKIRGYNDLLDTYSLHQFIIRKGQTLAETPEFISF  351

Query  354   QRTTEDLWGSVSTSIQELETMLTSYSVPLAYVDGQKLMKIAAMDATTRGTTELLSCILNM  413
             +R TEDLWGSVS +I+ELET+L +YSVPLAY+DGQKL+KIAAMDA +R  +ELL+C+LN+
Sbjct  352   KRITEDLWGSVSMAIRELETLLINYSVPLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNV  411

Query  414   DEVSSLMRRPGQRYKGSQGPDLAVVLIQSVWRMFLTKKRLKNHHGNEDAAVIQRIYRSYR  473
             DEV++ M RPGQR+KG      A +L+QSV+RM LT++RL+ HHG+  A+ IQR+YR+Y+
Sbjct  412   DEVTTFMARPGQRFKGEDSRHAAAILLQSVYRMHLTRRRLRQHHGHSYASHIQRVYRTYK  471

Query  474   CFSQLQQRLKLVREADLRIWDAQMQRFRANWDTMKMQRRVVVHVPSFASDDRTRLKMDNF  533
                ++Q +L+L READ R W+ QM  F ANWD +KMQRRVVVHVPSF++++RTRL MDNF
Sbjct  472   SVKEIQVKLRLAREADARTWETQMTAFHANWDKIKMQRRVVVHVPSFSAEERTRLNMDNF  531

Query  534   SIRQNLQMARMCAIADPNVDIIYISPFELSPDIQRYQVRLLQLGGITDPQTRIRMLHPEN  593
             +IRQNLQMAR+CAIADPNVD+IYISPFELS DIQ+Y +RLLQLGG+ DP +R+RMLHPEN
Sbjct  532   AIRQNLQMARLCAIADPNVDVIYISPFELSADIQKYMMRLLQLGGVADPHSRVRMLHPEN  591

Query  594   VDRFPEHFSLTTLLLYSPHCLKKIKRFVRGKNAYIVTGNVGPEDKRLAIALQIPLLGMDP  653
              +RFPEHFSL T+LLYSPHCLKKIKR+VRGK AYIV G VGPEDKRLAI LQ+PLLGMDP
Sbjct  592   AERFPEHFSLATILLYSPHCLKKIKRYVRGKEAYIVAGTVGPEDKRLAIRLQLPLLGMDP  651

Query  654   DKALLYGTRSGGKRIFMAADVNIPMGAHDIYDEDELIQSLSKLIAADVDQNEWLVKIDAD  713
             D+ALLYGTRSG KR+F  ADVNIP GAHDIYDEDELI SL+KL AA++ Q  WL+K+DAD
Sbjct  652   DRALLYGTRSGAKRLFTQADVNIPFGAHDIYDEDELILSLAKLTAANLHQGMWLIKLDAD  711

Query  714   QSDTGIASINVQQMQSVAKVRAEKRDMKHMAAEYFQQPDVRDAVLRSIFNELTESYFAAN  773
              SDTG+ASI++  ++ V KVR EKR MK+   EY+ QP++++ ++R+I  EL+E  F   
Sbjct  712   PSDTGLASIDMHALECVNKVRTEKRAMKN--DEYYSQPNIKEGIVRAIVAELSEQ-FHRL  768

Query  774   ITPCFPDVYASWAELRPVALRVGVVIEAYPSKVLSQVRANVFIEPSGGVHITSAHDLFMS  833
             I+PCFPDVY +W  +RPV  R+G VIEAYP KVL++VRANVFIEPSGGVH+TSA +  M 
Sbjct  769   ISPCFPDVYPTWQHMRPVVNRIGAVIEAYPPKVLARVRANVFIEPSGGVHLTSAQEQLMQ  828

Query  834   PANKHLPQCALFPQTSVPYQAIRGASLAIASSMFIKGIIGYASIDYMSFADPKTLVG-GG  892
               NKH    A++P T+VPY AIRGASLA+A +M+  GIIGYASIDY++F D KT+ G  G
Sbjct  829   AKNKHQSVGAVYPSTTVPYAAIRGASLAVAQAMYASGIIGYASIDYVAFLDVKTVNGKAG  888

Query  893   RPRQRLWAMQVVPGLTNTAVSFVMFAFLSCSQFNPITGKCHLQVAAPPPIAASATVAPIT  952
              P  RLWA+Q++P LT TA+SFV+F FLSC+  +  TG+  L   AP P  A+  + P+T
Sbjct  889   PPHLRLWALQLLPCLTPTAMSFVLFTFLSCATLDAATGRSFLPQPAPHPSPATGQL-PVT  947

Query  953   QAQKAVETILSARPPNGAVVCGPERTYMVLDYIYHPNMATLHFSTFFNTCRLNGVSFDLQ  1012
             + Q AVE ILS  P +  V  GPER Y+  +YI+HPNMATL ++ FFN CR++GVSFDLQ
Sbjct  948   ETQLAVEKILSESPRSSNV--GPERAYIAHEYIFHPNMATLQYAVFFNMCRVHGVSFDLQ  1005

Query  1013  RAIGAAFILADSLTAGVMGLMCIGENDKEAFRIARQAVELIGDQVGVQALPDSLSGERLG  1072
             ++IGAAF+LADSLTAGV+GL+CIGE+DKEA R+ R A+ELIGDQVGVQ  PD+L+GERLG
Sbjct  1006  KSIGAAFVLADSLTAGVVGLLCIGESDKEAVRLTRAALELIGDQVGVQPAPDALTGERLG  1065

Query  1073  NFPHLLAIVRNKSDDPADRRKR  1094
             NF  +L  +R++ DD   R K+
Sbjct  1066  NFAAVLGAIRSRHDDMVKRAKK  1087

>SPRG_06354
Length=884

 Score = 1108 bits (2866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 541/887 (61%), Positives = 673/887 (76%), Gaps = 17/887 (2%)

Query  212   IQNSRVKIYDRASQPVKSMPYTNPSGFNMASLKFDMsttpatstpspvaavvsGGDVSKM  271
             +QNS++++YDR+ QPVKS PY N SGFN+ASLK D++  P      P             
Sbjct  1     MQNSKLRLYDRSEQPVKSQPYMNSSGFNVASLKLDLAPPPTEPDAVPPTRPAVARKRKST  60

Query  272   VVTPIDISFDAPSSS---HPPVEQPKggatggddtnggdsstIHNLRRNVEKIRGYNELL  328
             V T + +SF           PVE P       DD     + TI  LR NVEKIRGYN+LL
Sbjct  61    VAT-VQLSFPGAKDELVDAVPVEDP-----ATDDGPIEPTDTIDELRNNVEKIRGYNDLL  114

Query  329   DTYSLHQFIIRKGKTLSDTPEFISFQRTTEDLWGSVSTSIQELETMLTSYSVPLAYVDGQ  388
             DTYSLHQFIIRKG+TLS+TPEFISF+R TEDLWGSVS +I+ELET+L  YSVPLAY+DGQ
Sbjct  115   DTYSLHQFIIRKGQTLSETPEFISFKRITEDLWGSVSMAIRELETLLVHYSVPLAYIDGQ  174

Query  389   KLMKIAAMDATTRGTTELLSCILNMDEVSSLMRRPGQRYKGSQGPDLAVVLIQSVWRMFL  448
             KL+KIAAMDA +R  +ELL+C+LN+DEV++ M RPGQR+KG  G   A ++IQSV+RM  
Sbjct  175   KLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGGDGRHAAAIVIQSVYRMHR  234

Query  449   TKKRLKNHHGNEDAAVIQRIYRSYRCFSQLQQRLKLVREADLRIWDAQMQRFRANWDTMK  508
             T++ L+ HHG+  A  IQR+YR+Y+C   +Q +L+L READ R W+ QM  F ANWD +K
Sbjct  235   TRRLLRQHHGHSYATHIQRVYRTYKCVKDIQVKLRLAREADARTWETQMTTFHANWDKIK  294

Query  509   MQRRVVVHVPSFASDDRTRLKMDNFSIRQNLQMARMCAIADPNVDIIYISPFELSPDIQR  568
             MQRRVVVHVPSF++++R RL MDNF+IRQNLQMAR+CAIADPNVD+IYISPFELS DIQ+
Sbjct  295   MQRRVVVHVPSFSAEERARLNMDNFAIRQNLQMARLCAIADPNVDVIYISPFELSVDIQK  354

Query  569   YQVRLLQLGGITDPQTRIRMLHPENVDRFPEHFSLTTLLLYSPHCLKKIKRFVRGKNAYI  628
             Y +RLLQLGG+ DP +R+RMLHPEN +RFPEHFSL T+LLYSPHCLKKIKR+VRGK AYI
Sbjct  355   YMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLATILLYSPHCLKKIKRYVRGKEAYI  414

Query  629   VTGNVGPEDKRLAIALQIPLLGMDPDKALLYGTRSGGKRIFMAADVNIPMGAHDIYDEDE  688
             V G VGPEDKRLAI LQ+PLLGMDPD+ALLYGTRSG KR+F  ADVNIP GAHDIYDEDE
Sbjct  415   VAGTVGPEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKRLFTQADVNIPYGAHDIYDEDE  474

Query  689   LIQSLSKLIAADVDQNEWLVKIDADQSDTGIASINVQQMQSVAKVRAEKRDMKHMAAEYF  748
             LI SL+KL AA++ Q  WL+K+DAD SDTG+A+I++  ++ V KVRAEKR MK+   EY+
Sbjct  475   LILSLAKLTAANLHQGMWLIKLDADPSDTGLAAIDMHALECVNKVRAEKRAMKN--DEYY  532

Query  749   QQPDVRDAVLRSIFNELTESYFAANITPCFPDVYASWAELRPVALRVGVVIEAYPSKVLS  808
              QP++++ ++R+I  EL+E  F   I+PCFPDVY +W  +RPV  R+G VIEAYP KVL+
Sbjct  533   SQPNIKEGIVRAIVAELSEQ-FHRLISPCFPDVYPTWQHMRPVVNRIGAVIEAYPPKVLA  591

Query  809   QVRANVFIEPSGGVHITSAHDLFMSPANKHLPQCALFPQTSVPYQAIRGASLAIASSMFI  868
             +VRANVFIEPSGGVH+TSA +  M   NKH    A++P T+VPY AIRGASLA+A +M+ 
Sbjct  592   RVRANVFIEPSGGVHVTSAQEQLMHVKNKHQSVGAVYPPTAVPYAAIRGASLAVAQAMYA  651

Query  869   KGIIGYASIDYMSFADPKTLVG-GGRPRQRLWAMQVVPGLTNTAVSFVMFAFLSCSQFNP  927
              GIIGYASIDY++F D KT+ G  G P  RLWA+Q++P LT TA+SFV+F FLSC+  + 
Sbjct  652   SGIIGYASIDYVAFLDVKTVNGKAGPPHLRLWALQLLPCLTPTAMSFVLFTFLSCATLDA  711

Query  928   ITGKCHLQVAAPPPIAASATVAPITQAQKAVETILSARPPNGAVVCGPERTYMVLDYIYH  987
              TG+  L + AP P  +S    P T+ Q AVE IL    P  A   G ER Y+  +YI+H
Sbjct  712   ATGRSFLPLPAPRP--SSLAGPPATETQLAVEKILGESSP--AATMGAERAYIAHEYIFH  767

Query  988   PNMATLHFSTFFNTCRLNGVSFDLQRAIGAAFILADSLTAGVMGLMCIGENDKEAFRIAR  1047
             PNMATL ++ FFN CR++GVSFDLQ++IGAAF+LADSLTAGV+GL+CIGE+DKEA R+ R
Sbjct  768   PNMATLQYAVFFNMCRVHGVSFDLQKSIGAAFVLADSLTAGVVGLLCIGESDKEAVRLTR  827

Query  1048  QAVELIGDQVGVQALPDSLSGERLGNFPHLLAIVRNKSDDPADRRKR  1094
              A+ELIGDQVGVQ  PD+L+GERLGNF  +L  +R + DD   R K+
Sbjct  828   AALELIGDQVGVQPAPDALTGERLGNFAAVLGAIRLRHDDMVKRAKK  874

>PYAP_17746
Length=1169

 Score = 825 bits (2131),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/1151 (40%), Positives = 681/1151 (59%), Gaps = 85/1151 (7%)

Query  1     MDKLCQQYHAEDVGRILLQAQDELRSMRekvneknnvdvneinA----------ILERAE  50
             M++L Q++H EDVGRILLQ QD+LR +RE++   N      + A          IL+RAE
Sbjct  1     MEQLQQRHHVEDVGRILLQTQDQLRQLREQLVGSNGPGNGSVIASNNAGAEIEEILQRAE  60

Query  51    ADLRAKAEIVLNGVVNNSMKMLPAIEAPGGKTSLSKFSSKLAQKRELAATMTRDS-SYEP  109
              +LR KAE+VL+ +V        A +  GG   L         +R        D  SY+ 
Sbjct  61    DELRMKAELVLSNIVTAGPASPGANDREGGLIPLPTVRRPPIARRRRRKAELHDGGSYDL  120

Query  110   ASPTYRQEDREPRFGGPIEPME---RDRAPGRRPVGRIIKAGSLVKKKTTKPHRLLPKMN  166
                 +RQ  +          M    R R  G  P       G +VK KTT   RLLP +N
Sbjct  121   DIEYFRQRFKRTAVDDASSTMTTAPRQRGGGPTPTH---AHGKVVKHKTTSNARLLPFVN  177

Query  167   RTDPTAPSPDLVEEDARGGVHNLVTRGFLPPSVDVTPAF-------THG--TSVIQNSRV  217
             + DPTAP P L   DA+ GV +L+ RGFLPP+VD+TPAF       + G  TSVIQN  V
Sbjct  178   KYDPTAPRPVLSPVDAKQGVLSLLNRGFLPPNVDLTPAFQSVSSPKSQGNPTSVIQNGSV  237

Query  218   KIYDRASQPVKSMPYTNPSGFNMASLKFDMsttpatstpspvaavvsGGDVSKMV----V  273
             K++ R  QPV++  Y++P  FN+A+LKFDM+     +     +      D S+ +    +
Sbjct  238   KLHRREEQPVRATAYSSPGNFNLATLKFDMAAVNTVTAAENRSIEPH--DESEALPLRAM  295

Query  274   TPIDISFDAPSSSHPPVEQPKgga----------------tggddtnggdsstIHNLRRN  317
               + ISF    S   P    +                      D T    ++++ +LR N
Sbjct  296   KTVTISFHNGKSESSPRNNARESEHDGRREDGNDTAPLEREDLDVTADEAANSMEDLRNN  355

Query  318   VEKIRGYNELLDTYSLHQFIIRKGKTLSDTPEFISFQRTTEDLWGSVSTSIQELETMLTS  377
             VEKIRGYNELLD YSLHQFII KG+ L DTPEF SF+R  +++WGS+   IQ LE +LT 
Sbjct  356   VEKIRGYNELLDAYSLHQFIIHKGRALRDTPEFQSFKRVAQEIWGSIEEVIQALEILLTR  415

Query  378   YSVPLAYVDGQKLMKIAAMDATTRGTTELLSCILNMDEVSSLMRRPGQRYKGSQGPDLAV  437
             Y VPLAY+DGQ+LM +A+M+     T ELL+C++N D+V+SL+RRPGQRYKG      A 
Sbjct  416   YFVPLAYIDGQRLMTLASMEMAKLSTCELLTCVVNEDQVASLIRRPGQRYKGKDRKRRAA  475

Query  438   VLIQSVWRMFLTKKRLKNHHGNEDAA-VIQRIYRSYRCFSQLQQRLKLVREADLRIWDAQ  496
               +Q+ +RM L + R +    N  +A +IQ+ +RSY C   L++RL  VRE  L  W A+
Sbjct  476   TTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSLRRRLAHVREERLGEWKAK  535

Query  497   MQRFRANWDTMKMQRRVVVHVPSFASDDRTRLKMDNFSIRQNLQMARMCAIADPNVDIIY  556
             ++R R+ W  ++ QRRVV+HV S + D+RTRL M+NFS++QNLQ++R+  + D NV+I+Y
Sbjct  536   VRRMRSQWRDIRQQRRVVIHVASISVDERTRLSMENFSVKQNLQLSRLAGLVDQNVEIVY  595

Query  557   ISPFELSPDIQRYQVRLLQLGGITDPQTRIRMLHPENVDRFPEHFSLTTLLLYSPHCLKK  616
             ++PFELS ++ +Y ++LLQL GI +  TR+R++ PE+  +FP+HFSL T L+YSP+C+++
Sbjct  596   VTPFELSTEVSQYFIKLLQLSGIANAHTRVRLVFPEHAAQFPQHFSLATHLIYSPNCIRR  655

Query  617   IKRFVRGKNAYIVTGNVGPEDKRLAIALQIPLLG-MDPDKALLYGTRSGGKRIFMAADVN  675
             I+R V+GK AY+V G  GPED+RLA+ALQ+P+LG  DP   L   TRSG KR F+ ADVN
Sbjct  656   IQRLVQGKEAYLVMGVPGPEDQRLAVALQVPILGPEDPTSILPLMTRSGSKRFFIKADVN  715

Query  676   IPMGAHDIYDEDELIQSLSKLIAADVDQNEWLVKIDADQSDTGIASINVQQMQSVAKVRA  735
             +P G +DIYD DEL+ SL+KLI + ++QN WL+K+DAD   TG A ++V  M ++  +R 
Sbjct  716   VPTGTYDIYDIDELLFSLAKLIISHLNQNVWLLKLDADPLGTGTAILDVSLMTTLRDIRR  775

Query  736   EKRDMKHMAAEYFQQPDVRDAVLRSIFNELTESYFAANITPCFPDVYASWAELRPVALRV  795
             EKR       EY++QP +RD + R++  EL E    + + P  P+++ASW E        
Sbjct  776   EKR-----PPEYWKQPGIRDTIARALLQEL-EREIGSLLKPSHPEIFASWKEFASAIPEF  829

Query  796   GVVIEAYPSKVLSQVRANVFIEPSGGVHITSAHDLFMSPAN-----KHLPQCALFPQTSV  850
             GVV+EA P  V   +R N+FIEPSG VH+ S +D+           +  P   +FPQT V
Sbjct  830   GVVVEALPFHVAGVIRMNIFIEPSGDVHVMSTNDVLSGNGTTLSQRQRRPAAFVFPQTLV  889

Query  851   PYQAIRGASLAIASSMFIK-GIIGYASIDYMSFADPKTLVGGGRPRQRLWAMQVVPGLTN  909
             P++AI GAS A+   ++ +    GYAS+D +  +  ++L    +  +RLWA+ + P LT+
Sbjct  890   PHEAIVGASSAVGRVLYEEHAFCGYASVD-LQLSQEESLTSPHKA-ERLWAVSLFPYLTD  947

Query  910   TAVSFVMFAFLSCSQFNPITGKCHLQV-AAPPPIAASATVAPITQAQKAVETILSARPPN  968
             +A +F  F  L     NP TG+ +L    + PP + SA V+ +      +          
Sbjct  948   SAATFAAFHALHRGVLNPATGRYNLTARESTPPESDSALVSSVIGTLDRI----------  997

Query  969   GAVVCGPERTYMVLDYIYHPNMATLHFSTFFNTCRLNGVSFDLQRAIGAAFILADSLTAG  1028
                  G  R+Y V +Y++HPN++ + ++ FF+TCRL+GV FD++R +G+ F+LADSLTAG
Sbjct  998   -----GAPRSYAVAEYVFHPNVSIMSYNAFFHTCRLHGVCFDVERCVGSVFLLADSLTAG  1052

Query  1029  VMGLMCIGENDKEAFRIARQAVELIGDQVGVQAL--PDSLSGERL---GNFPHLLAIVRN  1083
             + G++  GE+  +A +  R A E+IG +VG Q++   DS  G  +   GNF  +L ++R+
Sbjct  1053  IFGVLSSGESATQALQYLRTAFEVIGREVGTQSMVSGDSDIGSSVQLSGNFAEILGLLRH  1112

Query  1084  KSDDPADRRKR  1094
             +     ++ KR
Sbjct  1113  RLSLEKEKEKR  1123

>PYU1_G001734
Length=800

 Score = 755 bits (1950),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/815 (47%), Positives = 533/815 (65%), Gaps = 49/815 (6%)

Query  313   NLRRNVEKIRGYNELLDTYSLHQFIIRKGKTLSDTPEFISFQRTTEDLWGSVSTSIQELE  372
             +LR+NVEKIRGYNELLDTYSLHQFII KGK + +TPEF+SF+R  +++WG V   I+ LE
Sbjct  3     DLRKNVEKIRGYNELLDTYSLHQFIIHKGKAMRETPEFVSFKRVAQEIWGGVEEVIKALE  62

Query  373   TMLTSYSVPLAYVDGQKLMKIAAMDATTRGTTELLSCILNMDEVSSLMRRPGQRYKGSQG  432
             T+LT Y VPLAYVDGQ+LM +A+M+  +    +LLSCI+N D+V SL+RRPGQRYKG   
Sbjct  63    TLLTRYFVPLAYVDGQRLMTVASMEMASFSKQDLLSCIVNEDQVGSLIRRPGQRYKGKDR  122

Query  433   PDLAVVLIQSVWRMFLTKKRLKNHHGNEDAAV-IQRIYRSYRCFSQLQQRLKLVREADLR  491
                A + IQ+V+RM+  +K+   +  +  + V IQ+++R+Y     L+++LK  R+    
Sbjct  123   KRRAAITIQNVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAYASHEDLRRKLKAQRQQQHE  182

Query  492   IWDAQMQRFRANWDTMKMQRRVVVHVPSFASDDRTRLKMDNFSIRQNLQMARMCAIADPN  551
              W+A+MQR +  W  +K  RRV++HVPS + D+R R++ DNF+++QNLQ++R+C I D N
Sbjct  183   QWEARMQRLQREWPRIKANRRVIIHVPSLSIDERFRIRADNFAVKQNLQLSRLCGIIDAN  242

Query  552   VDIIYISPFELSPDIQRYQVRLLQLGGITDPQTRIRMLHPENVDRFPEHFSLTTLLLYSP  611
             VDI+Y+SPFEL+ ++ +Y ++LLQLGGI DP TR++++ PE   RFP HFSLTT+LLYSP
Sbjct  243   VDIVYVSPFELTSEVGQYFMKLLQLGGIADPVTRVKLVFPEQATRFPAHFSLTTVLLYSP  302

Query  612   HCLKKIKRFVRGKNAYIVTGNVGPEDKRLAIALQIPLLGMDPDKALLYGTRSGGKRIFMA  671
             HCL++I+R V+GK AY+VTG  G EDKRLA+AL +P+LGMDP   L   T+SG KR FM 
Sbjct  303   HCLRRIRRCVKGKEAYLVTGMPGQEDKRLAMALNVPILGMDPLATLPLMTKSGSKRFFMR  362

Query  672   ADVNIPMGAHDIYDEDELIQSLSKLIAADVDQNEWLVKIDADQSDTGIASINVQQMQSVA  731
             ADVN+P G +DIYDEDELI SL+KLI + ++QN WL+KID D   TG A ++   + ++ 
Sbjct  363   ADVNVPTGTYDIYDEDELIFSLAKLIVSHIEQNVWLLKIDYDPFGTGTAIVDASVVTALR  422

Query  732   KVRAEKRDMKHMAAEYFQQPDVRDAVLRSIFNELTESYFAANITPCFPDVYASWAELRPV  791
             ++R EK+     + EY++QP  RD   R I  EL E      +TP  P+VY +W E    
Sbjct  423   EIRREKK-----SPEYWRQPGTRDNAARMIIAEL-ERTIGKLVTPLHPEVYPTWQEFADA  476

Query  792   ALRVGVVIEAYPSKVLSQVRANVFIEPSGGVHITSAHDLFMSPANKHLPQCA--LFPQTS  849
               + GVVIEA PS ++  +RAN+F+EPSG VH++S  D+ +S A+ H  + A   FPQT+
Sbjct  477   IAQFGVVIEAAPSAIVGYIRANLFVEPSGEVHVSSTQDVILSTASIHKRKVAGYAFPQTT  536

Query  850   VPYQAIRGASLAIASSMFIKGIIGYASIDYMSFADPKTLVGGGRPRQRLWAMQVVPGLTN  909
              PY+AIRGAS+AI   +    + GY+S+DY+ F + KT V       RLWAM + P LT+
Sbjct  537   APYEAIRGASMAIGKVLVDDSVFGYSSVDYLVFREDKTHV------PRLWAMALHPYLTD  590

Query  910   TAVSFVMFAFLSCSQFNPITGKCHLQVAAPPPI--------------------AASATVA  949
             +A +F +F  L+    N  TG+ HL   A   +                    A SAT A
Sbjct  591   SASTFAVFHLLNRGALNIHTGQYHLPAPAASGVPSSSTASSVSLKLNASSTRAAGSATSA  650

Query  950   PITQAQKAVETILSARPPNGAVVCGPERTYMVLDYIYHPNMATLHFSTFFNTCRLNGVSF  1009
              +   Q+A    L +    GA     +RTY V +YI+HPN++T+ +S+FF+TCRL+GV F
Sbjct  651   NLV-LQEATHLGLVSLEKAGA-----QRTYAVNEYIFHPNVSTMQYSSFFHTCRLHGVCF  704

Query  1010  DLQRAIGAAFILADSLTAGVMGLMCIGENDKEAFRIARQAVELIGDQVGVQALPDSLSGE  1069
             D++R  G  F+LADSLTAGV G++C G+    A    R A+E+IG +VG QAL D L G 
Sbjct  705   DVERCFGTIFMLADSLTAGVFGIICCGDTASAALGFLRTALEVIGREVGTQALTDDLRGG  764

Query  1070  ---RLGNFPHLLAIVRNKSDDPAD-----RRKRRG  1096
                  GNF  +L +VR  +   +      RR RRG
Sbjct  765   GDCESGNFAEVLTVVRTLTGGKSAKLEKIRRLRRG  799

>PYIW_18793
Length=997

 Score = 753 bits (1945),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/796 (47%), Positives = 522/796 (66%), Gaps = 46/796 (6%)

Query  314   LRRNVEKIRGYNELLDTYSLHQFIIRKGKTLSDTPEFISFQRTTEDLWGSVSTSIQELET  373
             LR+NVEKIRGYNELLDTYSLHQFII KG+ + +TPEF+SF+R  +++WGSV   I+ LE 
Sbjct  202   LRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFVSFKRVAQEVWGSVDEVIKALEA  261

Query  374   MLTSYSVPLAYVDGQKLMKIAAMDATTRGTTELLSCILNMDEVSSLMRRPGQRYKGSQGP  433
             +LT Y VPLAYVDGQ+LM +AAM+  +    +LLSCI+N D+V SL+RRPGQRYKG    
Sbjct  262   LLTRYFVPLAYVDGQRLMTVAAMEMASYSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRK  321

Query  434   DLAVVLIQSVWRMFLTKKRL-KNHHGNEDAAVIQRIYRSYRCFSQLQQRLKLVREADLRI  492
               A V IQ+ +RM+  +K+  +  H       IQR++R Y     L++R+K  R+     
Sbjct  322   RRAAVTIQNFFRMWWNQKKYSRFRHHLASVVAIQRVWRVYASHDDLKRRIKSQRDQQHAQ  381

Query  493   WDAQMQRFRANWDTMKMQRRVVVHVPSFASDDRTRLKMDNFSIRQNLQMARMCAIADPNV  552
             W+A+MQR + +W  +K  RRVV+HVPSF+ D+R RL  DNFS++QNLQ++R+C + D NV
Sbjct  382   WEAKMQRLKRDWIRIKGNRRVVIHVPSFSVDERLRLSADNFSVKQNLQLSRLCGLVDSNV  441

Query  553   DIIYISPFELSPDIQRYQVRLLQLGGITDPQTRIRMLHPENVDRFPEHFSLTTLLLYSPH  612
             DI+Y+SPFEL+ D+ +Y ++LLQLGGI DP  R++++ PE+  RFP HFSLTTLLLYSPH
Sbjct  442   DIVYVSPFELTTDVVQYSMKLLQLGGIADPVARVKLVFPEHAPRFPTHFSLTTLLLYSPH  501

Query  613   CLKKIKRFVRGKNAYIVTGNVGPEDKRLAIALQIPLLGMDPDKALLYGTRSGGKRIFMAA  672
             CL++I+R+++ K AY+VTG  GPEDKRLA+AL +P+LGMDP  AL   T+SGGKR FM A
Sbjct  502   CLRRIQRYIKNKEAYLVTGMPGPEDKRLAMALNVPILGMDPLSALPLMTKSGGKRFFMRA  561

Query  673   DVNIPMGAHDIYDEDELIQSLSKLIAADVDQNEWLVKIDADQSDTGIASINVQQMQSVAK  732
             DVN+P G +DIYDEDEL+ SL+KLI + ++Q+ W++KID D   TG A ++V  M ++ +
Sbjct  562   DVNVPTGTYDIYDEDELVFSLAKLIVSHIEQSVWVLKIDYDPFSTGTALLDVSTMVALRE  621

Query  733   VRAEKRDMKHMAAEYFQQPDVRDAVLRSIFNELTESYFAANITPCFPDVYASWAELRPVA  792
             +R EKR     + EY++QP  RD   R I  EL E      +TP  P++Y SW +     
Sbjct  622   IRREKR-----SPEYWRQPGTRDNAARVIIAEL-ERTLGNLVTPLHPELYPSWQDYADAI  675

Query  793   LRVGVVIEAYPSKVLSQVRANVFIEPSGGVHITSAHDLFM----------SPANKHLPQC  842
             ++ GVV+EA PS V+  VRAN+F+EPSG VH++S  D+ +            A +H    
Sbjct  676   VQFGVVVEAAPSAVVGHVRANLFVEPSGEVHVSSTQDILLSSSGGCGGKPGGAYRHKSVG  735

Query  843   ALFPQTSVPYQAIRGASLAIASSMFIKGIIGYASIDYMSFADPKTLVGGGRPRQRLWAMQ  902
               FPQT+ PY+AIRGAS AI   +    + GYASID++ F + K+         RLWAM 
Sbjct  736   YAFPQTAAPYEAIRGASTAIGKLLAEDNVFGYASIDFLVFQEDKSHTA------RLWAMA  789

Query  903   VVPGLTNTAVSFVMFAFLSCSQFNPITGKCHLQVAAPPPIAASATVAPITQAQ-------  955
             + P LT++A +F  F  L+    N  +G  +L        AA+ T A + Q Q       
Sbjct  790   LRPYLTDSAATFTTFHLLNRGALNTTSGLYYLP-------AATVTSASLVQLQSSSAAFA  842

Query  956   ---KAVETILSARPPNGAVV---CGPERTYMVLDYIYHPNMATLHFSTFFNTCRLNGVSF  1009
                 A + +L     +G V     G + TY+V +YI+HPN++T+ +S FF+TCRL+GV F
Sbjct  843   SGASAADLVLHEATHSGLVSLEKVGAQHTYVVSEYIFHPNVSTMQYSAFFHTCRLHGVCF  902

Query  1010  DLQRAIGAAFILADSLTAGVMGLMCIGENDKEAFRIARQAVELIGDQVGVQALPDSLS--  1067
             D++R +G+ F+LADSLTAGV GLMC  +    A    R A+E++G +VG QAL D  +  
Sbjct  903   DVERCVGSVFLLADSLTAGVFGLMCCSDTASGALGFLRTALEVVGREVGTQALTDEFTSG  962

Query  1068  GE-RLGNFPHLLAIVR  1082
             GE   GNF  +LA +R
Sbjct  963   GEAETGNFADVLAAIR  978

 Score = 115 bits (287),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 72/90 (80%), Gaps = 3/90 (3%)

Query  160  RLLPKMNRTDPTAPSPDLVEEDARGGVHNLVTRGFLPPSVDVTPAF--THGTSVIQNSRV  217
            RLLP +N+ DP+AP+P+L E+DA+ G+ +LV RGFLP   D+T AF  +HG  +IQN + 
Sbjct  6    RLLPSVNKCDPSAPTPELSEQDAKNGMLSLVNRGFLPVGTDLTSAFVNSHG-GIIQNHKT  64

Query  218  KIYDRASQPVKSMPYTNPSGFNMASLKFDM  247
            +IYDR  QP++++P+TNPSGFN+A+LKFD+
Sbjct  65   RIYDRQEQPIRAVPHTNPSGFNIATLKFDL  94

>PYIR_13453
Length=1186

 Score = 747 bits (1929),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/798 (46%), Positives = 521/798 (65%), Gaps = 41/798 (5%)

Query  314   LRRNVEKIRGYNELLDTYSLHQFIIRKGKTLSDTPEFISFQRTTEDLWGSVSTSIQELET  373
             LR+NVEKIRGYNELLDTYSLHQFII KG+ + +TPEF+SF+R  +++WGSV   I+ LE 
Sbjct  382   LRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFVSFKRVAQEVWGSVEEVIRALEA  441

Query  374   MLTSYSVPLAYVDGQKLMKIAAMDATTRGTTELLSCILNMDEVSSLMRRPGQRYKGSQGP  433
             +LT Y VPLAY+DGQ+LM +AAM+       +LLSCI+N D+V SL+RRPGQRYKG    
Sbjct  442   LLTRYFVPLAYIDGQRLMTVAAMEMAAFSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRK  501

Query  434   DLAVVLIQSVWRMFLTKKRL-KNHHGNEDAAVIQRIYRSYRCFSQLQQRLKLVREADLRI  492
               A + IQ+ +RM+  +K+  +  H       IQR++R++     L+++LK  R      
Sbjct  502   RRAAITIQNFFRMWWNQKKYTRFRHHLASVVTIQRVWRAFASHESLKRKLKFQRAQQHEQ  561

Query  493   WDAQMQRFRANWDTMKMQRRVVVHVPSFASDDRTRLKMDNFSIRQNLQMARMCAIADPNV  552
             W+A+MQR + +W  +K  RRVV+HVPS + D+R+R+  DNFS++QN+Q++R+C + DPNV
Sbjct  562   WEAKMQRLKRDWTHIKGNRRVVIHVPSLSIDERSRISADNFSVKQNIQLSRLCGLIDPNV  621

Query  553   DIIYISPFELSPDIQRYQVRLLQLGGITDPQTRIRMLHPENVDRFPEHFSLTTLLLYSPH  612
             DI+Y+SPFEL+ D+ +Y ++LLQLGGI DP  R+++++PE   RFP HFSLTTLLLYSPH
Sbjct  622   DIVYVSPFELTADVAQYSMKLLQLGGIADPVARVKLVYPEQAARFPAHFSLTTLLLYSPH  681

Query  613   CLKKIKRFVRGKNAYIVTGNVGPEDKRLAIALQIPLLGMDPDKALLYGTRSGGKRIFMAA  672
             CL++I+R++R K AY+VTG  G EDKRLA+AL +P+LGMDP  AL   T+SG KR FM A
Sbjct  682   CLRRIQRYIRNKEAYLVTGIPGREDKRLAVALNVPILGMDPLSALPLMTKSGSKRFFMRA  741

Query  673   DVNIPMGAHDIYDEDELIQSLSKLIAADVDQNEWLVKIDADQSDTGIASINVQQMQSVAK  732
             DVN+P G +DIYDEDEL+ SL+KLI + ++Q+ W++KID D   TG A ++V  M  + +
Sbjct  742   DVNVPTGTYDIYDEDELVFSLAKLIMSHIEQSVWVLKIDYDPFGTGTALLDVSTMTVLRE  801

Query  733   VRAEKRDMKHMAAEYFQQPDVRDAVLRSIFNELTESYFAANITPCFPDVYASWAELRPVA  792
             +R EK+     + EY++QP  RD   R+I  EL E   A  +TP  P+VY SW E     
Sbjct  802   IRREKK-----SPEYWKQPSTRDNAARAIIAEL-ERTLAHLVTPLHPEVYPSWQEFVDAI  855

Query  793   LRVGVVIEAYPSKVLSQVRANVFIEPSGGVHITSAHDLFMSPANKHLPQCAL--------  844
              + GVV+EA PS V+  VRAN+FIEPSG VH++S  D+  + +N                
Sbjct  856   SQFGVVVEAAPSAVIGHVRANLFIEPSGEVHVSSTQDIITTSSNSSSSGGGAGKKAGAYR  915

Query  845   -------FPQTSVPYQAIRGASLAIASSMFIKGIIGYASIDYMSFADPKTLVGGGRPRQR  897
                    FPQT+ PY+AIRGAS AI   +  + + GY+SIDY+ F + KT         R
Sbjct  916   SKTVGYAFPQTAAPYEAIRGASTAIGKLLADECVFGYSSIDYLVFQEDKTHAA------R  969

Query  898   LWAMQVVPGLTNTAVSFVMFAFLSCSQFNPITGKCHLQVAAPPPIAASATVAPITQAQ--  955
             LWAM + P LT++A +F  F  L+    N  +G  HL   A  P ++S      + ++  
Sbjct  970   LWAMALHPYLTDSASTFATFHLLNRGALNASSGLYHLPPVAASPSSSSTKSLKPSHSRAA  1029

Query  956   -----KAVETILSARPPNGAVV---CGPERTYMVLDYIYHPNMATLHFSTFFNTCRLNGV  1007
                   A + ++     +G V     G +RTY+V +YI+HPN++T+ +S FF+TCRL+GV
Sbjct  1030  GATGTSAADLVMQEATHSGLVSLEKAGAQRTYVVSEYIFHPNVSTMQYSAFFHTCRLHGV  1089

Query  1008  SFDLQRAIGAAFILADSLTAGVMGLMCIGENDKEAFRIARQAVELIGDQVGVQALPDSLS  1067
              FD++R +G+ F+LADSLTAGV G+MC  ++   A    R A+E+IG +VG QAL D   
Sbjct  1090  CFDVERCVGSVFLLADSLTAGVFGIMCCSDSASGALGFLRTALEVIGREVGTQALMDEFM  1149

Query  1068  G---ERLGNFPHLLAIVR  1082
             G      GNF  +LA++R
Sbjct  1150  GGGESETGNFADVLAVIR  1167

 Score = 189 bits (481),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 122/271 (45%), Positives = 164/271 (61%), Gaps = 36/271 (13%)

Query  1    MDKLCQQYHAEDVGRILLQAQDELR---------------SMRekvneknnvdvneinAI  45
            MD+  QQ+H EDVGRILLQ Q++LR               SMR   +  +  DV     I
Sbjct  1    MDQFQQQHHVEDVGRILLQTQEQLRLMREQMAATSTTPSSSMRFASSGASQPDVLAFQEI  60

Query  46   LERAEADLRAKAEIVLNGVVNNSMKMLPAIEAPGGKTSLSKFSSKLAQKRELAATMT---  102
            L+RAE ++RAKAE+VLNG VN S +   A   P   +S +  +S  A+ R+   ++T   
Sbjct  61   LQRAEVEIRAKAELVLNGFVNTSSQ---ASALPTVSSSANGNASPKARLRQNVTSLTAAR  117

Query  103  ---RDSSYEPASPTYRQEDREPRFGGP-IEPMERDRAPGRRPVGRIIKAGSLVKKKTTKP  158
               R +S EP    +R      RF  P +E +     P   PV RI K G LVKKK  + 
Sbjct  118  RNSRLASDEPDLDYFR-----ARFHNPAVEFVSSPVLPS--PVQRITK-GQLVKKKMAQN  169

Query  159  HRLLPKMNRTDPTAPSPDLVEEDARGGVHNLVTRGFLPPSVDVTPAF--THGTSVIQNSR  216
             RLLP +N++DP+AP+P+L E+DA+ G+ +LV RGFLP   D+TPAF   HG S+I+NS+
Sbjct  170  ARLLPSVNKSDPSAPTPELSEQDAKSGMLSLVNRGFLPVGADLTPAFINNHG-SIIKNSK  228

Query  217  VKIYDRASQPVKSMPYTNPSGFNMASLKFDM  247
             +IYDR  QP++SMP TNPSGFN+ASLKFD+
Sbjct  229  TRIYDRQEQPIRSMPSTNPSGFNVASLKFDI  259

>PHYRA_95901
Length=1075

 Score = 714 bits (1842),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/1129 (38%), Positives = 643/1129 (57%), Gaps = 120/1129 (11%)

Query  1     MDKLCQQYHAEDVGRILLQAQDELRSMRek-----------------vneknnvdvnein  43
             M+K+ QQ+H EDVGR+LLQ Q++LR MRE+                        +V   N
Sbjct  1     MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSAVVTTAEVQAFN  60

Query  44    AILERAEADLRAKAEIVLNGVVNNSMKMLPAIEAPGGKTSLSKFSSKLAQKRELAATMTR  103
             AIL++ E +LRAKAE+VL G+VN+S            +T+ S+  + L      A   TR
Sbjct  61    AILQQTEVELRAKAELVLKGMVNSS---------SSAQTNQSQSGTLLPVVTVAAPPSTR  111

Query  104   D-SSYEPASPTYRQEDREPRFGGPIEPMERDRAPG----RRPVGRIIKAGSLVKKKTTKP  158
               S Y  AS    +  RE      +E + +   P     +R +G  I+ G L++KKTT+ 
Sbjct  112   HRSGYGDASSIPIEFFREQFHNSSVE-VRQSLMPSPQHWQRHLG--IQHGRLLRKKTTQH  168

Query  159   HRLLPKMNRTDPTAPSPDLVEEDARGGVHNLVTRGFLPPSVDVTPAFTHGTSVIQNSRVK  218
              RLLP +N+ DPTAP+P+L EEDA+ GV NLVTR         +     G+ V++    +
Sbjct  169   CRLLPSVNKVDPTAPTPELREEDAKHGVLNLVTR---------SSGTKDGSGVMKQRATR  219

Query  219   IYDRASQPVKSMPYTNPSGFNMASLKFDMsttpatstpspvaavvsG-----GDVSKMVV  273
             IYDR+ QP ++ P+T  +G+N+A+LKFD+ +T           +        G++S    
Sbjct  220   IYDRSEQPARATPFTQSTGYNLAALKFDLRSTGTGKNDRSNDDMEGNREHIDGEISDEDQ  279

Query  274   TPIDISFDAPSSSHPPVEQPKggatggddtnggdsstIHNLRRNVEKIRGYNELLDTYSL  333
                D   D  +                          +  L  NV+KIRGYN+LLD YSL
Sbjct  280   GGADNDKDEEAE-------------------------MEELGANVDKIRGYNDLLDAYSL  314

Query  334   HQFIIRKGKTLSDTPEFISFQRTTEDLWGSVSTSIQELETMLTSYSVPLAYVDGQKLMKI  393
             HQF+I KG+++ DTPEF+SF+R  ++LWGSV  +++ LET+LT Y VPLAYVDGQ+L+ +
Sbjct  315   HQFLIHKGRSMRDTPEFVSFRRVAQELWGSVEEALRALETLLTQYFVPLAYVDGQRLLSL  374

Query  394   AAMDATTRGTTELLSCILNMDEVSSLMRRPGQRYKGSQGPDLAVVLIQSVWRMFLTKKR-  452
             AA        +ELL+CI+N ++V S++RRPGQRYKG      A   IQ+  RM+  ++R 
Sbjct  375   AATGQPRFSKSELLACIVNEEQVMSVLRRPGQRYKGRDRKRRAATTIQACVRMWSIRRRY  434

Query  453   LKNHHGNEDAAVIQRIYRSYRCFSQLQQRLKLVREADLRIWDAQMQRFRANWDTMKMQRR  512
             +++   +  A  IQ  +RSY C + L+ RL+ VR   L  W+A+MQ  R  W  +  +RR
Sbjct  435   VRSRASDISATRIQLAWRSYSCHAALKTRLREVRREQLERWEARMQDLRTQWPQIAGRRR  494

Query  513   VVVHVPSFASDDRTRLKMDNFSIRQNLQMARMCAIA-DPNVDI-IYISPFELSPDIQRYQ  570
             VVVHVPS + D+ +RL  +NF+++QNLQ+ R+CA A D +VD+ +Y+SPFEL+ D+ +Y 
Sbjct  495   VVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSHVDLLVYVSPFELTADVSQYF  554

Query  571   VRLLQLGGITDPQTRIRMLHPENVDRFPEHFSLTTLLLYSPHCLKKIKRFVRGKNAYIVT  630
             ++LLQLGG+ D + R++++ PE   RFP+HFSL++LLLYSPHCL++I+ +  GK AY+V 
Sbjct  555   LKLLQLGGLADSRPRVKLVFPEQAARFPDHFSLSSLLLYSPHCLRRIRHYTAGKEAYLVM  614

Query  631   GNVGPEDKRLAIALQIPLLGMDPDKALLYGTRSGGKRIFMAADVNIPMGAHDIYDEDELI  690
             G  G ED+RLA+AL +P+LG  P +AL   TRSGGKR+ + ADVN+P G +++YDE EL 
Sbjct  615   GLPGAEDQRLAVALDLPILGAPPAQALPLLTRSGGKRLLIRADVNVPTGTYELYDEHELF  674

Query  691   QSLSKLIAADVDQNEWLVKIDADQSDTGIASINVQQMQSVAKVRAEKRDMKHMAAEYFQQ  750
              +L+KL  A ++Q +WL+K+D D    G A +++  MQ++ ++R EKR       EY++Q
Sbjct  675   AALAKLAVAHMEQPKWLLKLDYDPLGIGEAVVDLSGMQAMRELRREKR-----TPEYWRQ  729

Query  751   PDVRDAVLRSIFNELTESYFAANI-TPCFPDVYASWAELRPVALRVGVVIEAYP------  803
             P  RDA  + +  EL      A + TP   +++ +W +        G VIEA P      
Sbjct  730   PGPRDAAAKLVLAELERPGVLARLATPMHTEIFPAWRDFTEAIGHFGCVIEAVPPAGIAA  789

Query  804   ----SKVLSQ---VRANVFIEPSGGVHITSAHDLFMSPANKHLPQCAL-FPQTSVPYQAI  855
                 S +L +   VRAN+F+ P G   + S      S    +    A  FPQT+ P++A+
Sbjct  790   TPESSSLLVEPAYVRANLFVYPDGKNVLAS------SGGGLNRKTVAFTFPQTAAPHEAV  843

Query  856   RGASLAIASSMFIKGIIGYASIDYMSFADPKTLVGGGRPRQRLWAMQVVPGLTNTAVSFV  915
             +GA  A    +    + GY S+D++ F D K    GG P  RLWA+ V P LT++A SF 
Sbjct  844   QGACDATGKLLVETSVWGYVSLDFVVFQDEKN---GGSP--RLWALAVHPFLTDSAASFA  898

Query  916   MFAFLSCSQFNPITGKCHLQVAAPPPIAASATVAPITQAQKAVETILSARPPNGAVVCGP  975
              F  L+   +       +  V A P  + S   A +         +L       A + G 
Sbjct  899   CFHLLARGAYR--VAASNSMVNANPGRSGSGGAADL---------LLREASLTKAALAGA  947

Query  976   ERTYMVLDYIYHPNMATLHFSTFFNTCRLNGVSFDLQRAIGAAFILADSLTAGVMGLMCI  1035
              R ++V  Y++HP++ T+ +S FF+ CRL+GV FD++R +G  F+LADSLTAGV G++ +
Sbjct  948   PRCFVVCSYVFHPHVTTMQYSAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGILSV  1007

Query  1036  GENDKEAFRIARQAVELIGDQVG--VQALPDSLSGERLGNFPHLLAIVR  1082
             GE  + A    R A+E+IG +VG  ++         R GNF  +L+ VR
Sbjct  1008  GETTEGALAFLRTALEVIGREVGATIEMATSRPVSTRNGNFAQVLSAVR  1056

>PHALS_06477
Length=1166

 Score = 710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/1170 (36%), Positives = 635/1170 (54%), Gaps = 107/1170 (9%)

Query  1     MDKLCQQYHAEDVGRILLQAQDELRSMRekvneknnvdvnein-----------------  43
             M+K+ Q YH EDVGR+LL+ Q++LR+MRE++           +                 
Sbjct  16    MEKVQQHYHVEDVGRLLLETQEQLRAMREQMTAAAASMEANKSPKRHSSVITNAEVQAFH  75

Query  44    AILERAEADLRAKAEIVLNGVVNNSMKM----------LPAIE-APGGKTSLSKFSSKLA  92
             A+L++ E++LRAKAE+VLNG++N+S  +          LPA+  A        +  S+  
Sbjct  76    ALLQQTESELRAKAELVLNGIINSSNSVHNSQVQRNTRLPAVSVAAPSPIKHRRGDSRAD  135

Query  93    QKRELAATMTRDSSYEPASPTYRQEDREPRFGGPIEPMERDRAPGRRPVGRIIKAGSLVK  152
             +   +       +S E     +R    E R      P    R  G R V          +
Sbjct  136   EFGHINRIDNNSTSMEFFRQQFRNNRVEIRQSLMTSPENWRRKSGARRV----------R  185

Query  153   KKTTKPHRLLPKMNRTDPTAPSPDLVEEDARGGVHNLVTRGFLPPSVDVTPAFT------  206
             KKTT+ +RLLP +N+ DP+ P+PDL EEDA  G+ NLVTRGFLP   D+TPAF       
Sbjct  186   KKTTQHYRLLPCVNKADPSEPTPDLREEDATCGLLNLVTRGFLPAYADLTPAFAGPNGKS  245

Query  207   --HGTSVIQNSRVKIYDRASQPVKSMPYTNPSGFNMASLKFDMsttpa------------  252
                G   +++    IYDR+ +  +  P     GFN+A LKFD  T+              
Sbjct  246   NGSGGCALKHRATYIYDRSKRSARCTPLVYSIGFNLAGLKFDFRTSSTPSSAPKPNHSAT  305

Query  253   ------tstpspvaavvsGGDVSK---MVVTPIDISFDAPSS-SHPPVEQPKggatggdd  302
                    +  S +   VS G   +   +V  P + + D  ++ +H   +Q     +   D
Sbjct  306   VSASMPNTKFSSIMQTVSSGPAKRNSLVVAAPRNQNEDIENNCTHSFEDQEDEEGSDDSD  365

Query  303   tnggdsstIHNLRRNVEKIRGYNELLDTYSLHQFIIRKGKTLSDTPEFISFQRTTEDLWG  362
                 +  +  +L  NV KIR YN+L+D YSLHQ +I KG+ + DTPEF SF+R   DLWG
Sbjct  366   IIKDEGFSTKDLAVNVAKIREYNDLVDAYSLHQILIYKGRAIRDTPEFTSFRRVVHDLWG  425

Query  363   SVSTSIQELETMLTSYSVPLAYVDGQKLMKIAAMDATTRGTTELLSCILNMDEVSSLMRR  422
             SV   ++ LE +L  Y VPLA+VDGQ+L+ +A+ +       ELLSCI+N ++V S++RR
Sbjct  426   SVEEVLRALEAILFQYFVPLAHVDGQRLIALASTNQPQFSRRELLSCIVNKEQVMSVLRR  485

Query  423   PGQRYKGSQGPDLAVVLIQSVWRMFLTKKR-LKNHHGNEDAAVIQRIYRSYRCFSQLQQR  481
             PGQRY G      A   IQ+  RM++   R +K+   N +A  IQ  +R+Y   + L+ R
Sbjct  486   PGQRYNGRDRKHRAATTIQACARMWMVHHRYVKSRSSNINAIKIQSAFRAYSRCTALKAR  545

Query  482   LKLVREADLRIWDAQMQRFRANWDTMKMQRRVVVHVPSFASDDRTRLKMDNFSIRQNLQM  541
             L+ +R      W+A+M  F++ W  +  +RR+VVHVPS +  + +RL  +NF+++QNLQ+
Sbjct  546   LREIRCEKAAKWEARMYEFKSQWSQIAARRRIVVHVPSMSLGEHSRLNAENFAVQQNLQL  605

Query  542   ARMCAIA-DPNVDI-IYISPFELSPDIQRYQVRLLQLGGITDPQTRIRMLHPENVDRFPE  599
              R+CA A D  VD+ +Y+SP+EL+ D+ +Y  +LLQL G  D + R++ ++PE   RFP 
Sbjct  606   TRICAAALDLQVDLLVYVSPYELTADVSQYFHKLLQLSGPADSRPRVKFVYPEQAARFPA  665

Query  600   HFSLTTLLLYSPHCLKKIKRFVRGKNAYIVTGNVGPEDKRLAIALQIPLLGMDPDKALLY  659
             HFSL++L+LYSP+CL++I+ +  G  AY+V G  GPED+RLAI L +P+LG  P +AL  
Sbjct  666   HFSLSSLILYSPYCLRRIRHYTAGNEAYLVMGLPGPEDQRLAITLDLPILGALPSQALPL  725

Query  660   GTRSGGKRIFMAADVNIPMGAHDIYDEDELIQSLSKLIAADVDQNEWLVKIDADQSDTGI  719
              TRSGGKR+ + AD+N+P G +++YDE E+  +L+KL  A +DQ++WL+K+D D    G 
Sbjct  726   LTRSGGKRLLIQADINVPTGTYELYDEHEISVALAKLAVAHIDQSKWLIKLDYDPLGVGE  785

Query  720   ASINVQQMQSVAKVRAEKRDMKHMAAEYFQQPDVRDAVLRSIFNELTE-SYFAANITPCF  778
             A +++  MQ++ ++  EKR       EY++QP  RDA       E       A   TP  
Sbjct  786   AVVDLSSMQAMRELHREKR-----TPEYWRQPGTRDAAANLFLTEFERPGKLARLTTPIH  840

Query  779   PDVYASWAELRPVALRVGVVIEAYPSKVL-------SQVRANVFIEPSGGVHITSAHDLF  831
              ++Y +W E        G VIEA P           + +RAN+F++P+G VH+TS  ++ 
Sbjct  841   TELYPTWREYAAAIGHFGCVIEAVPPTASAASMEEPTYLRANIFVDPNGTVHMTSTQNVL  900

Query  832   MSPAN--KHLPQCALFPQTSVPYQAIRGASLAIASSMFIKGIIGYASIDYMSFADPKTLV  889
              +         +   FPQT  P+ AI+GA  A+   +    + GY S+D++ F D K+  
Sbjct  901   TTTRGGLSRKSEIFAFPQTVAPHAAIKGACNAVGKQLAETNVWGYVSLDFVVFQDIKSNA  960

Query  890   GGGRPRQRLWAMQVVPGLTNTAVSFVMFAFLS--CSQFNP----ITGKCHLQVAAPPPIA  943
                    RLWA+ + P LTN+A +F  F  L+  C   N     + G   LQ        
Sbjct  961   A-----VRLWALAIHPFLTNSAATFACFHLLTRGCLDANSGIYRVPGTKKLQ--------  1007

Query  944   ASATVAPITQAQKAVETILSARPPNGAVVCGPERTYMVLDYIYHPNMATLHFSTFFNTCR  1003
              +A  A  +    A++ +L       A+  G  R Y+V  Y++HPN+    ++TFF  CR
Sbjct  1008  -TACTAEQSGNHDAMDLLLREASLTKAIFQGATRCYVVCSYVFHPNVTATQYTTFFQNCR  1066

Query  1004  LNGVSFDLQRAIGAAFILADSLTAGVMGLMCIGENDKEAFRIARQAVELIGDQVG-VQAL  1062
             L+GV FD+ RA+G  F+LADSLTAGV G++ IGE  ++A    R A+E+IG + G  + +
Sbjct  1067  LHGVCFDVSRALGTLFLLADSLTAGVFGILSIGETAQDALSYLRTALEVIGREAGATKGI  1126

Query  1063  PDSLSGERLGNFPHLLAIVRNKSDDPADRR  1092
               S S   LGNF  +L+ VR  +   +  R
Sbjct  1127  VSSSSRSVLGNFADVLSTVRASTGGGSSNR  1156

>PHYSO_321157
Length=1180

 Score = 628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/792 (41%), Positives = 481/792 (61%), Gaps = 43/792 (5%)

Query  317   NVEKIRGYNELLDTYSLHQFIIRKGKTLSDTPEFISFQRTTEDLWGSVSTSIQELETMLT  376
             NV+KIRGYNELLD YSLHQF+I KG+T+ DTPEF+SF+R  ++LWGSV  +++ LET+LT
Sbjct  387   NVDKIRGYNELLDAYSLHQFLIHKGRTMRDTPEFVSFRRVAQELWGSVEEALRALETLLT  446

Query  377   SYSVPLAYVDGQKLMKIAAMDATTRGTTELLSCILNMDEVSSLMRRPGQRYKGSQGPDLA  436
              Y VPLAY DGQ+L+ +A+         ELLSCI+N ++V +++RRPGQRYKG      A
Sbjct  447   QYFVPLAYADGQRLLSLASTGQPRFSKRELLSCIVNEEQVMAVLRRPGQRYKGRDRKRRA  506

Query  437   VVLIQSVWRMFLTKKR-LKNHHGNEDAAVIQRIYRSYRCFSQLQQRLKLVREADLRIWDA  495
                IQ+  RM+  ++R +++   +  A  IQ  +R++ C + L+ RL+ +R   L  W+A
Sbjct  507   ATTIQACVRMWSIRRRYVRSRASDFSATKIQLAWRAFSCHAALKARLRELRREQLDNWEA  566

Query  496   QMQRFRANWDTMKMQRRVVVHVPSFASDDRTRLKMDNFSIRQNLQMARMCAIA-DPNVDI  554
             +M   +  W  +  +RRVVVHVPS + D+ +RL  +NF+++QNLQ+ R+CA A D NVD+
Sbjct  567   KMNDLKTQWHQIAGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSNVDL  626

Query  555   -IYISPFELSPDIQRYQVRLLQLGGITDPQTRIRMLHPENVDRFPEHFSLTTLLLYSPHC  613
              +Y++PFEL+ D+  Y ++LLQLGG+ D + R++++ PE   RFP HFSL+++LLYSPHC
Sbjct  627   LVYVAPFELTADVSHYFLKLLQLGGLADSRPRVKLVFPEQAARFPAHFSLSSVLLYSPHC  686

Query  614   LKKIKRFVRGKNAYIVTGNVGPEDKRLAIALQIPLLGMDPDKALLYGTRSGGKRIFMAAD  673
             L++I+ +  GK+AY+V G  G ED+RLAIAL +P+LG  P +AL   TRSGGKR+ + AD
Sbjct  687   LRRIRHYTAGKDAYLVMGLPGTEDQRLAIALDLPILGAPPPQALPLLTRSGGKRLLIRAD  746

Query  674   VNIPMGAHDIYDEDELIQSLSKLIAADVDQNEWLVKIDADQSDTGIASINVQQMQSVAKV  733
             VN+P G +++YDE EL  +L+KL  A +DQ  WL+K+D D    G A +++  MQ++ ++
Sbjct  747   VNVPTGTYELYDEHELFAALAKLAVAHMDQPRWLLKLDYDPLGVGEAVVDLSGMQAMREL  806

Query  734   RAEKRDMKHMAAEYFQQPDVRDAVLRSIFNELTESYFAANI-TPCFPDVYASWAELRPVA  792
             R EK+       EY++QP  RDA  + +  EL      A + TP   +++ SW E     
Sbjct  807   RREKK-----TPEYWRQPGPRDAASKLVLAELERPGVLARLATPMHTEIFPSWREYTEAI  861

Query  793   LRVGVVIEAYPSKVL-------------SQVRANVFIEPSGGVHITSAHDLFMSPANKHL  839
                G V+EA P                 + VRAN+FI+P G VHITS  ++  S    + 
Sbjct  862   SHFGCVVEAVPPTSFVASPETASSSVEPAYVRANLFIDPDGTVHITSTQNVLASGGGLNR  921

Query  840   PQCAL-FPQTSVPYQAIRGASLAIASSMFIKGIIGYASIDYMSFADPKTLVGGGRPRQRL  898
                A  FPQT  P++A++GA  A    +    + GY S+D++ F D K+   GG P  RL
Sbjct  922   KTVAFTFPQTVAPHEAVKGACTAAGKLLVETNVWGYVSLDFVVFQDDKS---GGAP--RL  976

Query  899   WAMQVVPGLTNTAVSFVMFAFLSCSQFNPITGKCHLQVAAPPPIAASATVAPIT----QA  954
             WA+ V P LT++A SF  F  L+    +  +G   +        AA++T+A +       
Sbjct  977   WALAVHPFLTDSAASFACFHLLARGVLDASSGGYRM-------AAANSTLAAVNSGRSGG  1029

Query  955   QKAVETILSARPPNGAVVCGPERTYMVLDYIYHPNMATLHFSTFFNTCRLNGVSFDLQRA  1014
                 + +L           G  R Y+V  Y++HP++ T+ ++ FF+ CRL+GV FD++R 
Sbjct  1030  GGTTDLLLREASLAKGAQAGTPRCYVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERT  1089

Query  1015  IGAAFILADSLTAGVMGLMCIGENDKEAFRIARQAVELIGDQVG----VQALPDSLSGER  1070
             +G  F+L DSLTAGV G++ +GE    A    R A+E+IG + G    +   P      R
Sbjct  1090  LGTLFLLTDSLTAGVFGVLSVGETTDGALAFMRTALEVIGREAGATVEMATSPSRPGSAR  1149

Query  1071  LGNFPHLLAIVR  1082
              GNF  +L+ VR
Sbjct  1150  SGNFAQVLSAVR  1161

 Score = 155 bits (391),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 108/284 (38%), Positives = 154/284 (54%), Gaps = 48/284 (17%)

Query  1    MDKLCQQYHAEDVGRILLQAQDELRSMRek-----------------vneknnvdvnein  43
            M+K+ QQ+H EDVGR+LLQ Q++LR MRE+                        +V   N
Sbjct  1    MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSAVVTTAEVQAFN  60

Query  44   AILERAEADLRAKAEIVLNGVVNNSM----------KMLPAIE--APGGKTSLSKFSSKL  91
            AIL++ EA+LRAKAE+VLNG+VN+S            +LPA+   AP      S ++   
Sbjct  61   AILQQTEAELRAKAELVLNGMVNSSSSAQNNQSQSGTLLPAVTVAAPPSTRHRSGYAKPR  120

Query  92   AQKRELAATMTRDSSYEPASPTYRQEDREPRFGGPIEPMERDRAPGRRPVGRIIKAGSLV  151
              K   A+++  +   E     +R    E R      P+   R  G       I  G L+
Sbjct  121  VAKSMDASSIPMEFFRE----QFRNSSVEVRQTLMPSPLHLQRHLG-------IHHGRLM  169

Query  152  KKKTTKPHRLLPKMNRTDPTAPSPDLVEEDARGGVHNLVTRGFLPPSVDVTPAFT-----  206
            +KKTT+  RLLP +N+ DP+AP+P+L EEDA+ GV NLVTRGFLP   D+TPAF      
Sbjct  170  RKKTTQHCRLLPSVNKVDPSAPTPELREEDAKHGVLNLVTRGFLPAYADLTPAFAGPSGA  229

Query  207  ---HGTSVIQNSRVKIYDRASQPVKSMPYTNPSGFNMASLKFDM  247
                G  V++    +I+DR+ Q V+  P+T  +G+N+A+LKFD+
Sbjct  230  NDGSGGGVMKQRATRIHDRSEQSVRPTPFTQSTGYNLAALKFDL  273

>PITG_18457
Length=1170

 Score = 615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/813 (41%), Positives = 493/813 (61%), Gaps = 42/813 (5%)

Query  311   IHNLRRNVEKIRGYNELLDTYSLHQFIIRKGKTLSDTPEFISFQRTTEDLWGSVSTSIQE  370
             +  L  NV+KIRGYNELLD YSLHQF+I KG+T+ DTPEF+SF+R T++LWGSV  +++ 
Sbjct  371   MEKLGANVDKIRGYNELLDVYSLHQFLIHKGRTMRDTPEFVSFRRVTQELWGSVEEALRA  430

Query  371   LETMLTSYSVPLAYVDGQKLMKIAAMDATTRGTTELLSCILNMDEVSSLMRRPGQRYKGS  430
             LET+L  Y VPLAYVDGQ+L+ +A          ELLSCI+N D+V S++RRPGQRYKG 
Sbjct  431   LETLLAQYFVPLAYVDGQRLLALAGTGQPRFSKRELLSCIVNEDQVMSVLRRPGQRYKGR  490

Query  431   QGPDLAVVLIQSVWRMFLTKKRLKNHHGNE-DAAVIQRIYRSYRCFSQLQQRLKLVREAD  489
                  A   I++  RM+L ++R      ++ +A+ IQ  +R+Y C + L+ RL+ V    
Sbjct  491   DRKRRAATTIEACVRMWLVRRRYARTRASDFNASKIQLAWRAYSCHTSLKARLREVHLEK  550

Query  490   LRIWDAQMQRFRANWDTMKMQRRVVVHVPSFASDDRTRLKMDNFSIRQNLQMARMCAIA-  548
             L  W+ +M   +++W  +  +RRVVVHVPS + D+ +RL  +NF+I+QNLQ+ R+CA A 
Sbjct  551   LEKWEKRMHNLKSHWPQIAGRRRVVVHVPSLSLDEHSRLGAENFAIQQNLQLTRVCAAAL  610

Query  549   DPNVDII-YISPFELSPDIQRYQVRLLQLGGITDPQTRIRMLHPENVDRFPEHFSLTTLL  607
             D NV+++ Y+SPFEL+ D+ +Y ++LLQLGG+ D + R++++ PE   RFP HFSL++LL
Sbjct  611   DSNVELLLYVSPFELTSDVSQYFLKLLQLGGLVDSRPRVKLVFPEQTTRFPAHFSLSSLL  670

Query  608   LYSPHCLKKIKRFVRGKNAYIVTGNVGPEDKRLAIALQIPLLGMDPDKALLYGTRSGGKR  667
             LYSPHCL++I+ +  GK AY+V G  G ED+RLA+AL +P+LG  P +AL   TRSGGKR
Sbjct  671   LYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAMALDLPILGAPPAQALPLLTRSGGKR  730

Query  668   IFMAADVNIPMGAHDIYDEDELIQSLSKLIAADVDQNEWLVKIDADQSDTGIASINVQQM  727
             + + ADVN+P G +++YDE E+  +L+KL  A +DQ  WL+K+D D  D G A +++  M
Sbjct  731   LLIRADVNVPNGTYELYDEHEVCAALAKLAIAHMDQPRWLIKLDYDPLDVGEAVVDLSNM  790

Query  728   QSVAKVRAEKRDMKHMAAEYFQQPDVRDAVLRSIFNELTESYFAANI-TPCFPDVYASWA  786
             Q++ ++R EKR       EY++QP  RDA  + I  EL      A I TP   +++  W 
Sbjct  791   QAMRELRREKR-----TPEYWRQPGPRDAAAKLILAELERPGMLARIATPMQTEIFPKWR  845

Query  787   ELRPVALRVGVVIEAYP----------SKVLSQ---VRANVFIEPSGGVHITSAHDLFMS  833
             E        G V+EA P          S VL +   VRAN+F++P G VHI+S  ++  +
Sbjct  846   EFIDAVGHFGCVVEAVPPTAIAASSEASTVLVEPAYVRANLFVDPDGSVHISSTQNVLAA  905

Query  834   PAN--KHLPQCALFPQTSVPYQAIRGASLAIASSMFIKGIIGYASIDYMSFADPKTLVGG  891
                          FPQT+ PY+AI+GA  A    +    + GY S+D++ F D K+    
Sbjct  906   GGGGLNRKTVAFTFPQTAAPYEAIKGACNAAGKLLVETNVWGYVSLDFVVFQDEKS----  961

Query  892   GRPRQRLWAMQVVPGLTNTAVSFVMFAFLSCSQFNPITGKCHLQVAAPPPIAASATVAPI  951
                  RLWA+ V P LT++A SF  F  L+    +  +G   +   +      +A     
Sbjct  962   -NDAPRLWALAVHPFLTDSATSFACFHLLARGVLDTNSGVYRVANKS----LTTANSGRK  1016

Query  952   TQAQKAVETILSARPPNGAVVCGPERTYMVLDYIYHPNMATLHFSTFFNTCRLNGVSFDL  1011
             +++  A + +L       + + G  R ++   Y++HP++ T+ ++ FF+ CRL+GV FD+
Sbjct  1017  SESGSATDLLLREALLAKSSLVGARRCFVACSYVFHPHVITMQYTAFFHACRLHGVCFDV  1076

Query  1012  QRAIGAAFILADSLTAGVMGLMCIGENDKEAFRIARQAVELIGDQVG----VQALPDSLS  1067
             +R +G  F+LADSLTAGV G++ IGE  + A    R A+E+IG + G    V + P    
Sbjct  1077  ERTLGTLFLLADSLTAGVFGILSIGETTEGALAFLRTALEVIGREAGSTISVASSPSRSV  1136

Query  1068  GERLGNFPHLLAIVR-----NKSDDPADRRKRR  1095
               R GNF  +L+ +R      KSD     R+R+
Sbjct  1137  ASRSGNFAQILSAIRVSTGGGKSDRLGKMRQRQ  1169

 Score = 162 bits (411),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 110/280 (39%), Positives = 154/280 (55%), Gaps = 46/280 (16%)

Query  1    MDKLCQQYHAEDVGRILLQAQDELRSMRekvne-----------------knnvdvnein  43
            MDK+ QQ+H EDVGR+LLQ Q++LR MRE++                       +V   N
Sbjct  1    MDKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHNAIVTTAEVQAFN  60

Query  44   AILERAEADLRAKAEIVLNGVVNNSMK----------MLPAIEAPGGKTSLSKFSSKLAQ  93
            AIL++ E +LRAKAE+VLNG+VN+S            +LPA+      + + +     A 
Sbjct  61   AILQQTETELRAKAELVLNGMVNSSSSARNNQAQSGTLLPAVTVAAAPSIMHRSGYDKAN  120

Query  94   K-RELAATMTRDSSYEPASPTYRQEDREPRFGGPIEPMERDRAPGRRPVGRIIKAGSLVK  152
            K R++ A+       E     +R    E R   P EP ER            I  G L++
Sbjct  121  KPRQMDASSI---PVEFFREQFRNNSVEIRQSLP-EPWERHFG---------IHHGRLMR  167

Query  153  KKTTKPHRLLPKMNRTDPTAPSPDLVEEDARGGVHNLVTRGFLPPSVDVTPAF-----TH  207
            KKTT+  RLLP +N+TDP+ P+P+L EEDA+ GV NLVTRGFLP   D+TP F       
Sbjct  168  KKTTQHCRLLPSVNKTDPSVPTPELREEDAKHGVLNLVTRGFLPAYADLTPVFSGTSDGS  227

Query  208  GTSVIQNSRVKIYDRASQPVKSMPYTNPSGFNMASLKFDM  247
            G  V++    +IY+R+ Q V+S P+T  +G+N+ASLKFD+
Sbjct  228  GGGVMKQRATRIYNRSEQVVRSTPFTQSTGYNLASLKFDL  267

>PPTG_17128
Length=1177

 Score = 601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/817 (41%), Positives = 493/817 (60%), Gaps = 52/817 (6%)

Query  311   IHNLRRNVEKIRGYNELLDTYSLHQFIIRKGKTLSDTPEFISFQRTTEDLWGSVSTSIQE  370
             +  L  NV+KIRGYNELLD YSLHQF+I KG+T+ DTPEFISF+R  ++LWGSV  +++ 
Sbjct  380   MEELGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTPEFISFRRVAQELWGSVEEALRA  439

Query  371   LETMLTSYSVPLAYVDGQKLMKIAAMDATTRGTTELLSCILNMDEVSSLMRRPGQRYKGS  430
             LE +LT Y VPLAYVDGQ+L+ +A          ELLSCI+N D++ S++RRPGQRYKG 
Sbjct  440   LEALLTQYFVPLAYVDGQRLLALAGTGQPRFSKRELLSCIVNEDQIMSVLRRPGQRYKGR  499

Query  431   QGPDLAVVLIQSVWRMFLTKKRLKNHHGNE-DAAVIQRIYRSYRCFSQLQQRLKLVREAD  489
                  A   +Q+  RM+L ++R      ++ +A  IQ  +R+Y C + L+ RL+ VR   
Sbjct  500   DRKRRAATTVQACIRMWLVRRRYARSRASDINATKIQLAWRAYSCHTALKTRLREVRREK  559

Query  490   LRIWDAQMQRFRANWDTMKMQRRVVVHVPSFASDDRTRLKMDNFSIRQNLQMARMCAIA-  548
             L  W+ +M   ++ W  +  +RRVVVHVPS + D+  RL  +NF+++QNLQ+ R+CA+A 
Sbjct  560   LEKWEKRMCTLKSQWSQIAARRRVVVHVPSLSLDEHYRLSAENFAVQQNLQLTRVCAVAL  619

Query  549   DPNVDI-IYISPFELSPDIQRYQVRLLQLGGITDPQTRIRMLHPENVDRFPEHFSLTTLL  607
             D NVD+ +Y+SPFEL+ D+ +Y ++LLQLGG+ D   R++ + PE   RFP HFSL++LL
Sbjct  620   DSNVDLLVYVSPFELTADVLQYFLKLLQLGGLVDSGPRVKFVFPEQSTRFPAHFSLSSLL  679

Query  608   LYSPHCLKKIKRFVRGKNAYIVTGNVGPEDKRLAIALQIPLLGMDPDKALLYGTRSGGKR  667
             LYSPHCL++I+ +  GK AY+V G  G ED+RLAIAL +P+LG  P +AL   TRSGGKR
Sbjct  680   LYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAIALDLPILGAPPAQALPLLTRSGGKR  739

Query  668   IFMAADVNIPMGAHDIYDEDELIQSLSKLIAADVDQNEWLVKIDADQSDTGIASINVQQM  727
             + + ADVN+P G +++YDE EL  +L+KL  A +DQ +WL+K+D D    G A +++  +
Sbjct  740   LLIRADVNVPNGTYELYDEHELCAALAKLAIAHMDQPKWLIKLDYDPLGVGEAVVDLSNI  799

Query  728   QSVAKVRAEKRDMKHMAAEYFQQPDVRDAVLRSIFNELTESYFAANI-TPCFPDVYASWA  786
             Q++ ++R EKR       EY++QP  RDA  + I  EL      A +  P   +++ +W 
Sbjct  800   QAMRELRREKR-----TPEYWRQPGPRDAAAKMILAELERPGMLARLAAPMHSEMFPTWR  854

Query  787   ELRPVALRVGVVIEAYPSKVLSQ-------------VRANVFIEPSGGVHITSAHDLFMS  833
             +        G VIEA P   ++              VRAN+F++P G VH+TS  ++  +
Sbjct  855   DYIDAVGHFGCVIEAVPPTAIAASPEASTALVEPAYVRANLFVDPDGSVHVTSTQNVLAT  914

Query  834   PAN--KHLPQCALFPQTSVPYQAIRGASLAIASSMFIKGIIGYASIDYMSFADPKTLVGG  891
                          FPQT+ P++AI+GA  A    +    + GY S+D++ F D K+    
Sbjct  915   GGGGLNRKTVAFTFPQTAAPHEAIKGACNAAGKLLVETNVWGYVSLDFVVFQDEKS---N  971

Query  892   GRPRQRLWAMQVVPGLTNTAVSFVMFAFLSCSQFNPITGKCHLQVAAPPPIAASATVAPI  951
             G P  RLWA+ V P LT++A SF  F  L+    +  +G   +         AS ++  +
Sbjct  972   GAP--RLWALAVHPFLTDSAASFACFHLLARGVLDTNSGAYRV---------ASKSLTTV  1020

Query  952   T-QAQKAVETILSARPPNGA--VVCGPERTYMVLDYIYHPNMATLHFSTFFNTCRLNGVS  1008
             T +      T L  R  + A   + G  R ++V  Y++HP++ T+ ++ FF+ CRL+GV 
Sbjct  1021  TGRNGSGCTTDLLLREASLAKDSLAGAPRCFVVCSYVFHPHVTTMQYTAFFHACRLHGVC  1080

Query  1009  FDLQRAIGAAFILADSLTAGVMGLMCIGENDKEAFRIARQAVELIGDQVG-----VQALP  1063
             FD++R +G  F+LADSLTAGV G++ IGE  + A    R A+E+IG + G     V +  
Sbjct  1081  FDVERTLGTLFLLADSLTAGVFGVLSIGETMEGALAFLRTALEVIGREAGSTINMVSSPS  1140

Query  1064  DSLSGERLGNFPHLLAIVR-----NKSDDPADRRKRR  1095
               +SG R GNF  +L+ VR      KSD     ++RR
Sbjct  1141  RPVSG-RSGNFAQVLSAVRASTGGGKSDRLGKMQRRR  1176

 Score = 155 bits (391),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 106/283 (37%), Positives = 152/283 (54%), Gaps = 46/283 (16%)

Query  1    MDKLCQQYHAEDVGRILLQAQDELRSMRek-----------------vneknnvdvnein  43
            M+K+ QQ H EDVGR+LLQ Q++LR MRE+                        +V   N
Sbjct  1    MEKVQQQQHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSAIVTTAEVQAFN  60

Query  44   AILERAEADLRAKAEIVLNGVV----------NNSMKMLPAIEAPGGKTSLSKFSSKLAQ  93
            AIL++ E +LR+KAE+VLNG+V            S   LPA+      ++  +     A 
Sbjct  61   AILQQTETELRSKAELVLNGMVNSSNNAQNNQTQSGNFLPAVTVAALPSTKHRSGYNGAN  120

Query  94   K-RELAATMTRDSSYEPASPTYRQEDREPRFGGPIEPMERDRAPGRRPVGRIIKAGSLVK  152
            K R++ A+      +         E R+     P EP +R            +  G L++
Sbjct  121  KPRQMDASSIPMEFFREQFRNSSVEIRQSLMPSP-EPWQRHFG---------VHHGRLMR  170

Query  153  KKTTKPHRLLPKMNRTDPTAPSPDLVEEDARGGVHNLVTRGFLPPSVDVTPAFT--HGTS  210
            KKTT+  RLLP +N+ DP+AP+P+L EEDA+ GV NLVTRGFLP   D+TPAF   +GTS
Sbjct  171  KKTTQHCRLLPSVNKVDPSAPAPELREEDAKHGVLNLVTRGFLPAYADLTPAFAGPNGTS  230

Query  211  ------VIQNSRVKIYDRASQPVKSMPYTNPSGFNMASLKFDM  247
                  +++    +IYDR+ Q V+S P+T  +G+N+ASLKFD+
Sbjct  231  NGSCGGIMKQRATRIYDRSEQAVRSTPFTQSTGYNLASLKFDL  273

>PHYCA_34475
Length=692

 Score = 565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/738 (41%), Positives = 440/738 (60%), Gaps = 65/738 (9%)

Query  322   RGYNELLDTYSLHQFIIRKGKTLSDTPEFISFQRTTEDLWGSVSTSIQELETMLTSYSVP  381
             RGYNELLD YSLHQF+I KG+T+ DTPEFISF R  ++LWGSV  +++ LET+LT Y VP
Sbjct  1     RGYNELLDAYSLHQFLIHKGRTMRDTPEFISFHRVAQELWGSVEEALRALETLLTHYFVP  60

Query  382   LAYVDGQKLMKIAAMDATTRGTTELLSCILNMDEVSSLMRRPGQRYKGSQGPDLAVVLIQ  441
             LAYVDGQ+L+ +AA         ELLSCI+N ++V + +RRPGQRYKG      A   IQ
Sbjct  61    LAYVDGQRLLSLAATGQPRFSKRELLSCIVNEEQVMAALRRPGQRYKGRDRKRRAATTIQ  120

Query  442   S-VWRMFLTKKRLKNHHGNEDAAVIQRIYRSYRCFSQLQQRLKLVREADLRIWDAQMQRF  500
             + V      ++  ++   + +A  IQ  +R+Y C + L+ RL+ VR   L  W+A+M R 
Sbjct  121   AFVRMWAARRRYARSRARDINATRIQLAWRAYSCHAALKARLREVRREQLEKWEARMHRL  180

Query  501   RANWDTMKMQRRVVVHVPSFASDDRTRLKMDNFSIRQNLQMARMCAIA-DPNVDI-IYIS  558
             ++ W  +   RRVVVHVPS + D+ +RL  +N ++RQNLQ+ R+CA A D  VD+ +Y+S
Sbjct  181   KSQWAQIASHRRVVVHVPSLSLDEYSRLSAENLAVRQNLQLTRICAAALDSRVDLLVYVS  240

Query  559   PFELSPDIQRYQVRLLQLGGITDPQTRIRMLHPENVDRFPEHFSLTTLLLYSPHCLKKIK  618
             PFEL+ D+ +Y ++LLQLGG+ D + R+++L PE   RFP HFSL++LLLYSPHCL++I+
Sbjct  241   PFELTTDVSQYFIKLLQLGGLADSRPRVKLLFPEQATRFPAHFSLSSLLLYSPHCLRRIR  300

Query  619   RFVRGKNAYIVTGNVGPEDKRLAIALQIPLLGMDPDKALLYGTRSGGKRIFMAADVNIPM  678
              +  GK AY+V G  G ED+RLA+ L +P+LG  P +AL   TRSGGKR+ + ADVN+P 
Sbjct  301   HYTAGKEAYLVMGLPGAEDQRLAMTLDLPILGAPPAQALPLLTRSGGKRLLIRADVNVPA  360

Query  679   GAHDIYDEDELIQSLSKLIAADVDQNEWLVKIDADQSDTGIASINVQQMQSVAKVRAEKR  738
             G +++YDE EL  +L+KL  A +DQ +WL K+D D    G A +++  MQ++ ++R EKR
Sbjct  361   GTYELYDEHELFSALAKLAVAHMDQPKWLFKLDYDPLGVGEAVVDLSGMQAMRELRREKR  420

Query  739   DMKHMAAEYFQQPDVRDAVLRSIFNELTESYFAANIT-PCFPDVYASWAELRPVALRVGV  797
                    EY++QP  RDA  + +  EL      A +  P   D++ SW E        G 
Sbjct  421   -----TPEYWRQPGPRDAAAKLVLTELERPGTLARLAMPVHKDIFPSWLEFAEAIGHFGC  475

Query  798   VIEAYPSKVL-------------SQVRANVFIEPSGGVHITSAHDLFMSPAN--KHLPQC  842
             VIEA P   +             + +RAN+F++P G VH+TS  ++  +           
Sbjct  476   VIEAVPLTAIAVTPETSTALLEPAYIRANLFVDPDGSVHVTSTLNMLATGGGGLNRRTVA  535

Query  843   ALFPQTSVPYQAIRGASLAIASSMFIKGIIGYASIDYMSFADPKTLVGGGRPRQRLWAMQ  902
               FPQT+ P++A++GA  A    +    + GY S+D++ F D K+    G P  RLWA+ 
Sbjct  536   FTFPQTAAPHEAVKGACSAAGKLLVETNVWGYVSLDFVVFQDDKS---NGAP--RLWALA  590

Query  903   VVPGLTNTAVSFVMFAFLSCSQFNPITGKCHLQVAAPPPIAASATVAPITQAQKAVETIL  962
             V P LT++A SF  F  L+    +  +G   +  A+ P                      
Sbjct  591   VHPFLTDSAASFACFHLLARGVLDANSGVYRMAAASTP----------------------  628

Query  963   SARPPNGAVVCGPERTYMVLDYIYHPNMATLHFSTFFNTCRLNGVSFDLQRAIGAAFILA  1022
                           R ++V  Y++HP++ T+ ++ FF+ CRL+GV FD++R +G  F+LA
Sbjct  629   --------------RCFVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLA  674

Query  1023  DSLTAGVMGLMCIGENDK  1040
             DSLTAGV G++ IGE  +
Sbjct  675   DSLTAGVFGVLSIGETTE  692

>CCA18898
Length=1147

 Score = 541 bits (1394),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 357/1118 (32%), Positives = 587/1118 (53%), Gaps = 113/1118 (10%)

Query  1     MDKLCQQYHAEDVGRILLQAQDELRSMRek-------------------------vnekn  35
             M+++ Q+YH EDVGRILLQ Q ELR +R +                          NE  
Sbjct  26    MEQVEQKYHKEDVGRILLQTQQELRDIRAEISARKQAGISHVVDAHPHREDHASLANENQ  85

Query  36    nvdvneinAILERAEADLRAKAEIVLNGVVNNSMKM---LPAIEAPGGKTSLSK------  86
             + D+  ++ IL+RAE +++AK +++  G  N    M   LPA+ +P  + S +       
Sbjct  86    SKDLETLHDILDRAEREIQAKVDLMFRGAANFGQMMQTGLPAVTSPPRQVSTTTKSLSDQ  145

Query  87    -FSSKLAQKRELAATMTRDSSYEPASPTYRQEDREPRFGGPIEPMERDRAPGRRPVGRII  145
              FS++ ++       +T        SP+ +Q +        I P        +RP   ++
Sbjct  146   IFSTQESKVDGTRKQLTAAKDDYKCSPSMQQSE-------LISP--------KRPTQGLL  190

Query  146   KAGSLVKKKTTKPHRLLPKMNRTDPTAPSPDLVEEDARGGVHNLVTRGFLP-PSVDVTPA  204
              + +  KK+     + LP +     +  S  L ++ +    H L +R   P  S++++ +
Sbjct  191   TSKA-SKKRYNVSLKSLPAVQNGHASTSSSALADQSSETA-HFLNSRHGSPLNSIEISQS  248

Query  205   FTHGTSVIQNSRVKIYDRASQPVKSMPYTNPSGFNMASLKFDMsttpatstpspvaavvs  264
              T+  +++Q +  ++++R  +P+++ P T+    ++ SLKFD S      +P  V     
Sbjct  249   -TYDRALMQRT-AQLHNRLEEPIRTTPCTSTISHDITSLKFDFSAPTILQSPGKVQIHEQ  306

Query  265   GGDVSKMVVTPIDISFDAPSSSHPPV-----EQPKggatggddtnggdsstIHNLRRN--  317
                 +   +   +        S   +     +  K   +       G    I + + N  
Sbjct  307   VTHFNDQALGECNCRLSTNQVSMALINGFREDNSKLSPSRDHSKKMGIPKVIKSTKINTD  366

Query  318   VEKIRGYNELLDTYSLHQFIIRKGKTLSDTPEFISFQRTTEDLWGSVSTSIQELETMLTS  377
              E  +G N     +++HQ I+ + ++     +F SFQ    D+W +V   +  LE +L+ 
Sbjct  367   TESHKGNNSSNHDFTIHQGIVDRRRS-----DFKSFQCFANDVWNNVEEVVTTLERLLSV  421

Query  378   YSVPLAYVDGQKLMKIAAMDATTRGTTELLSCILNMDEVSSLMRRPGQRYKGSQGPDLAV  437
             Y +P+A+++GQ+++ ++  +       +LLSC+ N  EV  L+ +PGQR++G +    A 
Sbjct  422   YFIPIAHINGQRILTLSQENNKIITNRDLLSCVKNEHEVRMLLLKPGQRFQGVEKCTRAA  481

Query  438   VLIQSVWRMFLTKKR----LKNHHGNEDAAVIQRIYRSYRCFSQLQQRLKLVREADLRIW  493
             + +QS  RM   ++     + NH        IQ+ +R Y  +   + +++ +RE    ++
Sbjct  482   MAVQSFMRMITFRRTYLLMISNH---RKVRAIQQNWRRYAAYKATKIKIEAIRERQDIVF  538

Query  494   DAQMQRFRANWDTMKMQRRVVVHVPSFASDDRTRLKMDNFSIRQNLQMARMCAIADPNVD  553
             +  M+ F +NWD ++ QRR V+H+PS + D R R+K + FSI+QNLQ+ R+CA+ D NV+
Sbjct  539   NEIMRSFCSNWDKIRTQRRTVMHIPSISIDPRHRMKTEQFSIQQNLQLQRLCALIDENVE  598

Query  554   IIYISPFELSPDIQRYQVRLLQLGGITDPQTRIRMLHPENVDRFPEHFSLTTLLLYSPHC  613
             +IYI PFEL+ DI +Y ++LLQL GI+D   RI+++ PEN  RFP HFSL+ ++L SPH 
Sbjct  599   LIYICPFELTDDIVQYYMKLLQLAGISDAAARIKLMCPENASRFPSHFSLSNVVLCSPHT  658

Query  614   LKKIKRFVRGKNAYIVTGNVGPEDKRLAIALQIPLLGMDPDKALLYGTRSGGKRIFMAAD  673
             +K++ R++RG+NAY+V G  G EDKRLA  L+IP+LG+DP K     T SG KR F   +
Sbjct  659   MKRLSRYIRGRNAYLVPGFPGTEDKRLAALLRIPILGLDPAKFFQMTTHSGIKRCFKKTN  718

Query  674   VNIPMGAHDIYDEDELIQSLSKLIAADVDQNEWLVKIDADQSDTGIASINVQQMQSVAKV  733
              N   G+ D+YDE+ELI SL+KLIAA+  Q+  ++K+D D   TG A +++ Q+QS+  +
Sbjct  719   ANTLPGSIDLYDENELIFSLAKLIAANPHQSSMVLKLDYDPFRTGTALVDISQLQSIQVL  778

Query  734   RAEKRDMKHMAAEYFQQPDVRDAVLRSIFNELTESYFAANITPCFPDVYASWAELRPVAL  793
             R   R +     +Y++QP +++ ++R+I  E+ +S  ++ +    P+VY SW        
Sbjct  779   RLRTRTL-----DYWRQPPIQNKLIRNIVQEM-QSIISSLVFMVNPEVYPSWKSFLQAIR  832

Query  794   RVGVVIEAYPSKVLSQVRANVFIEPSGGVHITSAHDLFMSPANKHLPQ------------  841
               GVVIE  P      VRAN+FIEPS  V I+S  + F+S  N H               
Sbjct  833   MYGVVIEVCPKNRQGYVRANLFIEPSRRVCISSTQE-FLSFENIHENDDRARKVVFDKAF  891

Query  842   -------CALFPQTSVPYQAIRGASLAIASSMFIKGIIGYASIDYMSFADPKTLVGGGRP  894
                       FPQT + ++ ++ ASL I  ++   GI GY S+D++   D +T       
Sbjct  892   AAKMRTIGFTFPQTLIDHEVLKSASLVIGQALAKDGICGYISVDFLVILDDQT------Q  945

Query  895   RQRLWAMQVVPGLTNTAVSFVMFAFLS-CSQFNPITGKCHLQVAAPPPIAASATVAPITQ  953
              + L+AM + P LTN+A SF +F FLS    +N  TG  HL  A       S T  P + 
Sbjct  946   NKILYAMALQPFLTNSAASFSLFQFLSRGGGYNSKTGLFHLPRAITSHGVTSDT--PSSS  1003

Query  954   AQKAVETILSARPPNGAVV----CGPERTYMVLDYIYHPNMATLHFSTFFNTCRLNGVSF  1009
             +  A + ++     +G V       P R+Y++L+Y+ +PN+ATL + +FF  CR  GV F
Sbjct  1004  SLSATDLMIREARLSGIVSNELPLTPTRSYVLLEYVCNPNVATLSYGSFFQNCRSRGVYF  1063

Query  1010  DLQRAIGAAFILADSLTAGVMGLMCIGENDKEAFRIAR  1047
             D++R IG  F+LADSLTAGV+G+MCI +  K A    R
Sbjct  1064  DIERDIGTVFLLADSLTAGVLGIMCISDTRKNALLSCR  1101

>CCI45122
Length=1105

 Score = 513 bits (1320),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 285/756 (38%), Positives = 437/756 (58%), Gaps = 50/756 (7%)

Query  334   HQFIIRKGKTLSDTPEFISFQRTTEDLWGSVSTSIQELETMLTSYSVPLAYVDGQKLMKI  393
             + F+I +G      PEF +FQR    +W SV   ++ L  +L+ Y +P+AY++GQ+++ +
Sbjct  338   YDFVIHQGIIDRKRPEFEAFQRIANPIWSSVDVVLEALARILSLYFIPIAYINGQRILTL  397

Query  394   AAMDATTRGTTELLSCILNMDEVSSLMRRPGQRYKGSQGPDLAVVLIQSVWRMFLTKKR-  452
             A  D     T +L+SCI N DEV  L+ +PGQR++G++    A + +QS  RM + +KR 
Sbjct  398   AQADNVPLTTKDLISCIRNEDEVKMLLSKPGQRFQGAERTKRATIALQSFIRMAMHRKRF  457

Query  453   LKNHHGNEDAAVIQRIYRSYRCFSQLQQRLKLVREADLRIWDAQMQRFRANWDTMKMQRR  512
             L   +       IQR +R +      + +++  RE    ++   M+ F +NWD ++MQRR
Sbjct  458   LVMRYKYWKVTAIQRNWRRFSAHKATKLKIEAKREHQEMVFTDSMRSFCSNWDKIRMQRR  517

Query  513   VVVHVPSFASDDRTRLKMDNFSIRQNLQMARMCAIADPNVDIIYISPFELSPDIQRYQVR  572
              ++H+PS + D R R+K + FSI+QNLQ+ R+CA+ D NV++IYI PFEL+ DI +Y ++
Sbjct  518   TIIHIPSISIDSRQRMKTEQFSIQQNLQLQRLCAVIDENVELIYICPFELTDDIVQYYMK  577

Query  573   LLQLGGITDPQTRIRMLHPENVDRFPEHFSLTTLLLYSPHCLKKIKRFVRGKNAYIVTGN  632
             LLQLGGI+D   RI+++ PEN  RFP HFSL++++LYSP  L ++ R +RG+NAY+V G 
Sbjct  578   LLQLGGISDAAARIKLICPENASRFPSHFSLSSVVLYSPRTLNRLSRCIRGRNAYMVPGF  637

Query  633   VGPEDKRLAIALQIPLLGMDPDKALLYGTRSGGKRIFMAADVNIPMGAHDIYDEDELIQS  692
              G EDKR+A  L +P+LG+D  K+L   T SG KR F  A+VN      D+YDE+ELI S
Sbjct  638   PGLEDKRVATILGVPILGLDSTKSLQATTYSGSKRYFRKANVNTLPACIDLYDENELIFS  697

Query  693   LSKLIAADVDQNEWLVKIDADQSDTGIASINVQQMQSVAKVRAEKRDMKHMAAEYFQQPD  752
             L+KL+A+   Q   ++++D D   TGIA +++ ++QSV +VR   + +     E + QP 
Sbjct  698   LAKLVASHPHQLSVVLRLDYDPFGTGIALMDISRLQSVKEVRLRTKTL-----ESWLQPP  752

Query  753   VRDAVLRSIFNELTESYFAANITPCFPDVYASWAELRPVALRVGVVIEAYPSKVLSQVRA  812
             ++  ++R++  E+ ++  ++ I    P+++ S           GV+IE  P K    VRA
Sbjct  753   IQAKLIRNLVLEM-QNNISSFIFVVHPEIFPSSKSFLQAIRIYGVIIELSPKKRQGHVRA  811

Query  813   NVFIEPSGGVHITSAHDLF------------------MSPANKHLPQCALFPQTSVPYQA  854
             N+FIEPS  V ++S H++                    + A K       FPQT + ++ 
Sbjct  812   NLFIEPSRRVCVSSTHEIHSLETDTKIDDRVRKFGLDKASAAKMRTFGVTFPQTLIDHEV  871

Query  855   IRGASLAIASSMFIKGIIGYASIDYMSFADPKTLVGGGRPRQRLWAMQVVPGLTNTAVSF  914
             ++ ASLAI  ++   GI GY S+D++   D +T       ++ L+A  + P LTNTA SF
Sbjct  872   LKDASLAIGQALAKDGICGYISVDFVVCLDDQT------QKKTLYATGLQPFLTNTAASF  925

Query  915   VMFAFLS-CSQFNPITGKCHLQVAAP-------PPIAASATVAPITQAQKA--VETILSA  964
              +F  LS    +N +TG  HL    P       PP + SAT   I +A+ +  V  +L  
Sbjct  926   ALFQLLSRGGSYNSMTGSLHLPQEVPLVGVQNDPPSSLSATDLMIREARLSGIVSNVL--  983

Query  965   RPPNGAVVCGPERTYMVLDYIYHPNMATLHFSTFFNTCRLNGVSFDLQRAIGAAFILADS  1024
              PP       P RTY +++Y+ +P +ATL  S+FF  CR  GV FD +R  G  F+LADS
Sbjct  984   -PPT------PTRTYALIEYVCNPCVATLSCSSFFQHCRSRGVYFDTERDSGTVFLLADS  1036

Query  1025  LTAGVMGLMCIGENDKEAFRIARQAVELIGDQVGVQ  1060
             LTAGV G+MCI +  K A    R A+E I    G +
Sbjct  1037  LTAGVFGIMCISDTRKNALSNCRAAMEAIAGVAGTK  1072

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 67/282 (24%), Positives = 111/282 (39%), Gaps = 68/282 (24%)

Query  1    MDKLCQQYHAEDVGRILLQAQDELRSMRekvneknnvdvn--------------------  40
            MD L Q++H ED+GRILLQ Q ELR +R +++ +                          
Sbjct  1    MDHLEQKHHTEDIGRILLQTQQELREIRAEISGRKQTTETYIADATPFEDYPAPIVSVNP  60

Query  41   -----einAILERAEADLRAKAEIVLNGVVNNSMKM---LPAIEAPGGKTSLSKFSSKLA  92
                  +  IL+RAE +++AK +++  GV +   K    LP + +P  +   S  SS   
Sbjct  61   SKDLETLQNILDRAEREIQAKVDLLYKGVAHYGRKTQTGLPFVASPPRQIPSSANSS---  117

Query  93   QKRELAATMTRDSSYEPASPTYRQED----REPRFGGPIEPMERDRAPGRRPVGRIIKAG  148
                    + R SS++  S    ++     +E     P +      +P R   G +    
Sbjct  118  --------LERKSSFQELSVDLIRKQLHSVKEKYKCLPTKQHSELISPKRPTQGLLTSKP  169

Query  149  SLVKKKTTKPHRLLPKMNR---TDPTAPSPDLVEEDARGGVHNLVTRGFLPPSVDVTPAF  205
            S  KK+     R LP + R    D ++ S D + E                     +   
Sbjct  170  S--KKRYNASLRSLPTVQRGEAGDFSSASRDQIGE--------------------ASNTL  207

Query  206  THGTSVIQNSRVKIYDRASQPVKSMPYTNPSGFNMASLKFDM  247
            +    V+      +++R  +P+K+ PYT     NM S+KFD 
Sbjct  208  SVNDRVLMQRTAHLHNRMEEPIKTTPYTTAISHNMMSVKFDF  249

>PYAR_13581
Length=730

 Score = 257 bits (657),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 135/317 (43%), Positives = 190/317 (60%), Gaps = 36/317 (11%)

Query  313  NLRRNVEKIRGYNELLDTYSLHQFIIRKGKTLSDTPEFISFQRTTEDLWGSVSTSIQELE  372
            +LR+NVEKIRGYNELLDTYSLHQFII KG+ + +TPEF SF+R  +++WG+V   I+ LE
Sbjct  83   DLRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFQSFKRVGQEIWGAVDEVIRALE  142

Query  373  TMLTSY---SVPLAYVDGQKLMKIAAMDATTRGTTELLSCILNMDEVSSLMRRPGQRYKG  429
             +LT Y   S P                     T+ LLSC++N D+V+SL+RRPGQRYKG
Sbjct  143  ALLTRYFMASFP---------------------TSVLLSCVVNEDQVASLLRRPGQRYKG  181

Query  430  SQGPDLAVVLIQSVWRM-FLTKKRLKNHHGNEDAAVIQRIYRSYRCFSQLQQRLKLVREA  488
                  A   +Q+ +RM F   +  +       A  IQ  +R +     L++ L L R  
Sbjct  182  KDRKRRAATTLQAFFRMLFHRNRFRRVCRRGASATRIQTTWRKFAAQQSLRRELTLRRAE  241

Query  489  DLRIWDAQMQRFRANWDTMKMQRRVVVHVPSFASDDRTRLKMDNFSIRQNLQMARMCAIA  548
             LR+W  QM R R+ W  +  QRRVVVHVPS + D+  R+ +D+F+++QNLQ+AR+ A+ 
Sbjct  242  QLRVWQLQMARLRSQWREISTQRRVVVHVPSLSLDEHARVSLDHFAVQQNLQLARLAAVV  301

Query  549  DPNVD-IIYISPFELSPDIQRYQVRLLQLGGITDPQTRIRMLHPENVDRFPEHFSLTTLL  607
            D  V+ ++Y+SPFEL  D+           G+ +   R++++ PE+   FP HFSL T L
Sbjct  302  DATVEYVVYVSPFELPTDLSH---------GVANAAHRVKIVVPEHAATFPGHFSLATQL  352

Query  608  LYSPH-CLKKIKRFVRG  623
            LYSPH  L+K+ R  R 
Sbjct  353  LYSPHLTLEKLGRCSRA  369

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 91/366 (25%), Positives = 143/366 (39%), Gaps = 90/366 (25%)

Query  742   HMAAEYFQQPDVRDAVLRSIFNELTESYFAANITPCFPDVYASWAELRPVALRVGVVIEA  801
             H    Y++QP +RD V R++  EL E        PC  + +  W        R GVVIEA
Sbjct  406   HKPPAYWKQPGIRDTVARALLQEL-ERAIGTLAKPCHSERFPDWRAFAQAIGRDGVVIEA  464

Query  802   YPSKVLSQVRANVFIEPSGGVH-----ITSAHDLFMSPANKHLPQCALFPQTSVPYQAIR  856
              P++V   VR N+F+ P+   H     + S  +   + A +  P     PQT VP+ A+ 
Sbjct  465   LPARVRGVVRVNIFVTPASSDHDADVPVVSTQEALRASAGR-APLAFACPQTLVPHDAVV  523

Query  857   GASLAIASSMFIK-GIIGYASIDYMSFADPKTLVGGGRPRQRLWAMQVVPGLTNTAVSFV  915
             GA+ AI   +       GYAS+D     D  +             + ++P          
Sbjct  524   GAAQAIGRLLREDYAFCGYASVDLQLCRDETS------------GLYLLPS---------  562

Query  916   MFAFLSCSQFNPITGKCHLQVAAPPPIAASATVAPITQ--AQKAVETILSARPPNGAVVC  973
                                     P +  SA ++P T    Q+A     S+RP   A   
Sbjct  563   ------------------------PAVDTSAPLSPATPLVLQEAHLLARSSRP--LASPS  596

Query  974   GPERTYMVLDYIYHPNMATLHFSTFFNTCRLNGVSFDLQRAIGAAFILADSLTAGVMGLM  1033
                R ++ +D+  HPN+ T+  + FF  CR  GV FD+ R                    
Sbjct  597   ASPRCFVSVDWAVHPNLCTMPTAAFFLACRRRGVCFDVTR--------------------  636

Query  1034  CIGENDKEAFRIARQAVELIGDQVGVQALPDSLSGERLGNFPHLLAIVRNKSDDPADRRK  1093
                     A +  R A E++  +VG  + P S      GNF  +LA++R++     +R K
Sbjct  637   -------RAMQYLRTAFEVLAREVG-SSTPSS-----DGNFGDVLALLRHRVGVEKEREK  683

Query  1094  RRGALK  1099
                +++
Sbjct  684   EAASVR  689

>PHYKE_8394
Length=428

 Score = 188 bits (478),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 108/267 (40%), Positives = 160/267 (60%), Gaps = 42/267 (16%)

Query  491  RIWDAQMQRFRANWDTMKMQRRVVVHVPSFASDDRTRLKMDNFSIRQNLQMARMCAIA-D  549
            R  DA+M+   AN D ++    ++        D  T    +NF+++QNLQ+ R+CA A D
Sbjct  150  RDEDAEMEELGANVDKIRGYNELL--------DAYT----ENFAVQQNLQLTRICAAALD  197

Query  550  PNVDI-IYISPFELSPDIQRYQVRLLQLGGITDPQTRIRMLHPENVDRFPEHFSLTTLLL  608
             NVD+ +Y+SPFEL+ D+ +Y ++LLQLGG+ D + R++++ PE   RFP          
Sbjct  198  SNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKLVFPEQALRFPT---------  248

Query  609  YSPHCLKKIKRFVRGKNAYIVTGNVGPEDKRLAIALQIPLLGMDPDKALLYGTRSGGKRI  668
                          GK+AY+V G  G ED+RLAIAL +P+LG  P +AL   TRSGGKR+
Sbjct  249  --------------GKDAYLVMGLPGAEDQRLAIALDLPILGAPPAQALPLLTRSGGKRL  294

Query  669  FMAADVNIPMGAHDIYDEDELIQSLSKLIAADVDQNEWLVKIDADQSDTGIASINVQQMQ  728
             + ADVN+P G +++YD+ EL  +L+KL    +DQ  WL+K+D D    G A I++  MQ
Sbjct  295  LIRADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWLLKLDYDPLGVGEAIIDLSGMQ  354

Query  729  SVAKVRAEKRDMKHMAAEYFQQPDVRD  755
            ++ ++R EKR     A EY++QP  RD
Sbjct  355  AMRELRREKR-----APEYWRQPGPRD  376

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 48/71 (68%), Gaps = 3/71 (4%)

Query  1   MDKLCQQYHAEDVGRILLQAQDELRSMRekvneknnvdvneinAILE---RAEADLRAKA  57
           M+K+ QQ+H EDVGR+LLQ Q++LR MRE++           + +     + E +LRAKA
Sbjct  1   MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAEAVEANASPMRHSTVKTEMELRAKA  60

Query  58  EIVLNGVVNNS  68
           E+VLNG+VN+S
Sbjct  61  ELVLNGMVNSS  71

 Score = 34.7 bits (78),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 23/35 (66%), Gaps = 1/35 (3%)

Query  311  IHNLRRNVEKIRGYNELLDTYSLHQFIIRKGKTLS  345
            +  L  NV+KIRGYNELLD Y+   F +++   L+
Sbjct  156  MEELGANVDKIRGYNELLDAYT-ENFAVQQNLQLT  189

>PYAP_17482
Length=1354

 Score = 37.4 bits (85),  Expect = 0.72, Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 59/131 (45%), Gaps = 15/131 (11%)

Query  435   LAVVLIQSVWRMFLTKKRLKNHHGNEDAAVIQRIYRSYRCFSQLQQRLKLVREADLRIW-  493
             L  V IQS+WR   ++ + +    N  A  IQ  +R+Y+     +QR KL R+A +++  
Sbjct  915   LQCVKIQSLWRGVHSRMQAQYLLKNRMATRIQTNFRTYKA----RQRYKLFRDAVIKVQA  970

Query  494   --------DAQMQRFRANWDTMKMQRRVVVHVPSFASDDRTRLKMD--NFSIRQNLQMAR  543
                     D   Q      +   M+  V +       + R R +++  N S++  L++ R
Sbjct  971   KLKMRKQVDKYQQLLEEKKEHTIMENEVALLKQRLEEEKRARTEIEAVNTSLQLELRVVR  1030

Query  544   MCAIADPNVDI  554
               +I   +VD+
Sbjct  1031  QSSITRSDVDL  1041

>HYAP_04567
Length=1275

 Score = 36.2 bits (82),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 32/143 (22%), Positives = 60/143 (42%), Gaps = 15/143 (10%)

Query  437   VVLIQSVWRMFLTKKRLKNHHGNEDAAVIQRIYRSYRCFSQLQQRLKLVREADLRIW---  493
              V++QSVWR   +++R+        A +IQ  YR +      +Q+   +R A ++I    
Sbjct  864   CVIVQSVWRGVRSRQRMYLLMKGNSAVLIQSAYRKHLA----EQKYTKLRNATIKIQCML  919

Query  494   --DAQMQRF------RANWDTMKMQRRVVVHVPSFASDDRTRLKMDNFSIRQNLQMARMC  545
                 Q+ ++      R   D M+ +  ++ H        R  ++ +N S++Q L+  R  
Sbjct  920   KTRKQVDKYRKLLTERKEHDAMETEVDLLKHRLEDEKRARLEIEAENSSLQQELKEVRGS  979

Query  546   AIADPNVDIIYISPFELSPDIQR  568
             +    N  I    P    P+  R
Sbjct  980   SALTANSSICEGEPLHTFPNSSR  1002

>PITG_15637
Length=2036

 Score = 36.2 bits (82),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 47/93 (51%), Gaps = 11/93 (12%)

Query  426   RYKGSQGPDLAVVLIQSVWRMFLTKKRLKNHHGNEDAAVIQRIYRSYRCFSQLQQRLKLV  485
             R   S    LA   IQ+ +R F+T+++      +    VIQR  RS+R  ++ ++ L+L 
Sbjct  1516  RLYASHKQLLAATFIQAAFRGFITRQQYAK--ASTSVLVIQRALRSWRAVTKFRRALRLH  1573

Query  486   READ-----LRIWDAQMQRFRANWDTMKMQRRV  513
             R A+      R W ++ +RF    D   +Q+R+
Sbjct  1574  RAAESIQKLARGWSSRRRRF----DFYALQKRL  1602

 Score = 34.7 bits (78),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 38/71 (54%), Gaps = 6/71 (8%)

Query  435   LAVVLIQSVWRMFLTKKRLKNHHG------NEDAAVIQRIYRSYRCFSQLQQRLKLVREA  488
             +AV  IQ  WR + + +  + H        +  A ++QR++ +YRC  +  QR+  ++  
Sbjct  1224  VAVAQIQRAWRRYRSLQVARKHRQQMWRQMHRSAGILQRVWSAYRCRREETQRVLALQRF  1283

Query  489   DLRIWDAQMQR  499
             +L + + ++QR
Sbjct  1284  ELMMKEKELQR  1294

>PHYRA_75591
Length=1574

 Score = 35.0 bits (79),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 51/105 (49%), Gaps = 4/105 (4%)

Query  409  CILNMDEVSSLMRRPGQRYKGSQGPDLAVVLIQSVWRMFLTKKRLKNHHGNEDAAV-IQR  467
            C +N+  +    R   +RYKG +  D AV L+Q  WR  + +   K H     +A+ IQR
Sbjct  709  CAINLQRLWR-ARVARKRYKGLKREDWAVRLLQRHWRGKMGRTSYKQHMLEYLSALDIQR  767

Query  468  IYRSYRCFSQLQQRLKLVREADLRIWD-AQMQRFRANWDTMKMQR  511
            I R +    ++  R + +  A +RI    + QR + N   M +QR
Sbjct  768  IARGWLARHRVLCRRQQLHHAAVRIQQLMRRQRLQRN-AAMDIQR  811

>PITG_02344
Length=1210

 Score = 35.0 bits (79),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 25/87 (29%), Positives = 46/87 (53%), Gaps = 7/87 (8%)

Query  751  PDVRDAVLRSIFNELTESYFAANITPCFPDVYASWAELRPVALRVGVVIEAYPSK-----  805
            PD++D VL++  +++ E     + TP + +   +W E+ PV L    ++E   +K     
Sbjct  654  PDLKDPVLKTTTSDIVEPCKPHSTTPFYFEKDKAWKEI-PVYLHE-ELLERRGAKYKGPA  711

Query  806  VLSQVRANVFIEPSGGVHITSAHDLFM  832
            ++ Q  A V +EP   V I S+ DL++
Sbjct  712  IIMQGTATVVVEPEWEVQIMSSGDLYL  738

>PYIW_18059
Length=2095

 Score = 35.0 bits (79),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 20/61 (33%), Positives = 36/61 (59%), Gaps = 2/61 (3%)

Query  711  DADQSDTGIA-SINVQQMQ-SVAKVRAEKRDMKHMAAEYFQQPDVRDAVLRSIFNELTES  768
            D D SD+    SI  +Q+Q  +  +RAEK  ++ + ++Y +Q D +    ++ +NEL+E 
Sbjct  100  DGDHSDSEEEDSIRYEQLQREIQLLRAEKEQLELLHSQYKKQSDAQLLEYKTQYNELSEK  159

Query  769  Y  769
            Y
Sbjct  160  Y  160

>PHYSO_298246
Length=425

 Score = 34.3 bits (77),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 20/75 (27%), Positives = 39/75 (52%), Gaps = 1/75 (1%)

Query  421  RRPGQRYKGSQGPDLAVVLIQSVWRMFLTKKRLKNHHGNEDAAVIQRIYRSYRCFSQLQQ  480
            R+  Q +  S   +LA V ++ + + + ++  L  H   ED A ++ + RS+  F +  +
Sbjct  149  RKQTQCWDSSSNGELAAVSMEDLQKKY-SELSLVAHALEEDQAALREVLRSHEDFHERLR  207

Query  481  RLKLVREADLRIWDA  495
            RL   RE +  +WD+
Sbjct  208  RLAEEREDENSLWDS  222

>SPRG_18275
Length=367

 Score = 33.5 bits (75),  Expect = 7.6, Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 28/53 (53%), Gaps = 0/53 (0%)

Query  422  RPGQRYKGSQGPDLAVVLIQSVWRMFLTKKRLKNHHGNEDAAVIQRIYRSYRC  474
            R  QR++  Q      +L+QS+WR    +  L+ H     A V+QR +R+Y+ 
Sbjct  17   RCHQRHRRFQLVRRRCILLQSLWRGRHARSALRQHQLYTSAVVLQRNWRTYKA  69

>PHYRA_83418
Length=291

 Score = 33.1 bits (74),  Expect = 8.3, Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 37/74 (50%), Gaps = 1/74 (1%)

Query  767  ESYFAANITPCFPDVYASWAELRPV-ALRVGVVIEAYPSKVLSQVRANVFIEPSGGVHIT  825
            ++Y ++++ P FP    SWA+  PV ++   V   A PS    + RA+ + +  G   ++
Sbjct  148  QTYLSSSMGPSFPGKKRSWADASPVQSVLYPVKSRASPSSGTHRSRASKYCKIEGCERVS  207

Query  826  SAHDLFMSPANKHL  839
              ++L  S   K L
Sbjct  208  QRNNLCHSHGGKRL  221

>PHYRA_83416
Length=291

 Score = 33.1 bits (74),  Expect = 8.3, Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 37/74 (50%), Gaps = 1/74 (1%)

Query  767  ESYFAANITPCFPDVYASWAELRPV-ALRVGVVIEAYPSKVLSQVRANVFIEPSGGVHIT  825
            ++Y ++++ P FP    SWA+  PV ++   V   A PS    + RA+ + +  G   ++
Sbjct  148  QTYLSSSMGPSFPGKKRSWADASPVQSVLYPVKSRASPSSGTHRSRASKYCKIEGCERVS  207

Query  826  SAHDLFMSPANKHL  839
              ++L  S   K L
Sbjct  208  QRNNLCHSHGGKRL  221

Lambda      K        H        a         alpha
   0.320    0.135    0.394    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 92731448775

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40