Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
H257_062941475635835816630.0
H310_092231475633335812362e-170
SDRG_01781147563353537212e-92
SPRG_06336147563353537161e-91
PYU1_G001735147563423494324e-49
PHYRA_81100147563493554203e-47
PHYSO_471523147563483534142e-46
PHYCA_556162147563513554109e-46
PYIR_13451147563593614091e-45
PITG_18456147563513554021e-44
PPTG_17127147563513584003e-44
PYAP_17762147563483463976e-44
PYVX_18171147562942463753e-41
PHALS_06478147563453603696e-40
CCA18899147563433523503e-37
PYIW_19971147563483603286e-34
PHYKE_8393147563263513041e-30
PYAR_13570147563222392751e-26
CCI45123147563013172258e-20
PPTG_188981612815591061752e-12
PITG_205621612815591061742e-12
PYAR_23286161286071041671e-11
PYIW_17381161289521121643e-11
PHYRA_849161612815411041643e-11
PHYSO_3617471612815231041619e-11
HYAP_086451612815141591601e-10
PYU1_G0063471612810951091582e-10
PYIR_215891612815681121564e-10
SPRG_0605912510913121521492e-09
PHYKE_2479144591711071403e-09
PYVX_13574144599501211483e-09
PHYKE_19901612814991041484e-09
PYAP_169971612810181031466e-09
SDRG_127621612813921121467e-09
SPRG_060581612812581151457e-09
H310_002311612814951461458e-09
SDRG_1276312510913171171431e-08
PYVX_204381612813461041431e-08
CCA188751612815141071422e-08
PYIW_13172144599391031413e-08
PYIR_15309144599371031413e-08
H257_06722161281482991394e-08
PHYCA_503112152926214971335e-08
PHALS_06533144599301051369e-08
CCI447521612815261071379e-08
PYU1_G001063144597831211369e-08
SPRG_05449144597231001342e-07
PHYRA_77834144599361031342e-07
PYAR_19914144597881151342e-07
SDRG_08800144598811001332e-07
PPTG_1340114459927971323e-07
PITG_1806714459924971323e-07
PHYRA_825431526711991091314e-07
PHYSO_5445981526711631091314e-07
PPTG_193711526711951091305e-07
CCI41225144599811111306e-07
PYAP_17290144598351201296e-07
CCA17102152926884991297e-07
PYAP_2264624178151241297e-07
SDRG_14487123428964561297e-07
PYIW_1848024177551221289e-07
SPRG_02752123428831561289e-07
CCA1909718566881271271e-06
H257_03361123428699691271e-06
PITG_192131526712011091271e-06
CCA2453118533741111251e-06
CCA16487144599751051262e-06
CCI4714518533901051252e-06
PHALS_040981526711831091234e-06
HYAP_044571526712031091234e-06
H310_0023012510912481121234e-06
PYAR_154631526710911091225e-06
CCA2171524177821361216e-06
CCA218601550787821361216e-06
CCI424571529269061051217e-06
PHYKE_6662152677651091208e-06
CCA180231526711381091209e-06
PHYKE_56782417809421209e-06
PYIR_151181347912221241201e-05
H257_0672112510912381101201e-05
PYAP_186361526710091091201e-05
PYIR_1312024178141221191e-05
CCI462351526711551091191e-05
PYVX_183382417746511191e-05
PITG_113039318293361161e-05
CCI10489158709777421181e-05
PHYSO_3441122417813421182e-05
PYU1_G00438624178371211182e-05
PYAR_1988324178331241182e-05
PPTG_055192417810421182e-05
PITG_027622417810421172e-05
PHYCA_5061372417810421172e-05
PYIR_183821526711541091182e-05
PHYRA_792812417809421172e-05
PYU1_G008848152677651091172e-05
PYIR_233721583514151371172e-05
PYVX_19030125545561461162e-05
PYU1_G00950895765328761152e-05
SDRG_014081225189161721163e-05
PYIW_16987152678211091163e-05
PITG_0210918535221111153e-05
SPRG_008891225189941681163e-05
H310_0637814459837981153e-05
HYAP_080262417798421144e-05
SDRG_00080124544298491125e-05
PHALS_0656818533881141125e-05
PHALS_036452417830421136e-05
H257_16349122272262791106e-05
H310_0484213957710811381137e-05
PYIW_18491158351684781128e-05
PYIW_18911134791196401129e-05
PPTG_1463018533981121109e-05
H310_04843152679681091111e-04
PYAR_25500158354731011101e-04
CCA25510134791139401111e-04
PYIR_22246125545591251101e-04
PYAP_241441583510221171101e-04
PYAP_136951853348531091e-04
H310_05457122272269791081e-04
PYIR_135551853355461091e-04
PYVX_133121526710161091102e-04
SPRG_00364122272255721062e-04
SDRG_03531122272255701062e-04
PYAR_1461586325171061082e-04
PYAP_19753614713401171092e-04
PYVX_1452760301269971092e-04
H310_002091583511981191092e-04
PITG_20103158351301751092e-04
SPRG_00890152678831231082e-04
PHYRA_79348158351240731092e-04
H257_03093152679751091082e-04
PYAP_2219586329011061082e-04
SPRG_1702213189210745992e-04
PYAR_2432361478831101082e-04
H257_1356714459836361083e-04
SPRG_16312131322261571053e-04
PHYSO_350197125545571061064e-04
SDRG_144861853308531054e-04
SDRG_01407152678151091074e-04
PYIR_17453951126191471074e-04
H257_09028125545561551064e-04
SPRG_027531853309531054e-04
PPTG_06823158351321751074e-04
H257_066981583511991201064e-04
H310_1244812554555991064e-04
PHYKE_491118534635934e-04
HYAP_11712125545581271054e-04
PYU1_G00673286329541161065e-04
CCI43793134791117401065e-04
PHALS_0972986329491081056e-04
SDRG_051502417787411056e-04
PHYSO_47861118535221231046e-04
PYU1_G0128701853352521036e-04
SPRG_083462417797411047e-04
H257_075142417810411047e-04
H310_077012417811411047e-04
PYU1_G012859185011831251047e-04
PHYCA_56429686329571081048e-04
PHYSO_55849886329671081030.001
H257_06469219447630930.001
SDRG_0628816641561030.001
PITG_10462863210281081030.001
PHYRA_82040863210541081030.001
PPTG_0878586329441081030.001
PYAP_1665895765294341010.001
CCI434561109212664960.001
PYVX_16714863210301061020.001
PHYCA_50480118533981121010.001
PYIW_208911853291521000.001
PHYSO_315255158351301751020.001
HYAP_09304134791144341020.001
PHYKE_104486325211081010.001
HYAP_01795132528561291010.002
PHYKE_9146125545571061010.002
SPRG_09211125545491471010.002
PHYRA_7343018533951111000.002
PYIW_1781818501188321010.002
PYVX_13084134791267341010.002
SDRG_02154126568822971010.002
CCA27157125545531181000.002
SPRG_11900166051131000.002
H257_033631853316205990.002
H310_019211853341138990.002
CCA191181109212564930.003
SPRG_0832612631050151990.003
SDRG_147711255454984990.003
PYU1_G01227415835873108990.003
SDRG_0512812631051251990.003
PHALS_0260812554557124990.003
H257_16768151071137143930.003
H310_14019920468345980.004
CCI419097700282112960.004
PHYSO_3436291445997730980.004
SPRG_0883412656882597980.004
H310_06666863288734980.004
HYAP_1171317645417112970.004
SPRG_0491212454426146960.004
HYAP_073488632973108980.004
HYAP_09511158351295101980.005
CCI4589595111721125980.005
CCA1903395111883180980.005
PYU1_G01126161471328117970.005
CCA268906147153059970.006
PYAP_1616198661889139970.006
SDRG_082368632864112970.006
PPTG_1898913479121334970.006
PYIR_230128632965106970.006
PPTG_0900813934166095970.006
PYU1_G0032291681050960.006
PHYRA_7713461501267108960.007
PHALS_0793013479120034960.007
PYAR_1869095112455117970.007
PHYSO_33085851237548122960.007
PYAR_1912299405554125960.007
PHYRA_8194413479114934960.007
CCI1147412554553118950.008
SPRG_0606115835115974950.009
SDRG_021352194430633940.009
SPRG_018608632674112950.009
PHYKE_8531770026941930.009
PYIW_2110895112593126950.009
SPRG_143129639661102950.010
PYIR_1316828851353106950.010
H257_01308863289734950.010
CCI45127160987202178920.010
SDRG_02438135450224133920.010
H310_09363140947195456950.010
PHALS_055872885136196950.011
PYVX_2258915835137578940.012
PPTG_0988921268183108910.012
PHALS_1136715835132969940.012
PHALS_0706211092122122880.012
H257_081821685954940.013
H257_039319639695108940.013
SPRG_0250211092121119870.014
CCI40991241780129930.014
PYAR_16504838381258105940.014
CCI45857863290556930.014
SDRG_0560811092121119870.014
H310_13911770036944920.015
SDRG_1277615835118474930.015
HYAP_13690185337739920.016
CCI1092861471530112930.016
SPRG_20275134100394117920.017
CCA23572863286856930.017
SPRG_139757700331109910.018
PYIR_1678061471352115930.018
PHYKE_55881675141920.018
PHYRA_732975725911937860.019
SDRG_070127700331109910.020
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= H257_06294

Length=358
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

H257_06294                                                            645        0.0   
H310_09223                                                            480        2e-170
SDRG_01781                                                            282        2e-92 
SPRG_06336                                                            280        1e-91 
PYU1_G001735                                                          171        4e-49 
PHYRA_81100                                                           166        3e-47 
PHYSO_471523                                                          164        2e-46 
PHYCA_556162                                                          162        9e-46 
PYIR_13451                                                            162        1e-45 
PITG_18456                                                            159        1e-44 
PPTG_17127                                                            158        3e-44 
PYAP_17762                                                            157        6e-44 
PYVX_18171                                                            149        3e-41 
PHALS_06478                                                           146        6e-40 
CCA18899                                                              139        3e-37 
PYIW_19971                                                            130        6e-34 
PHYKE_8393                                                            121        1e-30 
PYAR_13570                                                            110        1e-26 
CCI45123                                                              91.3       8e-20 
PPTG_18898                                                            72.0       2e-12 
PITG_20562                                                            71.6       2e-12 
PYAR_23286                                                            68.9       1e-11 
PYIW_17381                                                            67.8       3e-11 
PHYRA_84916                                                           67.8       3e-11 
PHYSO_361747                                                          66.6       9e-11 
HYAP_08645                                                            66.2       1e-10 
PYU1_G006347                                                          65.5       2e-10 
PYIR_21589                                                            64.7       4e-10 
SPRG_06059                                                            62.0       2e-09 
PHYKE_2479                                                            58.5       3e-09 
PYVX_13574                                                            61.6       3e-09 
PHYKE_1990                                                            61.6       4e-09 
PYAP_16997                                                            60.8       6e-09 
SDRG_12762                                                            60.8       7e-09 
SPRG_06058                                                            60.5       7e-09 
H310_00231                                                            60.5       8e-09 
SDRG_12763                                                            59.7       1e-08 
PYVX_20438                                                            59.7       1e-08 
CCA18875                                                              59.3       2e-08 
PYIW_13172                                                            58.9       3e-08 
PYIR_15309                                                            58.9       3e-08 
H257_06722                                                            58.2       4e-08 
PHYCA_503112                                                          55.8       5e-08 
PHALS_06533                                                           57.0       9e-08 
CCI44752                                                              57.4       9e-08 
PYU1_G001063                                                          57.0       9e-08 
SPRG_05449                                                            56.2       2e-07 
PHYRA_77834                                                           56.2       2e-07 
PYAR_19914                                                            56.2       2e-07 
SDRG_08800                                                            55.8       2e-07 
PPTG_13401                                                            55.5       3e-07 
PITG_18067                                                            55.5       3e-07 
PHYRA_82543                                                           55.1       4e-07 
PHYSO_544598                                                          55.1       4e-07 
PPTG_19371                                                            54.7       5e-07 
CCI41225                                                              54.7       6e-07 
PYAP_17290                                                            54.3       6e-07 
CCA17102                                                              54.3       7e-07 
PYAP_22646                                                            54.3       7e-07 
SDRG_14487                                                            54.3       7e-07 
PYIW_18480                                                            53.9       9e-07 
SPRG_02752                                                            53.9       9e-07 
CCA19097                                                              53.5       1e-06 
H257_03361                                                            53.5       1e-06 
PITG_19213                                                            53.5       1e-06 
CCA24531                                                              52.8       1e-06 
CCA16487                                                              53.1       2e-06 
CCI47145                                                              52.8       2e-06 
PHALS_04098                                                           52.0       4e-06 
HYAP_04457                                                            52.0       4e-06 
H310_00230                                                            52.0       4e-06 
PYAR_15463                                                            51.6       5e-06 
CCA21715                                                              51.2       6e-06 
CCA21860                                                              51.2       6e-06 
CCI42457                                                              51.2       7e-06 
PHYKE_6662                                                            50.8       8e-06 
CCA18023                                                              50.8       9e-06 
PHYKE_5678                                                            50.8       9e-06 
PYIR_15118                                                            50.8       1e-05 
H257_06721                                                            50.8       1e-05 
PYAP_18636                                                            50.8       1e-05 
PYIR_13120                                                            50.4       1e-05 
CCI46235                                                              50.4       1e-05 
PYVX_18338                                                            50.4       1e-05 
PITG_11303                                                            49.3       1e-05 
CCI10489                                                              50.1       1e-05 
PHYSO_344112                                                          50.1       2e-05 
PYU1_G004386                                                          50.1       2e-05 
PYAR_19883                                                            50.1       2e-05 
PPTG_05519                                                            50.1       2e-05 
PITG_02762                                                            49.7       2e-05 
PHYCA_506137                                                          49.7       2e-05 
PYIR_18382                                                            50.1       2e-05 
PHYRA_79281                                                           49.7       2e-05 
PYU1_G008848                                                          49.7       2e-05 
PYIR_23372                                                            49.7       2e-05 
PYVX_19030                                                            49.3       2e-05 
PYU1_G009508                                                          48.9       2e-05 
SDRG_01408                                                            49.3       3e-05 
PYIW_16987                                                            49.3       3e-05 
PITG_02109                                                            48.9       3e-05 
SPRG_00889                                                            49.3       3e-05 
H310_06378                                                            48.9       3e-05 
HYAP_08026                                                            48.5       4e-05 
SDRG_00080                                                            47.8       5e-05 
PHALS_06568                                                           47.8       5e-05 
PHALS_03645                                                           48.1       6e-05 
H257_16349                                                            47.0       6e-05 
H310_04842                                                            48.1       7e-05 
PYIW_18491                                                            47.8       8e-05 
PYIW_18911                                                            47.8       9e-05 
PPTG_14630                                                            47.0       9e-05 
H310_04843                                                            47.4       1e-04 
PYAR_25500                                                            47.0       1e-04 
CCA25510                                                              47.4       1e-04 
PYIR_22246                                                            47.0       1e-04 
PYAP_24144                                                            47.0       1e-04 
PYAP_13695                                                            46.6       1e-04 
H310_05457                                                            46.2       1e-04 
PYIR_13555                                                            46.6       1e-04 
PYVX_13312                                                            47.0       2e-04 
SPRG_00364                                                            45.4       2e-04 
SDRG_03531                                                            45.4       2e-04 
PYAR_14615                                                            46.2       2e-04 
PYAP_19753                                                            46.6       2e-04 
PYVX_14527                                                            46.6       2e-04 
H310_00209                                                            46.6       2e-04 
PITG_20103                                                            46.6       2e-04 
SPRG_00890                                                            46.2       2e-04 
PHYRA_79348                                                           46.6       2e-04 
H257_03093                                                            46.2       2e-04 
PYAP_22195                                                            46.2       2e-04 
SPRG_17022                                                            42.7       2e-04 
PYAR_24323                                                            46.2       2e-04 
H257_13567                                                            46.2       3e-04 
SPRG_16312                                                            45.1       3e-04 
PHYSO_350197                                                          45.4       4e-04 
SDRG_14486                                                            45.1       4e-04 
SDRG_01407                                                            45.8       4e-04 
PYIR_17453                                                            45.8       4e-04 
H257_09028                                                            45.4       4e-04 
SPRG_02753                                                            45.1       4e-04 
PPTG_06823                                                            45.8       4e-04 
H257_06698                                                            45.4       4e-04 
H310_12448                                                            45.4       4e-04 
PHYKE_4911                                                            40.4       4e-04 
HYAP_11712                                                            45.1       4e-04 
PYU1_G006732                                                          45.4       5e-04 
CCI43793                                                              45.4       5e-04 
PHALS_09729                                                           45.1       6e-04 
SDRG_05150                                                            45.1       6e-04 
PHYSO_478611                                                          44.7       6e-04 
PYU1_G012870                                                          44.3       6e-04 
SPRG_08346                                                            44.7       7e-04 
H257_07514                                                            44.7       7e-04 
H310_07701                                                            44.7       7e-04 
PYU1_G012859                                                          44.7       7e-04 
PHYCA_564296                                                          44.7       8e-04 
PHYSO_558498                                                          44.3       0.001 
H257_06469                                                            40.4       0.001 
SDRG_06288                                                            44.3       0.001 
PITG_10462                                                            44.3       0.001 
PHYRA_82040                                                           44.3       0.001 
PPTG_08785                                                            44.3       0.001 
PYAP_16658                                                            43.5       0.001 
CCI43456                                                              41.6       0.001 
PYVX_16714                                                            43.9       0.001 
PHYCA_504801                                                          43.5       0.001 
PYIW_20891                                                            43.1       0.001 
PHYSO_315255                                                          43.9       0.001 
HYAP_09304                                                            43.9       0.001 
PHYKE_1044                                                            43.5       0.001 
HYAP_01795                                                            43.5       0.002 
PHYKE_9146                                                            43.5       0.002 
SPRG_09211                                                            43.5       0.002 
PHYRA_73430                                                           43.1       0.002 
PYIW_17818                                                            43.5       0.002 
PYVX_13084                                                            43.5       0.002 
SDRG_02154                                                            43.5       0.002 
CCA27157                                                              43.1       0.002 
SPRG_11900                                                            43.1       0.002 
H257_03363                                                            42.7       0.002 
H310_01921                                                            42.7       0.002 
CCA19118                                                              40.4       0.003 
SPRG_08326                                                            42.7       0.003 
SDRG_14771                                                            42.7       0.003 
PYU1_G012274                                                          42.7       0.003 
SDRG_05128                                                            42.7       0.003 
PHALS_02608                                                           42.7       0.003 
H257_16768                                                            40.4       0.003 
H310_14019                                                            42.4       0.004 
CCI41909                                                              41.6       0.004 
PHYSO_343629                                                          42.4       0.004 
SPRG_08834                                                            42.4       0.004 
H310_06666                                                            42.4       0.004 
HYAP_11713                                                            42.0       0.004 
SPRG_04912                                                            41.6       0.004 
HYAP_07348                                                            42.4       0.004 
HYAP_09511                                                            42.4       0.005 
CCI45895                                                              42.4       0.005 
CCA19033                                                              42.4       0.005 
PYU1_G011261                                                          42.0       0.005 
CCA26890                                                              42.0       0.006 
PYAP_16161                                                            42.0       0.006 
SDRG_08236                                                            42.0       0.006 
PPTG_18989                                                            42.0       0.006 
PYIR_23012                                                            42.0       0.006 
PPTG_09008                                                            42.0       0.006 
PYU1_G003229                                                          41.6       0.006 
PHYRA_77134                                                           41.6       0.007 
PHALS_07930                                                           41.6       0.007 
PYAR_18690                                                            42.0       0.007 
PHYSO_330858                                                          41.6       0.007 
PYAR_19122                                                            41.6       0.007 
PHYRA_81944                                                           41.6       0.007 
CCI11474                                                              41.2       0.008 
SPRG_06061                                                            41.2       0.009 
SDRG_02135                                                            40.8       0.009 
SPRG_01860                                                            41.2       0.009 
PHYKE_8531                                                            40.4       0.009 
PYIW_21108                                                            41.2       0.009 
SPRG_14312                                                            41.2       0.010 
PYIR_13168                                                            41.2       0.010 
H257_01308                                                            41.2       0.010 
CCI45127                                                              40.0       0.010 
SDRG_02438                                                            40.0       0.010 
H310_09363                                                            41.2       0.010 
PHALS_05587                                                           41.2       0.011 
PYVX_22589                                                            40.8       0.012 
PPTG_09889                                                            39.7       0.012 
PHALS_11367                                                           40.8       0.012 
PHALS_07062                                                           38.5       0.012 
H257_08182                                                            40.8       0.013 
H257_03931                                                            40.8       0.013 
SPRG_02502                                                            38.1       0.014 
CCI40991                                                              40.4       0.014 
PYAR_16504                                                            40.8       0.014 
CCI45857                                                              40.4       0.014 
SDRG_05608                                                            38.1       0.014 
H310_13911                                                            40.0       0.015 
SDRG_12776                                                            40.4       0.015 
HYAP_13690                                                            40.0       0.016 
CCI10928                                                              40.4       0.016 
SPRG_20275                                                            40.0       0.017 
CCA23572                                                              40.4       0.017 
SPRG_13975                                                            39.7       0.018 
PYIR_16780                                                            40.4       0.018 
PHYKE_5588                                                            40.0       0.018 
PHYRA_73297                                                           37.7       0.019 
SDRG_07012                                                            39.7       0.020 
H310_08803                                                            40.0       0.022 
HYAP_06101                                                            40.0       0.022 
HYAP_13757                                                            39.3       0.022 
H310_13627                                                            39.7       0.023 
PHYSO_320361                                                          39.3       0.024 
PYU1_G001268                                                          39.3       0.025 
SDRG_15601                                                            39.3       0.026 
PHALS_13270                                                           39.7       0.026 
H257_05679                                                            39.3       0.027 
PHYCA_504712                                                          38.5       0.027 
PHYCA_509385                                                          39.7       0.027 
PITG_08008                                                            39.7       0.028 
PYVX_15906                                                            37.4       0.028 
PPTG_19385                                                            39.3       0.030 
PYU1_G000724                                                          38.1       0.032 
PYAR_18008                                                            37.4       0.034 
PPTG_19471                                                            38.9       0.035 
PPTG_14626                                                            39.3       0.035 
H310_06667                                                            39.3       0.035 
PYAR_21583                                                            38.5       0.035 
PYIR_14494                                                            39.3       0.035 
H310_07683                                                            39.3       0.036 
H310_01510                                                            39.3       0.036 
PHYRA_80100                                                           38.5       0.037 
PHYSO_355952                                                          38.5       0.037 
PYAP_22685                                                            39.3       0.038 
PITG_14197                                                            38.9       0.038 
H257_01309                                                            39.3       0.039 
PPTG_03644                                                            38.5       0.040 
CCA15513                                                              39.3       0.040 
PYAR_16120                                                            39.3       0.041 
PITG_13665                                                            37.0       0.041 
PPTG_06991                                                            38.9       0.042 
H257_07492                                                            38.9       0.043 
H310_07070                                                            38.9       0.043 
PYAP_19085                                                            38.9       0.045 
PYIW_14611                                                            39.3       0.045 
CCA22329                                                              38.9       0.046 
PYIR_22667                                                            38.9       0.048 
PYIR_21831                                                            37.4       0.049 
H310_02933                                                            38.9       0.049 
PHYCA_553561                                                          38.1       0.049 
H257_10913                                                            38.9       0.049 
H257_03521                                                            38.9       0.050 
PHALS_12874                                                           38.1       0.055 
PYU1_G009249                                                          38.9       0.055 
H310_02031                                                            38.9       0.056 
PPTG_05753                                                            38.5       0.057 
PHYKE_7347                                                            36.6       0.058 
PPTG_16659                                                            38.5       0.059 
PYAR_17064                                                            38.5       0.060 
PHYSO_484541                                                          38.5       0.060 
PHYRA_78815                                                           38.5       0.060 
PHYRA_94409                                                           38.5       0.062 
PYIW_24869                                                            37.7       0.062 
PHYRA_73432                                                           38.5       0.063 
PITG_00020                                                            38.5       0.063 
HYAP_04252                                                            38.1       0.063 
PHYSO_248481                                                          38.5       0.064 
PHYRA_85100                                                           36.2       0.064 
PHYRA_85097                                                           36.2       0.064 
PITG_16461                                                            38.5       0.066 
PHYCA_71329                                                           35.4       0.066 
H257_11802                                                            38.5       0.066 
PITG_03318                                                            38.5       0.068 
PITG_02106                                                            38.5       0.068 
PHALS_12503                                                           38.1       0.068 
PYVX_14851                                                            37.7       0.068 
PPTG_16044                                                            38.5       0.070 
PHYSO_533422                                                          38.5       0.070 
SPRG_02939                                                            38.5       0.077 
PYU1_G002683                                                          38.1       0.078 
PHALS_03540                                                           38.1       0.078 
PYIW_21526                                                            38.1       0.079 
PHYSO_289146                                                          36.2       0.082 
PITG_00263                                                            38.1       0.083 
PHYRA_79015                                                           38.1       0.087 
PITG_09298                                                            37.4       0.088 
PHYCA_510506                                                          35.8       0.089 
CCI46733                                                              38.1       0.091 
PYAP_17960                                                            37.7       0.094 
SPRG_21393                                                            37.7       0.097 
PHYRA_82553                                                           38.1       0.10  
PYU1_G010818                                                          36.6       0.10  
PHYCA_568901                                                          38.1       0.10  
PPTG_19631                                                            35.8       0.11  
SPRG_06273                                                            37.7       0.11  
PHYKE_10704                                                           37.7       0.11  
H310_01094                                                            35.4       0.11  
H310_12480                                                            36.6       0.11  
SDRG_01838                                                            37.7       0.11  
H257_00263                                                            37.7       0.12  
PYVX_14593                                                            37.7       0.12  
PHYSO_349983                                                          37.7       0.13  
SDRG_03414                                                            37.4       0.13  
PYAP_15732                                                            37.0       0.14  
CCI45290                                                              37.4       0.15  
PYU1_G008863                                                          37.4       0.15  
PYIR_25066                                                            36.6       0.15  
HYAP_02360                                                            35.0       0.16  
PITG_15553                                                            37.0       0.16  
PHYKE_7856                                                            37.0       0.16  
PYIW_21944                                                            37.4       0.16  
PYAP_18827                                                            37.4       0.17  
SPRG_06021                                                            37.4       0.17  
SDRG_05567                                                            37.4       0.17  
PYVX_14287                                                            37.0       0.17  
PYVX_21377                                                            37.0       0.18  
H310_13412                                                            37.0       0.18  
SDRG_07310                                                            37.0       0.19  
CCI40262                                                              37.0       0.19  
H257_03095                                                            37.0       0.19  
CCA25744                                                              36.2       0.20  
PYAP_23744                                                            35.0       0.20  
H257_09823                                                            37.0       0.21  
H257_10063                                                            37.0       0.22  
PYIR_22825                                                            36.6       0.22  
PHALS_06334                                                           37.0       0.22  
PYIW_19873                                                            35.8       0.23  
PHALS_00378                                                           37.0       0.23  
PHYKE_9717                                                            36.6       0.24  
H310_12867                                                            36.6       0.24  
PHALS_09667                                                           36.6       0.25  
PPTG_04553                                                            36.6       0.25  
PITG_17893                                                            36.6       0.25  
SDRG_00756                                                            36.6       0.25  
SDRG_06342                                                            36.6       0.25  
SPRG_08532                                                            36.6       0.26  
CCI39367                                                              36.6       0.27  
SPRG_06629                                                            36.2       0.28  
PYAR_16228                                                            36.6       0.28  
H310_05615                                                            36.6       0.28  
PYIW_23677                                                            33.9       0.29  
H257_10151                                                            36.2       0.29  
H257_00729                                                            34.3       0.29  
PHYSO_351681                                                          36.6       0.30  
PHYSO_529931                                                          36.6       0.30  
PHYRA_83071                                                           36.6       0.30  
PHYSO_556164                                                          36.2       0.31  
CCA24267                                                              35.0       0.31  
CCA21572                                                              35.0       0.31  
PPTG_10911                                                            36.2       0.32  
H310_06449                                                            36.2       0.32  
CCA25004                                                              36.2       0.33  
PHYRA_83696                                                           35.8       0.33  
SPRG_01283                                                            35.8       0.33  
PHYRA_72612                                                           36.2       0.33  
PYU1_G009178                                                          35.8       0.34  
HYAP_13688                                                            36.2       0.34  
PHYRA_73535                                                           36.2       0.35  
PHYRA_82888                                                           35.8       0.36  
PHALS_10968                                                           35.8       0.37  
PYAP_18890                                                            34.3       0.37  
CCI44571                                                              34.3       0.37  
SPRG_09128                                                            35.8       0.38  
SDRG_11258                                                            35.4       0.38  
CCA17621                                                              36.2       0.38  
PYVX_16256                                                            35.8       0.39  
CCI39556                                                              36.2       0.39  
PYIR_22259                                                            34.3       0.40  
SPRG_18807                                                            35.8       0.40  
PYVX_22150                                                            35.4       0.41  
H310_03025                                                            35.8       0.41  
PYIW_16910                                                            35.8       0.41  
H310_14194                                                            34.3       0.42  
PYAP_16297                                                            36.2       0.42  
PYIW_26522                                                            33.9       0.43  
PHYKE_38                                                              35.0       0.43  
PYIR_15407                                                            33.9       0.43  
PYAP_15706                                                            35.4       0.45  
PHYCA_529660                                                          35.4       0.45  
PYIW_20221                                                            35.8       0.45  
PHALS_06699                                                           35.8       0.47  
SPRG_09805                                                            35.8       0.47  
PITG_11578                                                            35.8       0.47  
PHALS_08097                                                           35.8       0.48  
SPRG_07505                                                            35.8       0.48  
PYU1_G008119                                                          33.9       0.49  
PHYCA_539981                                                          35.8       0.49  
PPTG_11714                                                            35.8       0.51  
PYAP_19560                                                            35.4       0.51  
PYIW_23501                                                            35.4       0.51  
H310_14230                                                            34.3       0.51  
PYAR_22485                                                            35.0       0.52  
PYAR_15792                                                            33.5       0.52  
HYAP_13827                                                            35.4       0.55  
PPTG_07800                                                            34.3       0.56  
PHYSO_485120                                                          33.5       0.56  
PHYKE_4910                                                            35.0       0.57  
CCA14529                                                              35.4       0.58  
SPRG_00585                                                            35.4       0.59  
PYU1_G012858                                                          35.0       0.60  
PYIW_21901                                                            35.4       0.64  
H310_10154                                                            35.0       0.65  
PYAP_16005                                                            35.4       0.66  
PHYRA_84786                                                           35.0       0.70  
SDRG_14286                                                            35.0       0.71  
PYAR_13522                                                            35.0       0.72  
H257_16221                                                            35.4       0.74  
PYU1_G007013                                                          35.0       0.75  
PHYCA_9844                                                            34.7       0.76  
H257_02642                                                            35.0       0.77  
PHYCA_98948                                                           33.1       0.77  
H257_10847                                                            35.0       0.79  
PYU1_G004115                                                          33.5       0.80  
HYAP_10421                                                            34.7       0.80  
PHYRA_85319                                                           35.0       0.81  
PYIR_21125                                                            35.0       0.83  
H257_11443                                                            35.0       0.84  
PITG_19979                                                            33.9       0.86  
PITG_07572                                                            33.9       0.86  
HYAP_10830                                                            35.0       0.87  
PHYRA_73534                                                           35.0       0.87  
H310_00912                                                            35.0       0.96  
PHALS_06336                                                           34.7       0.97  
H310_11667                                                            34.7       0.97  
PYAP_14828                                                            34.7       0.98  
CCI48559                                                              34.7       0.99  
PITG_03652                                                            34.7       0.99  
PYU1_G013961                                                          32.7       1.0   
PYAP_14281                                                            34.7       1.0   
CCA17473                                                              34.7       1.1   
SDRG_04871                                                            34.7       1.1   
H257_11158                                                            34.7       1.1   
PHALS_11651                                                           34.7       1.1   
PYIR_17155                                                            34.3       1.1   
SPRG_08217                                                            34.3       1.2   
PHALS_12153                                                           34.7       1.2   
PHYSO_543442                                                          34.3       1.2   
SDRG_01684                                                            34.3       1.2   
SDRG_06927                                                            34.3       1.2   
PYAR_13491                                                            34.3       1.2   
H257_02394                                                            34.3       1.3   
PHYRA_82056                                                           34.3       1.3   
PHALS_06636                                                           34.3       1.3   
PYVX_17890                                                            33.9       1.3   
HYAP_14013                                                            33.9       1.3   
PITG_10447                                                            34.3       1.3   
CCI42711                                                              34.3       1.3   
H257_08752                                                            34.3       1.4   
PPTG_08766                                                            34.3       1.4   
SPRG_08783                                                            33.9       1.4   
PHYCA_6753                                                            34.3       1.4   
PHYSO_333939                                                          32.7       1.4   
H310_04667                                                            34.3       1.5   
PHYRA_75484                                                           33.9       1.5   
SDRG_15262                                                            33.9       1.5   
H257_05175                                                            34.3       1.5   
HYAP_08248                                                            34.3       1.5   
PYVX_13261                                                            34.3       1.5   

>H257_06294
Length=358

 Score = 645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/358 (100%), Positives = 358/358 (100%), Gaps = 0/358 (0%)

Query  1    MHVNLSKIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSF  60
            MHVNLSKIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSF
Sbjct  1    MHVNLSKIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSF  60

Query  61   VLSECEKQDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKN  120
            VLSECEKQDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKN
Sbjct  61   VLSECEKQDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKN  120

Query  121  SSPQKSMSQRIEEITGPLLPCASVQLNCPRRDMIHITTLGHKESAGLMQSLEAQMKNVKK  180
            SSPQKSMSQRIEEITGPLLPCASVQLNCPRRDMIHITTLGHKESAGLMQSLEAQMKNVKK
Sbjct  121  SSPQKSMSQRIEEITGPLLPCASVQLNCPRRDMIHITTLGHKESAGLMQSLEAQMKNVKK  180

Query  181  TSQELLQQAINDAKEADRIGDATVNEMVYQEDVLNDAEGTVDTMGRQMDHAEDLGRSLKH  240
            TSQELLQQAINDAKEADRIGDATVNEMVYQEDVLNDAEGTVDTMGRQMDHAEDLGRSLKH
Sbjct  181  TSQELLQQAINDAKEADRIGDATVNEMVYQEDVLNDAEGTVDTMGRQMDHAEDLGRSLKH  240

Query  241  PILYKLTHLFtrkksykkggrgsktrkggakasrssrvsrvKLqppqqqhaaaqpEDDQL  300
            PILYKLTHLFTRKKSYKKGGRGSKTRKGGAKASRSSRVSRVKLQPPQQQHAAAQPEDDQL
Sbjct  241  PILYKLTHLFTRKKSYKKGGRGSKTRKGGAKASRSSRVSRVKLQPPQQQHAAAQPEDDQL  300

Query  301  DQLSKILAKLGQTADTISDITARTTEQVDRIDQKVTSVDDRVKKEAKLVQAVLKAEMT  358
            DQLSKILAKLGQTADTISDITARTTEQVDRIDQKVTSVDDRVKKEAKLVQAVLKAEMT
Sbjct  301  DQLSKILAKLGQTADTISDITARTTEQVDRIDQKVTSVDDRVKKEAKLVQAVLKAEMT  358

>H310_09223
Length=333

 Score = 480 bits (1236),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 257/358 (72%), Positives = 287/358 (80%), Gaps = 25/358 (7%)

Query  1    MHVNLSKIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSF  60
            MHVNLSKIHQTSCEGYVTKRGH+MK+WKRRYMVL+GDTLLV+YYDSKEIY S G PKGSF
Sbjct  1    MHVNLSKIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSF  60

Query  61   VLSECEKQDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKN  120
            VLSECEKQDLSDEG SVKPFGFKFIGHCPGQGYKEY V+VE+QIDQTKWLNVAHNALGK 
Sbjct  61   VLSECEKQDLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKT  120

Query  121  SSPQKSMSQRIEEITGPLLPCASVQLNCPRRDMIHITTLGHKESAGLMQSLEAQMKNVKK  180
            +                 +P  S++ +            GHKESAGLM SLEAQ+KNVKK
Sbjct  121  T----------------YIPSPSMESHG---------GAGHKESAGLMISLEAQIKNVKK  155

Query  181  TSQELLQQAINDAKEADRIGDATVNEMVYQEDVLNDAEGTVDTMGRQMDHAEDLGRSLKH  240
            TS ELLQQAINDAKEADRIGDATV+EM YQE+VLNDAE TVD MG+QMD AEDLG+S+KH
Sbjct  156  TSHELLQQAINDAKEADRIGDATVDEMAYQEEVLNDAENTVDAMGKQMDRAEDLGKSIKH  215

Query  241  PILYKLTHLFtrkksykkggrgsktrkggakasrssrvsrvKLqppqqqhaaaqpEDDQL  300
            PILYK TH+F+RKKS +     S  ++GG K++RSSRV R             + E+DQL
Sbjct  216  PILYKFTHIFSRKKSKRGKRGASSKKRGGGKSTRSSRVPRGVQVKLHPPQPQPKQEEDQL  275

Query  301  DQLSKILAKLGQTADTISDITARTTEQVDRIDQKVTSVDDRVKKEAKLVQAVLKAEMT  358
            D+LSKILAKLGQTADTISDIT RTTEQVDRIDQKVTSVD+RV KEAKLV++VLKAEMT
Sbjct  276  DELSKILAKLGQTADTISDITTRTTEQVDRIDQKVTSVDERVTKEAKLVESVLKAEMT  333

>SDRG_01781
Length=335

 Score = 282 bits (721),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 153/353 (43%), Positives = 210/353 (59%), Gaps = 25/353 (7%)

Query  1    MHVNLSKIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTS-KGHPKGS  59
            M+++L+   QTSCEGYVTKRGH+MKSW+RRYMVL+GDTL VSY+DSK IY S K   KGS
Sbjct  1    MNLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGS  60

Query  60   FVLSECEKQDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGK  119
            F+L+E EK D SDEG  VKP+GFK +GH PG GYKE+ VYVE+  DQT+WL VAHNALGK
Sbjct  61   FILAEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120

Query  120  NSSPQKSMSQRIEEITGPLLPCASVQLNCPRRDMIHITTLGHKESAGLMQSLEAQMKNVK  179
            N +PQ S  QR   +                        LGH+ ++G + S   Q++NV 
Sbjct  121  NVAPQASADQRATAL------------------------LGHRAASGFLTSAPVQLRNVN  156

Query  180  KTSQELLQQAINDAKEADRIGDATVNEMVYQEDVLNDAEGTVDTMGRQMDHAEDLGRSLK  239
            KT +ELL++AI   + A  +GD TV+EM +  ++L+ AE  +D +G ++D  +++ + + 
Sbjct  157  KTKEELLRKAIVTLEHARTVGDNTVSEMGHNAEMLDIAEANMDYVGTELDRGDNIIKKMT  216

Query  240  HPILYKLTHLFtrkksykkggrgsktrkggakasrssrvsrvKLqppqqqhaaaqpEDDQ  299
             P  Y  +   ++KK        S           S    +      +         DD+
Sbjct  217  SPFFYYFSSSKSKKKGAGSPKSKSARSHLPQTPMNSPTNKKPSGPTSKTGGPTTDAGDDE  276

Query  300  LDQLSKILAKLGQTADTISDITARTTEQVDRIDQKVTSVDDRVKKEAKLVQAV  352
            LDQLSKILA L   A+TIS    RTTEQ+DRI +K+   D+RV +++  V A+
Sbjct  277  LDQLSKILASLEVHANTISTEVERTTEQIDRIQKKMVEADERVVEQSAKVHAI  329

>SPRG_06336
Length=335

 Score = 280 bits (716),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 153/353 (43%), Positives = 210/353 (59%), Gaps = 25/353 (7%)

Query  1    MHVNLSKIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTS-KGHPKGS  59
            M+++L+   QTSCEGYVTKRGH+MKSW+RRYMVL+GDTL VSYYDSK IY S K   KGS
Sbjct  1    MNLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGS  60

Query  60   FVLSECEKQDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGK  119
            F+L+E EK D SDEG  VKP+GFK +GH PG GYKE+ VYVE+  DQT+WL VAHNALGK
Sbjct  61   FILAEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120

Query  120  NSSPQKSMSQRIEEITGPLLPCASVQLNCPRRDMIHITTLGHKESAGLMQSLEAQMKNVK  179
            N +PQ S+ QR   +                        LGH+  +G + S   Q++NV 
Sbjct  121  NVTPQASVDQRASAL------------------------LGHRAPSGFLTSAPVQLRNVN  156

Query  180  KTSQELLQQAINDAKEADRIGDATVNEMVYQEDVLNDAEGTVDTMGRQMDHAEDLGRSLK  239
            KT +ELL++AI   + A  +GD TV+EM +  ++L+ AE  +D +  ++D  +++ + + 
Sbjct  157  KTKEELLRKAIVTLEHARTVGDNTVSEMGHNAEMLDIAEANMDYVETELDRGDNIIKKMT  216

Query  240  HPILYKLTHLFtrkksykkggrgsktrkggakasrssrvsrvKLqppqqqhaaaqpEDDQ  299
             P  Y  +   ++KK        S           S    +      +   A     DD+
Sbjct  217  SPFFYYFSSSKSKKKGTGSPKSKSARSHQPQTPMNSPTHKKSSGPASKAGGATTDAGDDE  276

Query  300  LDQLSKILAKLGQTADTISDITARTTEQVDRIDQKVTSVDDRVKKEAKLVQAV  352
            LDQLSKILA L   A+TIS    RTTEQ+DRI +K+   D+R+ +++  V A+
Sbjct  277  LDQLSKILASLEVHANTISTEVERTTEQIDRIQKKMVEADERIVEQSAKVHAI  329

>PYU1_G001735
Length=342

 Score = 171 bits (432),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 119/349 (34%), Positives = 179/349 (51%), Gaps = 36/349 (10%)

Query  11   TSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGH-PKGSFVLSECEKQD  69
            TSCEGYVTKRGH  KSW+ RY+V NG  L VSY++S++   + G  PKGSF +S  EK +
Sbjct  22   TSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHE  81

Query  70   --LSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNAL-GKNSSPQKS  126
              +   G   KPFGFK +GH P +GY E  ++VES  D  KWL V  NAL       +K 
Sbjct  82   YWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKLTRKG  141

Query  127  MSQRIEEITGPLLPCASVQLNCPRRDMIHITTLGHKESAGLMQSLEAQMKNVKKTSQELL  186
            M+   + + G                             G   S + Q+K +  T +ELL
Sbjct  142  MTDSTKSMFG----------------------------FGASISPQLQVKKLAATKEELL  173

Query  187  QQAINDAKEADRIGDATVNEMVYQEDVLNDAEGTVDTMGRQMDHAEDLGRSLKHPILYKL  246
            ++A+ + + A  IG   VNE+V Q + L+  E  +  +   +DHA+ L R LK P+L   
Sbjct  174  REALREIEGAKLIGREAVNEIVSQGEKLDQVENDLGHVEGDLDHADKLLRHLKSPVL---  230

Query  247  THLFtrkksykkggrgsktrkggakasrssrvsrvKLqppqqqhaaaqpEDDQLDQLSKI  306
             H+F+     KKG   + T      AS ++            +        + L+ L+  
Sbjct  231  -HVFSNDNRQKKGAPTAATASASGGASATTSPVSGTEGQLHAKITGGGGTLNDLEMLALA  289

Query  307  LAKLGQTADTISDITARTTEQVDRIDQKVTSVDDRVKKEAKLVQAVLKA  355
            L++L + A+ ++   AR+TEQ+ RI++++TSV+DRV+ + K   A +KA
Sbjct  290  LSELEEQANLMNAEAARSTEQIARIEERLTSVNDRVQHQTKKATATMKA  338

>PHYRA_81100
Length=349

 Score = 166 bits (420),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 120/355 (34%), Positives = 187/355 (53%), Gaps = 33/355 (9%)

Query  7    KIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEI----YTSKGHPKGSFVL  62
            K   TSCEGYVTKRGH  KSW+ R++VL G  L +SYY+S+            PKGSF L
Sbjct  17   KARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYL  76

Query  63   SECEKQD--LSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKN  120
            S  E  +  +   GA+ KPFGFK IGH P +GY E  V+VE+Q D+ KWL VA NAL   
Sbjct  77   SSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNAL---  133

Query  121  SSPQKSMSQRIEEITGPLLPCASVQLNCPRRDMIHITTLGHKESAGLMQSLEAQMKNVKK  180
            S+ ++   Q I++         SV  N  ++++      G   S   + + + QM+ + +
Sbjct  134  SAKRQLTRQAIDQ---------SVSSN--KKNLF---GFGVSLSPQPLMTPQKQMQTLTQ  179

Query  181  TSQELLQQAINDAKEADRIGDATVNEMVYQEDVLNDAEGTVDTMGRQMDHAEDLGRSLKH  240
               ELL  A+ D + A  +G    NE+V Q + L+  E  +  + R +D  + L R LK 
Sbjct  180  NKDELLSGALRDIEAAKLVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFGDKLLRRLKS  239

Query  241  PILYKLTHLFtrkksykkggrgsktrkggakasrssrvsrvKLqppqqqhaaaqpEDDQL  300
            P L    HLF    S     + + ++    + S+ S  S  +L P  +    A   D  L
Sbjct  240  PTL----HLF----SDDSRPKSTASKGHSPQRSQQSGGSPSRLPPAMETINDAGVSD--L  289

Query  301  DQLSKILAKLGQTADTISDITARTTEQVDRIDQKVTSVDDRVKKEAKLVQAVLKA  355
            ++L++ L +L   A+ ++    R+T+Q++R++ ++++V  RV+K+ K   A L+A
Sbjct  290  ERLAQALGELEVQAEILNGEAGRSTQQIERVEHQLSNVTARVEKQTKQASATLRA  344

>PHYSO_471523
Length=348

 Score = 164 bits (414),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 117/353 (33%), Positives = 176/353 (50%), Gaps = 34/353 (10%)

Query  7    KIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEI-YTSKGH---PKGSFVL  62
            K   TSCEGYVTKRGH  KSW+ R++VL+G  L VSYY+S+   +   G    PKGSF L
Sbjct  17   KARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYL  76

Query  63   SECEKQD--LSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKN  120
            S  E  +  +   GA+ KPFGFK +GH P +GY E  V+VE+  D+ KWL VA NAL   
Sbjct  77   SSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNAL---  133

Query  121  SSPQKSMSQRIEEITGPLLPCASVQLNCPRRDMIHITTLGHKESAGLMQSLEAQMKNVKK  180
            S+ ++   Q I++   P            R+++          S     S + QM+ + K
Sbjct  134  SAKRQLTRQAIDQSVSPN-----------RKNLFGFNI---SLSPQPNMSPQKQMQTLTK  179

Query  181  TSQELLQQAINDAKEADRIGDATVNEMVYQEDVLNDAEGTVDTMGRQMDHAEDLGRSLKH  240
            +  ELL  A+ D + A ++G    NE+V Q + L+  E  +  + R +D  + L R LK 
Sbjct  180  SRDELLSDALRDIEAAKQVGREACNEIVTQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKS  239

Query  241  PILYKLTHLFtrkksykkggrgsktrkggakasrssrvsrvKLqppqqqhaaaqpEDDQL  300
            P L    HLF            +   K  +           +L P       A   D  L
Sbjct  240  PTL----HLF-----SDDSRPKASASKASSPQRSQQSGRPPRLPPAMDSINDAGVSD--L  288

Query  301  DQLSKILAKLGQTADTISDITARTTEQVDRIDQKVTSVDDRVKKEAKLVQAVL  353
            ++L++ L +L   A+ ++    R T+Q++RI+ ++++V  RV+K+ K   A L
Sbjct  289  ERLAQALGELEVQAELLNGEAGRGTQQIERIEHQLSNVTARVEKQTKQASAAL  341

>PHYCA_556162
Length=351

 Score = 162 bits (410),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 114/355 (32%), Positives = 181/355 (51%), Gaps = 31/355 (9%)

Query  7    KIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEI-YTSKGH---PKGSFVL  62
            K   TSCEGYVTKRGH  KSW+ R++VL+G  L V+YY+S+   + + G    PKGSF L
Sbjct  17   KARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYL  76

Query  63   SECEKQD--LSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKN  120
            S  E  +  +   GA+ KPFGFK +GH P +GY E  V+VE+  D+ KWL VA NAL   
Sbjct  77   SSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNAL---  133

Query  121  SSPQKSMSQRIEEITGPLLPCASVQLNCPRRDMIHITTLGHKESAGLMQSLEAQMKNVKK  180
            S+ ++   Q I++   P            ++++   +     + A    S + QM+ + K
Sbjct  134  SAKRQLTRQAIDQSVSP-----------NKKNLFGFSVSLSPQPA---LSPQKQMQTLTK  179

Query  181  TSQELLQQAINDAKEADRIGDATVNEMVYQEDVLNDAEGTVDTMGRQMDHAEDLGRSLKH  240
               +LL  A+ D + A +IG    NE+V Q + L+  E  +  + R +D  + L R LK 
Sbjct  180  NKDDLLSDALRDIEAAKQIGREACNEIVIQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKS  239

Query  241  PILYKLTHLFtrkksykkggrgsktrkggakasrssrvsrvKLqppqqqhaaaqpEDDQL  300
            P L    H+F      +     S       ++ +S   S  +L    +        D  L
Sbjct  240  PTL----HMF--SNDSRPKSTSSSKANSPQRSQQSGGSSPTRLAQAAESRIDPGASD--L  291

Query  301  DQLSKILAKLGQTADTISDITARTTEQVDRIDQKVTSVDDRVKKEAKLVQAVLKA  355
            ++L++ L +L   A+ ++D    +T+Q+  I+  +++V  RV+K+ K   A L+A
Sbjct  292  ERLAQALGELELQAELLNDEAGHSTQQIQTIEHHLSTVTGRVEKQTKQASATLRA  346

>PYIR_13451
Length=359

 Score = 162 bits (409),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 117/361 (32%), Positives = 180/361 (50%), Gaps = 40/361 (11%)

Query  7    KIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGH--------PKG  58
            K   TSCEGYVTKRGH  KSW+ RY+V NG  L V+YY+S++               PKG
Sbjct  23   KFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDASKGSSSSGGTGVPVPKG  82

Query  59   SFVLSECEKQD--LSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNA  116
            SF +S  EK +  +   G   KPFGFK +GH P +GY E  ++VES  D  KW+ V  NA
Sbjct  83   SFYVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQNA  142

Query  117  LGKNSSPQKSMSQRIEEITGPLLPCASVQLNCPRRDMIHITTLGHKESAGLMQSLEAQMK  176
            L  +++ ++S +                Q N   + M      G   SA    S + Q+K
Sbjct  143  L--DAAKKRSRT-------------GGFQDNSTTKTM-----FGFSASA----SPQLQVK  178

Query  177  NVKKTSQELLQQAINDAKEADRIGDATVNEMVYQEDVLNDAEGTVDTMGRQMDHAEDLGR  236
             +  T ++LL+ A+ + + A  IG   VNE+V Q + L+  E  +  +   +DHA+ L R
Sbjct  179  KLAATKEDLLRDALREIEGAKLIGREAVNEIVVQGEKLDMVESDLGKVEGDLDHADKLLR  238

Query  237  SLKHPILYKLTHLFtrkksykkggrgsktrkggakasrssrvsrvKLqppqqqhaaaqpE  296
             +K P+L    HLF+  +  K+            +AS               Q    Q  
Sbjct  239  HMKRPML----HLFSGDERVKQSPHTGGASGHTDRASHGQTPGTTNGGTAGGQQIHGQRN  294

Query  297  D--DQLDQLSKILAKLGQTADTISDITARTTEQVDRIDQKVTSVDDRVKKEAKLVQAVLK  354
            D    L++L+  L +L + A+ ++    ++TEQ+ R++Q++T+V+DRV+ + K   A +K
Sbjct  295  DALSDLEKLALALGELEEQANLMNAEAVKSTEQIARVEQRLTAVNDRVQTQTKKANATMK  354

Query  355  A  355
            A
Sbjct  355  A  355

>PITG_18456
Length=351

 Score = 159 bits (402),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 115/355 (32%), Positives = 182/355 (51%), Gaps = 31/355 (9%)

Query  7    KIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEI----YTSKGHPKGSFVL  62
            K   TSCEGYVTKRGH  KSW+ R++V++G  L VSYY+S+            PKG F L
Sbjct  17   KARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYL  76

Query  63   SECEKQD--LSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKN  120
            S  E  +  +   GA+ KPFGFK +GH P +GY E  V+V++  D+ KWL VA NALG  
Sbjct  77   SSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALGAK  136

Query  121  SSPQKSMSQRIEEITGPLLPCASVQLNCPRRDMIHITTLGHKESAGLMQSLEAQMKNVKK  180
               ++   Q I++   P            ++++   +     + A    S + Q++ + K
Sbjct  137  ---RQLTRQAIDQSVSP-----------GKKNLFGFSVSLSPQPA---MSPQKQIQTLSK  179

Query  181  TSQELLQQAINDAKEADRIGDATVNEMVYQEDVLNDAEGTVDTMGRQMDHAEDLGRSLKH  240
            +  ELL QA+ + + A  +G    NE+V Q + L+  E  +  + R +D  + L R LK 
Sbjct  180  SKDELLSQALRELEAAKLVGREACNEIVVQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKS  239

Query  241  PILYKLTHLFtrkksykkggrgsktrkggakasrssrvsrvKLqppqqqhaaaqpEDDQL  300
            P L    HLF      +    GS       ++ +S   S  +L P  +  + A   D  L
Sbjct  240  PTL----HLF--SDDSRPKSTGSSKGSSPQRSHQSGGSSPTRLPPALEISSDAGVSD--L  291

Query  301  DQLSKILAKLGQTADTISDITARTTEQVDRIDQKVTSVDDRVKKEAKLVQAVLKA  355
            ++L++ L +L   A+ ++    R+++Q++RI+  +T+V  RV+K+ K   A L A
Sbjct  292  ERLAQALGELEVQAELLNGEAGRSSQQIERIEHHLTNVTTRVEKQTKQASATLSA  346

>PPTG_17127
Length=351

 Score = 158 bits (400),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 120/358 (34%), Positives = 183/358 (51%), Gaps = 37/358 (10%)

Query  7    KIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSK-EIYTSKGH---PKGSFVL  62
            K   TSCEGYVTKRGH  KSW+ R++V++G  L VSYY+S+   +   G    PKGSF L
Sbjct  17   KARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYL  76

Query  63   SECEKQD--LSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKN  120
            S  E  +  +   GA+ KPFGFK +GH P +GY E  V+V++  D+ KWL VA NAL   
Sbjct  77   SSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL---  133

Query  121  SSPQKSMSQRIEEITGP---LLPCASVQLNCPRRDMIHITTLGHKESAGLMQSLEAQMKN  177
            S  ++   Q I++   P    L   SV L+ P+  M                S + QM+ 
Sbjct  134  SVKRQLTRQAIDQSVSPNKKTLFGFSVALS-PQPAM----------------SPQKQMQT  176

Query  178  VKKTSQELLQQAINDAKEADRIGDATVNEMVYQEDVLNDAEGTVDTMGRQMDHAEDLGRS  237
            + K+  ELL +A+ + + A  +G    NE+V Q + L+  E  +  + R +D  + L R 
Sbjct  177  LAKSKDELLSEALRELEAAKLVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFGDKLLRR  236

Query  238  LKHPILYKLTHLFtrkksykkggrgsktrkggakasrssrvsrvKLqppqqqhaaaqpED  297
            LK P L    HLF      +    G        +  +S   S  +L P     + A   D
Sbjct  237  LKSPTL----HLF--SDDSRPKSTGGSKGSSPQRFHQSGGSSPSRLPPAFDTSSDAGGSD  290

Query  298  DQLDQLSKILAKLGQTADTISDITARTTEQVDRIDQKVTSVDDRVKKEAKLVQAVLKA  355
              L++L++ L +L   A+ ++   + +++Q++RI+  +T+V  RV+K+ K   A L A
Sbjct  291  --LERLAQALGELEVQAEMLNGEASHSSQQIERIEHHLTNVTTRVEKQTKQASATLSA  346

>PYAP_17762
Length=348

 Score = 157 bits (397),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 111/346 (32%), Positives = 177/346 (51%), Gaps = 33/346 (10%)

Query  11   TSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGH-PKGSFVLSECEKQD  69
            TSCEGYVTKRGH  KSW+ R++VLNG  LLVSYYDSKE+  + G  PKGSF LS  EK +
Sbjct  30   TSCEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHE  89

Query  70   --LSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSPQKSM  127
              +   GA  KPFGFK +GH P +GY E  ++VE+  D  KWL V  NAL  +++ + + 
Sbjct  90   YYVGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNAL--DAAKKLTR  147

Query  128  SQRIEEITGPLLPCASVQLNCPRRDMIHITTLGHKESAGLMQSLEAQMKNVKKTSQELLQ  187
            + + E +              P+      +  G   +    Q    QMK +  T +++L+
Sbjct  148  TGQPEAL-------------APK------SLFGFSPATSPQQ----QMKKMTATKEQMLK  184

Query  188  QAINDAKEADRIGDATVNEMVYQEDVLNDAEGTVDTMGRQMDHAEDLGRSLKHPILYKLT  247
            QAI + + A  IG +   E+  Q + L+     +  +   +D+A+ L R +K+P L    
Sbjct  185  QAIEEIESAKLIGRSACQEIFIQGERLDHIGQELAHVEGDLDYADKLLRHMKNPGL----  240

Query  248  HLFtrkksykkggrgsktrkggakasrssrvsrvKLqppqqqhaaaqpEDDQLDQLSKIL  307
            H+F+     +    G          S  S  +R  +           P  D +++L+ +L
Sbjct  241  HMFSSDARDRAKNTGRTKPSSRDTPSAVSEETRAAILSDSHDAVGGAPLSD-IERLASLL  299

Query  308  AKLGQTADTISDITARTTEQVDRIDQKVTSVDDRVKKEAKLVQAVL  353
             +L Q A  +++   + T QV+R+ +++  V++RVK + +   A +
Sbjct  300  GELEQQATLLNEEAIKGTAQVERVGEQLAHVNERVKAQTRKANASI  345

>PYVX_18171
Length=294

 Score = 149 bits (375),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/246 (35%), Positives = 126/246 (51%), Gaps = 27/246 (11%)

Query  8    IHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEK  67
            +  TSCEGYVTKRGH  KSW+ RY+VL+G  L V+Y++SK  + +    KG F LS  +K
Sbjct  9    VRPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDK  68

Query  68   Q-----DLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSS  122
                   +   GA  KPFGFK +GH P +GY E  ++VE+  D TKWL VAHNAL     
Sbjct  69   HAYVAGGMGAVGAQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNAL----E  124

Query  123  PQKSMSQRIEEITGPLLPCASVQLNCPRRDMIHITTLGHKESAGLMQSLEAQMKNVKKTS  182
               +MS++     G          +   + +   +T           S + Q+K +  + 
Sbjct  125  SAAAMSRKAAGDGGG---------SATTKSLFGFST---------TTSPQQQLKAMSVSK  166

Query  183  QELLQQAINDAKEADRIGDATVNEMVYQEDVLNDAEGTVDTMGRQMDHAEDLGRSLKHPI  242
             ELL+ A+ + + A  IG     EMV Q + L+  E  +  +   +D+ + L R LK P+
Sbjct  167  DELLKDALRELEGAKLIGREACTEMVVQGEKLDGIEANLGGIESDLDYGDKLLRRLKSPV  226

Query  243  LYKLTH  248
            L+ L  
Sbjct  227  LHLLAR  232

>PHALS_06478
Length=345

 Score = 146 bits (369),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 109/360 (30%), Positives = 178/360 (49%), Gaps = 47/360 (13%)

Query  7    KIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSK-EIYTSKGH---PKGSFVL  62
            K   TSCEGYVTKRGH  KSW+ R++VL+G  L V+YY+S+   +   G    PKGSF L
Sbjct  17   KAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYL  76

Query  63   SECEKQD--LSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNAL-GK  119
            S  E  +  +   GA+ +PFGFK +GH P +G+ E  V+VE+Q D+ KWL VA NAL  K
Sbjct  77   SNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAK  136

Query  120  NSSPQKSMSQRI----EEITGPLLPCASVQLNCPRRDMIHITTLGHKESAGLMQSLEAQM  175
                ++++ Q +    +++ G  +P ++  +  P++                      QM
Sbjct  137  RQLTRQAIDQSVSPNKKKLFGFSVPSSTQPVMSPQK----------------------QM  174

Query  176  KNVKKTSQELLQQAINDAKEADRIGDATVNEMVYQEDVLNDAEGTVDTMGRQMDHAEDLG  235
            + +  + + LL +A+ + + A  +G    NE+V Q + L+  E  +  + R +D  + L 
Sbjct  175  QTLATSKEGLLLEALREIEAAKLVGREACNEIVNQGEKLDVIEQDLSAIDRDLDFGDKLL  234

Query  236  RSLKHPILYKLTHLFtrkksykkggrgsktrkggakasrssrvsrvKLqppqqqhaaaqp  295
              LK P L    H F                  G     S   S  +L P  +    A  
Sbjct  235  HRLKSPTL----HFF--------SDDTRPKVPLGDHPHHSGSTSPSRLIPAIEITRDAGV  282

Query  296  EDDQLDQLSKILAKLGQTADTISDITARTTEQVDRIDQKVTSVDDRVKKEAKLVQAVLKA  355
             D  L +L++ L +L   A+ ++  +  +++Q++RI+  ++ V +RV+K+ K   A L A
Sbjct  283  SD--LQRLAQALGELEVQAELLNSESGHSSQQIERIEHHLSHVTERVEKQTKQAVATLSA  340

>CCA18899
Length=343

 Score = 139 bits (350),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 98/352 (28%), Positives = 172/352 (49%), Gaps = 33/352 (9%)

Query  4    NLSKIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSK-GHPKGSFVL  62
            +L++   TSCEGYVTKRGH  KSW+ RY+V++G  + VSYY+SK+   SK   PKGSF+L
Sbjct  9    HLARYTPTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYESKDSSKSKNATPKGSFIL  68

Query  63   SECEKQD-----LSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNAL  117
               EK +     +       KPFGFK +GH P QGY E  V+V+S  D  +WL+V +N L
Sbjct  69   QSAEKHEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGL  128

Query  118  GKNSSPQKSMSQRIEEITGPLLPCASVQLNCPRRDMIHITTLGHKESAGLMQSLEAQMKN  177
                   K M++  E     +    SV         +  + +G         + + Q++ 
Sbjct  129  ----KASKCMAR--EAFMAEMDTTKSV---------LGFSYIG--------TTSKQQIQV  165

Query  178  VKKTSQELLQQAINDAKEADRIGDATVNEMVYQEDVLNDAEGTVDTMGRQMDHAEDLGRS  237
            +K    + + +A+   + A   G+A  +E+V Q + L   E  + T+   ++H+E L +S
Sbjct  166  LKSKKCDYIHEALQQIEMAKSAGNAACDEIVSQGEQLGKVEQNLSTIQNDLNHSEKLIKS  225

Query  238  LKHPILYKLTHLFtrkksykkggrgsktrkggakasrssrvsrvKLqppqqqhaaaqpED  297
            ++HP+ Y     F+R + + +      +    +           K +         +   
Sbjct  226  IRHPLRY----FFSRSRPHDRATISKSSSIHRSHHHPGILHKTKKDRNVDHLAEEIRVPT  281

Query  298  DQLDQLSKILAKLGQTADTISDITARTTEQVDRIDQKVTSVDDRVKKEAKLV  349
            + +++L+  L  L   A  I+    ++ EQ+ RI+ +++ ++DR++ +   V
Sbjct  282  NDIEKLAMALKDLEVQAQLINSEAVKSNEQIARIEGQLSGINDRIQAQTSQV  333

>PYIW_19971
Length=348

 Score = 130 bits (328),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 107/360 (30%), Positives = 160/360 (44%), Gaps = 47/360 (13%)

Query  7    KIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECE  66
            K   TSCEGYVTKRGH  KSW+ RY+V NG  L  +        T    PKGSF +S  E
Sbjct  21   KFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQAAGGGGASPAT----PKGSFFVSSVE  76

Query  67   KQD--LSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGK----N  120
            K +  +   G   KPFGFK +GH P +GY E  ++VE+  D  KW+ V  NAL       
Sbjct  77   KHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKHT  136

Query  121  SSPQKSMSQRIEEITGPLLPCASVQLNCPRRDMIHITTLGHKESAGLMQSLEAQMKNVKK  180
             +P  + S   + + G      S QL                           Q+K +  
Sbjct  137  RTPGAADSSTTKNMFG-FSATVSPQL---------------------------QVKKLAA  168

Query  181  TSQELLQQAINDAKEADRIGDATVNEMVYQEDVLNDAEGTVDTMGRQMDHAEDLGRSLKH  240
            T +ELL+ A+ + + A  IG   V+++  Q   LN  E  +  +   +DH   L   +K 
Sbjct  169  TKEELLRDALREIEGAKLIGREAVSDIKGQGGKLNMIEDDLGKVESDLDHGGKLLNHMKR  228

Query  241  PILYKLTHLFtrkksykkggrgsktrkggakasrssrvsrvKLqppqqqhaaaqpEDD--  298
            P+L    HLF+     K     S +          +  S           A    + D  
Sbjct  229  PML----HLFSNDNRSKPNAHHSGSHSDHKDGHSGAHPSSGGSSAETATGAQHHQQQDTS  284

Query  299  ---QLDQLSKILAKLGQTADTISDITARTTEQVDRIDQKVTSVDDRVKKEAKLVQAVLKA  355
                L++L   L +L + A  ++    ++TEQ+ R++Q++T+V+DRV+ + K   A +KA
Sbjct  285  VMSDLERLVLALGELEEQATAMNAEAVKSTEQIARVEQRLTAVNDRVQAQTKKATATMKA  344

>PHYKE_8393
Length=326

 Score = 121 bits (304),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 102/351 (29%), Positives = 159/351 (45%), Gaps = 48/351 (14%)

Query  7    KIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECE  66
            K   TSCEGYVTKRGH            +G+T                H KGSF LS   
Sbjct  17   KARPTSCEGYVTKRGHFPCHPP------HGET--------------PAH-KGSFYLSNIA  55

Query  67   KQD--LSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSPQ  124
              +  +   GA+ KPFGFK +GH P +GY E  V+VE+  D+ KWL VA NALG     +
Sbjct  56   PHEYVVGVMGAADKPFGFKMVGHAPRKGYVELDVFVETLSDRNKWLEVARNALGAK---R  112

Query  125  KSMSQRIEEITGPLLPCASVQLNCPRRDMIHITTLGHKESAGLMQSLEAQMKNVKKTSQE  184
            + M Q I++   P            ++ M      G   S   +   + Q++ +    +E
Sbjct  113  QIMRQAIDQSVSPT-----------KKGMF---GFGLSLSPQPLVPPQKQIQALTHNKEE  158

Query  185  LLQQAINDAKEADRIGDATVNEMVYQEDVLNDAEGTVDTMGRQMDHAEDLGRSLKHPILY  244
            LL +A+ + + A  +G    NE+V Q + L+  E  +  + R +D  + L R LK+P L 
Sbjct  159  LLAEALRELEAAKMVGREACNEIVVQGEKLDSVEHDLHAIDRDLDFGDKLLRRLKNPTL-  217

Query  245  KLTHLFtrkksykkggrgsktrkggakasrssrvsrvKLqppqqqhaaaqpEDDQLDQLS  304
               HLF    S     +        +            +  P    +A   +   L++L+
Sbjct  218  ---HLF----SDDTRPKSHANSNESSPQRTHQSAGSNPIHLPFSMGSANDADASDLERLA  270

Query  305  KILAKLGQTADTISDITARTTEQVDRIDQKVTSVDDRVKKEAKLVQAVLKA  355
              L +L   A+ ++    R+T+Q+ RI+Q++++V  RV+K+ K   A L A
Sbjct  271  HALGELELQAELLNGEAGRSTQQIARIEQQLSNVTARVEKQTKQASATLSA  321

>PYAR_13570
Length=322

 Score = 110 bits (275),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 76/239 (32%), Positives = 115/239 (48%), Gaps = 43/239 (18%)

Query  24   MKSWKRRYMVLNGDTLLVSYYDSKEIYTSKG-HPKGSFVLSECEKQD--LSDEGASVKPF  80
            + SW+ RY+VLNG  L VSY+DSK++  + G  PKGSF LS  EK +  +   GA  KPF
Sbjct  6    LPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPF  65

Query  81   GFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSPQKSMSQRIEEITGPLLP  140
            GFK +GH P +GY E  ++VES+ D  KWL V  +AL       +S           L  
Sbjct  66   GFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRS----------GLSD  115

Query  141  CASVQLNCPRRDMIHITTLGHKESAGLMQSLEAQMKNVKKTSQELLQQAINDAKEADRIG  200
             AS +           +  G   +     S + Q++ +  + +ELL+QAI++ + A  +G
Sbjct  116  AASTK-----------SLFGFSPAT----SPQKQIQKLSASKEELLKQAIDEIESAKLMG  160

Query  201  DATVNEMVYQ---------------EDVLNDAEGTVDTMGRQMDHAEDLGRSLKHPILY  244
                 E+V Q                + L+  E  +  +   +D+ + L   LK P+LY
Sbjct  161  REACQEIVVQGVRKRGRLTSGFSLHAEKLDHIESELQRVDADLDYGDKLLSHLKSPLLY  219

>CCI45123
Length=301

 Score = 91.3 bits (225),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 79/317 (25%), Positives = 145/317 (46%), Gaps = 32/317 (10%)

Query  41   VSYYDSKEIYTSK-GHPKGSFVLSECEKQD-----LSDEGASVKPFGFKFIGHCPGQGYK  94
            VSYY+SK+ Y ++   PKGSF+L   EK +     +       +PFGFK +GH P QGY 
Sbjct  3    VSYYESKDSYKNRNATPKGSFILQNVEKHEYWISRMVTGSVKERPFGFKMVGHAPKQGYV  62

Query  95   EYSVYVESQIDQTKWLNVAHNALGKNSSPQKSMSQRIEEITGPLLPCASVQLNCPRRDMI  154
            E  V+V+S  +  +WL+V +N L  N    K M++  E     +     V          
Sbjct  63   ELDVFVDSLSNMDQWLDVINNGLKAN----KRMAR--EAFMAEMDTTKGV----------  106

Query  155  HITTLGHKESAGLMQSLEAQMKNVKKTSQELLQQAINDAKEADRIGDATVNEMVYQEDVL  214
                LG    AG   + + Q+K +K    + + +A+   + A   G A  +E+V Q + L
Sbjct  107  ----LGF-SFAGT--TSKQQVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQL  159

Query  215  NDAEGTVDTMGRQMDHAEDLGRSLKHPILYKLTHLFtrkksykkggrgsktrkggakasr  274
               E  +  +   ++H+E L +S++HP+ Y  +     +K        +           
Sbjct  160  GKVEQNLSNIESDLNHSEKLIKSIRHPLRYFFSKTHHHEKDAMSKNNTNHRSHHHQTGIL  219

Query  275  ssrvsrvKLqppqqqhaaaqpEDDQLDQLSKILAKLGQTADTISDITARTTEQVDRIDQK  334
              R +  K++   ++        + L++L+  L +L   A  I+    ++ +Q+ RI+ +
Sbjct  220  HMRKNDGKIEHVAEEICVPT---NDLEKLAMALKELEVQAQLINSEAVKSNDQITRIEGQ  276

Query  335  VTSVDDRVKKEAKLVQA  351
            ++ ++DR++ +   V A
Sbjct  277  LSGINDRIQSQTTQVVA  293

>PPTG_18898
Length=1559

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 60/106 (57%), Gaps = 18/106 (17%)

Query  12   SCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIY-TSKGHPKGSFVLSECEKQDL  70
            SC GY+TK+GH  KSWK+RY +L G+T  +SYY   ++   +KG P    ++ + +K D 
Sbjct  407  SCAGYLTKQGHKRKSWKKRYFILRGNT--ISYYSDYDMANNAKGKPLAEVLVEDVQKWD-  463

Query  71   SDEGASVKPFGFKFIGH--CPGQGYKEYSVYVESQIDQTKWLNVAH  114
                   +PFGF F+ +   P      Y VY ++  ++TKW+N  H
Sbjct  464  ------GEPFGFMFMTNEQVP------YYVYADNDRERTKWMNALH  497

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 45/98 (46%), Gaps = 17/98 (17%)

Query  13   CEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSD  72
            CEGY+TKRGH+  +WK RY  L G+ L   YY S+E    K    G+  + +        
Sbjct  213  CEGYLTKRGHVFTNWKTRYFTLRGNVL--EYYSSEE----KSKKYGAVTVEKVAPWSGEA  266

Query  73   EGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWL  110
             G     F F      P      Y VY  S+ ++++WL
Sbjct  267  HG-----FMFYTTKQIP------YYVYASSEAERSRWL  293

 Score = 43.5 bits (101),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)

Query  12   SCEGYVTKRGHLMKSWKRRYMVLNGDTL  39
            SCEGY+TKRGHL+ S +  Y VLNG +L
Sbjct  307  SCEGYLTKRGHLVPSQRMAYYVLNGTSL  334

>PITG_20562
Length=1559

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 60/106 (57%), Gaps = 18/106 (17%)

Query  12   SCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIY-TSKGHPKGSFVLSECEKQDL  70
            SC GY+TK+GH  KSWK+RY +L G+T  +SYY   ++   +KG P    ++ + +K D 
Sbjct  408  SCAGYLTKQGHKRKSWKKRYFILRGNT--ISYYSDYDMANNAKGKPLAEVLVEDVQKWD-  464

Query  71   SDEGASVKPFGFKFIGH--CPGQGYKEYSVYVESQIDQTKWLNVAH  114
                   +PFGF F+ +   P      Y VY ++  ++TKW+N  H
Sbjct  465  ------GEPFGFMFMTNEQVP------YYVYADNDRERTKWMNALH  498

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 45/98 (46%), Gaps = 17/98 (17%)

Query  13   CEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSD  72
            CEGY+TKRGH+  +WK RY  L G+ L   YY S+E    K    G+  + +        
Sbjct  214  CEGYLTKRGHVFTNWKTRYFTLRGNVL--EYYSSEE----KSKKYGAVTVEKVAPWSGEA  267

Query  73   EGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWL  110
             G     F F      P      Y VY  S+ ++++WL
Sbjct  268  HG-----FMFYTTKQIP------YYVYASSEAERSRWL  294

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 25/35 (71%), Gaps = 0/35 (0%)

Query  5    LSKIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTL  39
            + +  + SCEGY+TKRGHL+ S +  Y VLNG +L
Sbjct  301  MVETEEVSCEGYLTKRGHLVPSQRMAYYVLNGTSL  335

>PYAR_23286
Length=607

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 57/104 (55%), Gaps = 18/104 (17%)

Query  12   SCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYY-DSKEIYTSKGHPKGSFVLSECEKQDL  70
            +C GY+TK+GH  KSWK+RY VL G +  VSYY D     + KG P    V+ + ++ D 
Sbjct  388  ACSGYLTKQGHKRKSWKKRYFVLRGSS--VSYYTDYDTANSPKGKPLAEVVIEDVQRWD-  444

Query  71   SDEGASVKPFGFKFIG--HCPGQGYKEYSVYVESQIDQTKWLNV  112
                   +PFGF F+     P      Y VY +++ ++TKW+N 
Sbjct  445  ------GEPFGFMFMTSEQIP------YYVYADNERERTKWMNA  476

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 45/98 (46%), Gaps = 17/98 (17%)

Query  13   CEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSD  72
            CEG++TKRGH+  +WK RY VL G+ L   Y+  ++    K    GS V+ +        
Sbjct  194  CEGFLTKRGHVFTNWKMRYFVLRGNVL--EYFAGED----KSKRYGSVVVEKVAAWSGEA  247

Query  73   EGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWL  110
             G     F F      P      Y VY  S+ ++ KWL
Sbjct  248  HG-----FMFYTAKQVP------YYVYASSESERAKWL  274

 Score = 41.2 bits (95),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 22/28 (79%), Gaps = 0/28 (0%)

Query  12   SCEGYVTKRGHLMKSWKRRYMVLNGDTL  39
            +CEGY+T+RGHL+ S +  Y VLNG +L
Sbjct  288  TCEGYLTRRGHLVPSQRHAYYVLNGTSL  315

>PYIW_17381
Length=952

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 58/112 (52%), Gaps = 18/112 (16%)

Query  4    NLSKIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTS-KGHPKGSFVL  62
            N +     SC GY+TK+GH  KSWK+RY +L G+  L++Y+   +I  S KG P     +
Sbjct  397  NATAPEPVSCAGYLTKQGHKRKSWKKRYFILRGN--LIAYFTDYDIANSAKGKPLAEVTV  454

Query  63   SECEKQDLSDEGASVKPFGFKFIG--HCPGQGYKEYSVYVESQIDQTKWLNV  112
             + +K D        +PFGF F+     P      Y VY ++  ++ KW+N 
Sbjct  455  EDVQKWD-------GEPFGFMFMTSEQVP------YYVYADNDRERNKWMNA  493

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 47/98 (48%), Gaps = 17/98 (17%)

Query  13   CEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSD  72
            CEG++TKRGH+  +WK RY VL G+ L   Y+  ++    KG   GS  +++        
Sbjct  211  CEGFLTKRGHVFTTWKTRYFVLRGNVL--EYFSGED----KGKRYGSVTVAKVAPWSGEA  264

Query  73   EGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWL  110
             G     F F      P      Y VY  S+ +++KWL
Sbjct  265  HG-----FMFYTTKQVP------YYVYASSEAERSKWL  291

 Score = 42.0 bits (97),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 31/63 (49%), Gaps = 14/63 (22%)

Query  10   QTSCEGYVTKRGHLMKSWKRRYMVLNGDTL--------------LVSYYDSKEIYTSKGH  55
            +  CEGY+T+RGHL+ S +  Y VLNG +L               ++  D K I   +G 
Sbjct  303  EVGCEGYLTRRGHLVPSQRMAYYVLNGTSLRHYADQSAYRENQSAIAEVDVKSIAPWEGE  362

Query  56   PKG  58
            P G
Sbjct  363  PNG  365

>PHYRA_84916
Length=1541

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 58/104 (56%), Gaps = 18/104 (17%)

Query  12   SCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIY-TSKGHPKGSFVLSECEKQDL  70
            SC GY+TK+GH  KSWK+RY +L G+T  +SYY   ++   +KG P    ++ + +K D 
Sbjct  404  SCAGYLTKQGHKRKSWKKRYFILRGNT--ISYYSDYDMANNTKGKPLAEVLVEDVQKWD-  460

Query  71   SDEGASVKPFGFKFIGH--CPGQGYKEYSVYVESQIDQTKWLNV  112
                   +PFGF F+ +   P      Y VY ++  ++ KW+N 
Sbjct  461  ------GEPFGFMFMTNEQVP------YYVYADNDRERNKWMNA  492

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 45/98 (46%), Gaps = 17/98 (17%)

Query  13   CEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSD  72
            CEGY+TKRGHL  +WK RY  L G+ L   YY S+E    K    G+  + +        
Sbjct  210  CEGYLTKRGHLFTNWKTRYFTLRGNVL--EYYSSEE----KSKKYGAVTVEKVAPWSGEA  263

Query  73   EGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWL  110
             G     F F      P      Y VY  S+ ++++WL
Sbjct  264  HG-----FMFYTTKQIP------YYVYASSEGERSRWL  290

 Score = 43.5 bits (101),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)

Query  12   SCEGYVTKRGHLMKSWKRRYMVLNGDTL  39
            SCEGY+TKRGHL+ S +  Y VLNG +L
Sbjct  304  SCEGYLTKRGHLVPSQRMAYYVLNGTSL  331

>PHYSO_361747
Length=1523

 Score = 66.6 bits (161),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 56/104 (54%), Gaps = 18/104 (17%)

Query  12   SCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIY-TSKGHPKGSFVLSECEKQDL  70
            SC GY+TK+GH  KSWK+RY +L G+   +SYY   ++   SKG P    ++ + +K D 
Sbjct  413  SCAGYLTKQGHKRKSWKKRYFILRGNA--ISYYSDYDMANNSKGKPLAEVLVEDVQKWD-  469

Query  71   SDEGASVKPFGFKFIG--HCPGQGYKEYSVYVESQIDQTKWLNV  112
                   +PFGF F+     P      Y VY ++  ++ KW+N 
Sbjct  470  ------GEPFGFMFMTTEQVP------YYVYADNDRERNKWMNA  501

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 46/100 (46%), Gaps = 17/100 (17%)

Query  13   CEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSD  72
            CEGY+TKRGHL  +WK RY  L G+ L   YY S+E    K    G+  + +        
Sbjct  219  CEGYLTKRGHLFTNWKTRYFTLRGNVL--EYYSSEE----KSKKYGAVTVEKVATWSGEA  272

Query  73   EGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNV  112
             G     F F      P      Y VY  S+ ++++WL V
Sbjct  273  HG-----FMFYTTKQIP------YYVYASSESERSRWLRV  301

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 25/35 (71%), Gaps = 0/35 (0%)

Query  5    LSKIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTL  39
            + +  + SCEGY+TKRGHL+ S +  Y VLNG +L
Sbjct  306  MVETEEVSCEGYLTKRGHLVPSQRMAYYVLNGTSL  340

>HYAP_08645
Length=1514

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 75/159 (47%), Gaps = 28/159 (18%)

Query  12   SCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIY-TSKGHPKGSFVLSECEKQDL  70
            SC GY+TK+GH  KSWK+RY +L G+  L+SYY   ++   +KG P    ++ + +  D 
Sbjct  307  SCAGYLTKQGHKRKSWKKRYFILRGN--LISYYSDYDMANNTKGRPLAEVLVEDVQSWD-  363

Query  71   SDEGASVKPFGFKFIGH--CPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSPQ---K  125
                   +PFGF F+ +   P      Y VY ++  ++ KW+N  +        PQ   K
Sbjct  364  ------GEPFGFMFMTNEQVP------YYVYADNDRERNKWMNALNKLNAVEEEPQVDKK  411

Query  126  SMSQRIEEITGPLLPCASVQLNCPRRDMIHITTLGHKES  164
              S     +TG    C +   N      +  TTLG + +
Sbjct  412  RCSNCNAVLTGSRF-CGACGFN------LRGTTLGEQSA  443

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 44/98 (45%), Gaps = 17/98 (17%)

Query  13   CEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSD  72
            CEGY+TKRGHL  +WK RY  L G+ L   YY  +E    K    G+  + +        
Sbjct  113  CEGYLTKRGHLFTNWKTRYFTLRGNVL--EYYSGEE----KSKKYGAVTVEKVATWSGEA  166

Query  73   EGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWL  110
             G     F F      P      Y VY  S+ ++++WL
Sbjct  167  HG-----FMFYTTKQIP------YYVYASSESERSRWL  193

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 23/30 (77%), Gaps = 0/30 (0%)

Query  10   QTSCEGYVTKRGHLMKSWKRRYMVLNGDTL  39
            + SCEGY+TKRGHL+ S +  Y VLNG +L
Sbjct  205  EVSCEGYLTKRGHLVPSQRMAYYVLNGTSL  234

>PYU1_G006347
Length=1095

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 38/109 (35%), Positives = 57/109 (52%), Gaps = 14/109 (13%)

Query  4    NLSKIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTS-KGHPKGSFVL  62
            N +     SC GY+TK+GH  KSWK+RY +L G+  L+SYY   ++  S KG P     +
Sbjct  386  NATAPEPVSCAGYLTKQGHKRKSWKKRYFILRGN--LISYYSDYDLANSAKGKPLAEVAV  443

Query  63   SECEKQDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLN  111
             + +K D        +PFGF F+          Y VY ++  ++ KW+N
Sbjct  444  EDVQKWD-------GEPFGFMFM----TSEQVPYYVYADNDRERNKWMN  481

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 33/101 (33%), Positives = 47/101 (47%), Gaps = 17/101 (17%)

Query  10   QTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQD  69
            +  CEG++TKRGH+  +WK RY VL GD L   Y+  +E    K    GS  +++     
Sbjct  197  EIKCEGFLTKRGHVFTNWKTRYFVLRGDVL--EYFSGEE----KNKKYGSVTVAKVAPWS  250

Query  70   LSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWL  110
                G     F F      P      Y VY  S+ +++KWL
Sbjct  251  GEAHG-----FMFYTTKQIP------YYVYAASEAERSKWL  280

 Score = 41.2 bits (95),  Expect = 0.009, Method: Composition-based stats.
 Identities = 17/30 (57%), Positives = 23/30 (77%), Gaps = 0/30 (0%)

Query  10   QTSCEGYVTKRGHLMKSWKRRYMVLNGDTL  39
            + SCEGY+T+RGHL+ S +  Y VLNG +L
Sbjct  292  EVSCEGYLTRRGHLVPSQRMAYYVLNGASL  321

>PYIR_21589
Length=1568

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 57/112 (51%), Gaps = 18/112 (16%)

Query  4    NLSKIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTS-KGHPKGSFVL  62
            N +     SC GY+TK+GH  KSWK+RY +L G+  L++YY   ++  S KG       +
Sbjct  397  NATAPEPVSCAGYLTKQGHKRKSWKKRYFILRGN--LIAYYPDYDLANSAKGRALAEVTV  454

Query  63   SECEKQDLSDEGASVKPFGFKFIG--HCPGQGYKEYSVYVESQIDQTKWLNV  112
             + +K D        +PFGF F+     P      Y VY ++  ++ KW+N 
Sbjct  455  EDVQKWD-------GEPFGFMFMTSEQVP------YYVYADNDRERNKWMNA  493

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 47/98 (48%), Gaps = 17/98 (17%)

Query  13   CEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSD  72
            CEG++TKRGH+  +WK RY VL G+ L   Y+  ++    KG   GS  +++        
Sbjct  211  CEGFLTKRGHVFTTWKTRYFVLRGNVL--EYFAGED----KGKRYGSVTVAKVAPWSGEA  264

Query  73   EGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWL  110
             G     F F      P      Y VY  S+ +++KWL
Sbjct  265  HG-----FMFYTTKQIP------YYVYAASEAERSKWL  291

 Score = 43.1 bits (100),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 23/30 (77%), Gaps = 0/30 (0%)

Query  10   QTSCEGYVTKRGHLMKSWKRRYMVLNGDTL  39
            + SCEGY+T+RGHL+ S +  Y VLNG +L
Sbjct  303  EVSCEGYLTRRGHLVPSQRMAYYVLNGTSL  332

>SPRG_06059
Length=1312

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 71/152 (47%), Gaps = 27/152 (18%)

Query  6    SKIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSEC  65
            S I   SC GY+TK+GH  KSWKRRY VL G TL  +YY   +    +        L+E 
Sbjct  219  SAIKPISCAGYLTKQGHRRKSWKRRYFVLRGGTL--AYYADYDSMNKQS-------LAEV  269

Query  66   EKQDLSDEGASVKPFGFKFIG--HCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSP  123
              +D++      + FGF+FI     P      Y V+ ES  ++ KW+      +  +S+P
Sbjct  270  GVEDVALWDG--EQFGFQFITTEQVP------YYVFAESDRERQKWMVALQTLVRTHSAP  321

Query  124  QKSMSQRIEEITGPLLPCASVQLNCPR-RDMI  154
                   I  +  P  P +S    CP+ R M+
Sbjct  322  -----LHIPNVLAP--PSSSNAKCCPKCRHMV  346

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 52/188 (28%), Positives = 74/188 (39%), Gaps = 29/188 (15%)

Query  13   CEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSK------EIYTSKGHPKGSFVLSECE  66
            C GY+TKRGH++ +WK R+ VL    +L  Y D        +++  K  P      +   
Sbjct  12   CAGYLTKRGHVVTNWKTRFFVLRPHAILCYYADESMAKKLGQVHLVKVAPWEYVSATTAN  71

Query  67   KQDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWL-------NVAHNA---  116
                S  G+    FGF F           Y VY     ++ KWL        V  NA   
Sbjct  72   SILKSTRGSDEMKFGFMFF----TTKRVAYYVYANVNAERQKWLLALQDLYVVTSNATDC  127

Query  117  ---LGKNSSPQKSMSQRIEE--ITGPLLPCASVQLNCPRRDM----IHITTLGHKESAGL  167
               L K +     +S R +   +TG LL C   +      D+    IHI T+G  E   +
Sbjct  128  EGYLTKRTPGFSFLSSRPKYYVLTGTLLKCYHDEEGYRGHDVPSAKIHIKTVGKWEDGLM  187

Query  168  MQSLEAQM  175
            +QS    M
Sbjct  188  VQSETGSM  195

 Score = 33.1 bits (74),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 29/47 (62%), Gaps = 6/47 (13%)

Query  11   TSCEGYVTKR--GHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGH  55
            T CEGY+TKR  G    S + +Y VL G TLL  Y+D +E Y  +GH
Sbjct  125  TDCEGYLTKRTPGFSFLSSRPKYYVLTG-TLLKCYHD-EEGY--RGH  167

>PHYKE_2479
Length=171

 Score = 58.5 bits (140),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 54/107 (50%), Gaps = 21/107 (20%)

Query  10   QTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQD  69
            ++  EGYVTKRGHL+++WK R+  L G+  LVSYY++K    ++ H KG   ++  +   
Sbjct  72   RSKWEGYVTKRGHLVRNWKMRFFTLEGN--LVSYYENKVDARNRSHLKGRVNVASVKMDK  129

Query  70   LSDEGASVKPFGFKF------IGHCPGQGYKEYSVYVESQIDQTKWL  110
            ++  G     F F F      + HC           V +Q DQ  W+
Sbjct  130  VAKNGHG---FDFSFETTEGKVFHCS----------VPTQFDQLAWV  163

>PYVX_13574
Length=950

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 59/121 (49%), Gaps = 26/121 (21%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDE  73
            EGYVTKRGHL+++WK R+  L G+  LVSYY+SK    ++ H KG   ++  +   ++  
Sbjct  159  EGYVTKRGHLVRNWKMRFFTLEGN--LVSYYESKVDARNRSHLKGRVNVASVKIDKVAKS  216

Query  74   GASVKPFGFKF------IGHCPGQGYKEYSVYVESQIDQTKWL-----NVAHNALGKNSS  122
            G     F F F      + HC           V +Q DQ  W+      V  N + KN+ 
Sbjct  217  GQG---FDFSFETTEGKVFHCS----------VPTQFDQLAWVYYLEAGVDCNNMRKNNK  263

Query  123  P  123
            P
Sbjct  264  P  264

>PHYKE_1990
Length=1499

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 55/104 (53%), Gaps = 18/104 (17%)

Query  12   SCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIY-TSKGHPKGSFVLSECEKQDL  70
            +C GY+TK+GH  KSWK+RY +L G T  +SYY   ++   SKG      ++ + ++ D 
Sbjct  405  ACAGYLTKQGHKRKSWKKRYFILRGST--ISYYSDYDMANNSKGKALAEVLVEDVQRWD-  461

Query  71   SDEGASVKPFGFKFIG--HCPGQGYKEYSVYVESQIDQTKWLNV  112
                   +PFGF F+     P      Y VY ++  ++ KW+N 
Sbjct  462  ------GEPFGFMFMTSEQVP------YYVYADNDRERNKWMNA  493

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 46/98 (47%), Gaps = 17/98 (17%)

Query  13   CEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSD  72
            CEGY+TKRGHL  +WK RY  L G+ L   YY S+E    K    G+ ++ +        
Sbjct  211  CEGYLTKRGHLFTNWKTRYFTLRGNVL--EYYSSEE----KSKKYGAVMVEKVATWSGEA  264

Query  73   EGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWL  110
             G     F F      P      Y VY  S+ +++KWL
Sbjct  265  HG-----FMFYTTKQIP------YYVYASSEAERSKWL  291

 Score = 43.5 bits (101),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 23/30 (77%), Gaps = 0/30 (0%)

Query  10   QTSCEGYVTKRGHLMKSWKRRYMVLNGDTL  39
            + SCEGY+TKRGHL+ S +  Y VLNG +L
Sbjct  303  EVSCEGYLTKRGHLVPSQRMAYYVLNGASL  332

>PYAP_16997
Length=1018

 Score = 60.8 bits (146),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 55/103 (53%), Gaps = 16/103 (16%)

Query  12   SCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLS  71
            +C GY+TK+GH  KSWK+RY VL G+++   + D     ++KG      ++ + ++ D  
Sbjct  401  ACSGYLTKQGHKRKSWKKRYFVLRGNSITY-FTDFDTANSNKGKALAEVIVEDVQRWD--  457

Query  72   DEGASVKPFGFKFIG--HCPGQGYKEYSVYVESQIDQTKWLNV  112
                  +PFGF F+     P      Y VY +++ ++ KW+N 
Sbjct  458  -----GEPFGFMFMTSEQVP------YYVYADNERERGKWMNA  489

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 49/110 (45%), Gaps = 17/110 (15%)

Query  1    MHVNLSKIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSF  60
            M +  S   + +CEG++TKRGH+  +WK RY VL G+ L   Y+   +    K    GS 
Sbjct  195  MSIPESVPGEIACEGFLTKRGHVFTNWKMRYFVLRGNVL--EYFSGDD----KSKRYGSV  248

Query  61   VLSECEKQDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWL  110
            ++ +         G     F F      P      Y VY  S+ ++ KWL
Sbjct  249  IVEKVAPWSGEAHG-----FMFYTTKQVP------YYVYASSEAERAKWL  287

 Score = 40.8 bits (94),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 28/41 (68%), Gaps = 2/41 (5%)

Query  10   QTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIY  50
            + +CEG++T+RGHL+ S +  Y VLNG +L   +Y  ++ Y
Sbjct  299  EVTCEGFLTRRGHLVPSQRFAYYVLNGTSL--RHYADQQAY  337

>SDRG_12762
Length=1392

 Score = 60.8 bits (146),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 56/112 (50%), Gaps = 12/112 (11%)

Query  7    KIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECE  66
            K    +C G++TK+GH  KSWK+RY VL G T+L  + D +   T  G       LSE  
Sbjct  354  KPAPVACAGWLTKQGHKRKSWKKRYFVLRG-TVLSYFADFEAANTRLGK-----ALSEVS  407

Query  67   KQDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALG  118
             +D++     V  F F  + + P      Y V+ +++ DQ KW+     A+G
Sbjct  408  VKDVAPWDGEVCGFMFVTLENVP------YYVFADNERDQAKWMTALKKAVG  453

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 58/121 (48%), Gaps = 29/121 (24%)

Query  13   CEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSD  72
            CEGY+TKRGHL+ S++ RY V+ G   +V YY  +  Y +     G+  L+E E +    
Sbjct  258  CEGYLTKRGHLVPSYRLRYFVMCGS--VVKYYSDETAYRT-----GASALAEIEVKS---  307

Query  73   EGASVKPFGFKFIGHCPGQGYKEYS-----VYVESQIDQTKWLNVAHNALGK--NSSPQK  125
                    G ++ G   G  +K  +     V  E+  D  KW+     ALG+  N +P+ 
Sbjct  308  --------GGRWDGESTGLFFKTATNSTMFVCAENVADLQKWI----EALGRIFNEAPKP  355

Query  126  S  126
            +
Sbjct  356  A  356

 Score = 39.3 bits (90),  Expect = 0.042, Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 39/96 (41%), Gaps = 16/96 (17%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDEG  74
            GY+TKRGH++ +WK R+  L     L SYY+ + +            L E     +S   
Sbjct  164  GYLTKRGHVITNWKTRFFALRSQGRL-SYYNDEGMGKK---------LGEVHVSKVSPWS  213

Query  75   ASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWL  110
                 F F+            Y VY  S  ++ +WL
Sbjct  214  GETNGFMFQTTKQI------SYYVYASSNTERARWL  243

>SPRG_06058
Length=1258

 Score = 60.5 bits (145),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 57/115 (50%), Gaps = 12/115 (10%)

Query  7    KIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECE  66
            K    +C G++TK+GH  KSWK+RY VL G T+L  Y D +   T  G       LS+  
Sbjct  143  KPAPVACAGWLTKQGHKRKSWKKRYFVLRG-TVLSYYADFEAANTRAGK-----ALSDVS  196

Query  67   KQDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNS  121
             +D+         F F  + + P      Y V+ +++ DQ KW++    A+G ++
Sbjct  197  LKDVGPWDGEACGFMFTTLENVP------YYVFADNERDQAKWMSALKKAVGADT  245

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 53/112 (47%), Gaps = 27/112 (24%)

Query  13   CEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSD  72
            CEGY+TKRGHL+ S++ RY V+ G   +V YY  +  Y +     G+  L+E E +    
Sbjct  47   CEGYLTKRGHLVPSYRLRYFVMCGS--VVKYYSDETAYRT-----GASALAEIEVKS---  96

Query  73   EGASVKPFGFKFIGHCPGQGYKEYS-----VYVESQIDQTKWLNVAHNALGK  119
                    G ++ G   G  +K  +     V  E+  D  KW+     ALG+
Sbjct  97   --------GGRWDGESTGLFFKTATNSTMFVCAENVADLQKWI----EALGR  136

>H310_00231
Length=1495

 Score = 60.5 bits (145),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 68/146 (47%), Gaps = 22/146 (15%)

Query  8    IHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYY---DSKEIYTSKGHPKGSFVLSE  64
            +   +C G++TK+GH  KSWK+RY VL G TL  +YY   D+  +  S+  P G   + E
Sbjct  347  VQPIACAGWLTKQGHKRKSWKKRYFVLRGTTL--AYYTDFDASNMRHSR--PLGEVTVRE  402

Query  65   CEKQDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSS--  122
                D        +P GF F+ +        Y V+ +++ DQ KWL         ++S  
Sbjct  403  VSTWD-------GEPGGFMFVTN----DNVPYYVFADNERDQAKWLTALRKLFESSTSVE  451

Query  123  -PQKSMSQRIEEITGPLLPCASVQLN  147
             P+K+  +    +TG    C +   N
Sbjct  452  EPEKTCPRCAYVLTGSRF-CGACGFN  476

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 34/54 (63%), Gaps = 7/54 (13%)

Query  13   CEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECE  66
            CEGY+TKRGHL+ S++ RY VL+G ++   Y+  +  Y S     G+  L+E E
Sbjct  251  CEGYLTKRGHLVPSYRMRYFVLSGASM--KYFADETAYRS-----GASALAEME  297

 Score = 38.9 bits (89),  Expect = 0.059, Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (65%), Gaps = 0/31 (0%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYD  45
            GY+TKRGH++ +WK R+ VL     L  Y D
Sbjct  157  GYLTKRGHVVTNWKTRFFVLRAGGRLSYYAD  187

>SDRG_12763
Length=1317

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 59/117 (50%), Gaps = 20/117 (17%)

Query  6    SKIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSEC  65
            S I   SC GY+TK+GH  KSWKRRY VL G TL  SYY   +    +        L+E 
Sbjct  217  SAIKPISCAGYLTKQGHRRKSWKRRYFVLRGATL--SYYSDYDSMNKQS-------LAEV  267

Query  66   EKQDLSDEGASVKPFGFKFIG--HCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKN  120
              +D++      + FGF+FI     P      Y V+ ES  ++ KW+ VA   L +N
Sbjct  268  GVEDVALWDG--EQFGFQFITTEQVP------YYVFAESDRERQKWM-VALQTLIRN  315

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 52/188 (28%), Positives = 76/188 (40%), Gaps = 29/188 (15%)

Query  13   CEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSK------EIYTSKGHPKGSFVLSECE  66
            C GY+TKRGH++ +WK R+ VL    +L  Y D        +++  K  P   F  +   
Sbjct  10   CAGYLTKRGHVVTNWKTRFFVLRPHAILCYYADDSMVKKLGQVHLVKVAPWEYFSATTGN  69

Query  67   KQDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWL-------NVAHNA---  116
                S  G+    FGF F           Y VY     ++ +WL        V  NA   
Sbjct  70   SVLKSARGSDEMKFGFMFF----TTKRVAYYVYANVNAERQRWLLALQDLYVVTSNATDC  125

Query  117  ---LGKNSSPQKSMSQRIEE--ITGPLLPCASVQLNCPRRDM----IHITTLGHKESAGL  167
               L K +     +S R +   +TG LL C + +      D+    IHI T+G  E   +
Sbjct  126  EGYLTKRTPGFSFLSSRPKYYVLTGTLLKCYNDEEGYRGHDVPSAKIHIKTVGKWEDGLM  185

Query  168  MQSLEAQM  175
            +QS    M
Sbjct  186  VQSETGSM  193

 Score = 31.6 bits (70),  Expect = 9.8, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 28/47 (60%), Gaps = 6/47 (13%)

Query  11   TSCEGYVTKR--GHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGH  55
            T CEGY+TKR  G    S + +Y VL G TLL  Y D +E Y  +GH
Sbjct  123  TDCEGYLTKRTPGFSFLSSRPKYYVLTG-TLLKCYND-EEGY--RGH  165

>PYVX_20438
Length=1346

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 54/104 (52%), Gaps = 18/104 (17%)

Query  12   SCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTS-KGHPKGSFVLSECEKQDL  70
            +C GY+TK+GH  KSWK+RY +L G +  +SY+   E+  S KG       + + ++ D 
Sbjct  318  ACAGYLTKQGHKRKSWKKRYFILRGTS--ISYFADFEMANSAKGKALAEVTVEDVQRWD-  374

Query  71   SDEGASVKPFGFKFIG--HCPGQGYKEYSVYVESQIDQTKWLNV  112
                   +PFGF F+     P      Y VY ++  ++ KW+N 
Sbjct  375  ------GEPFGFMFMTSEQVP------YYVYADNDRERNKWMNA  406

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/98 (32%), Positives = 45/98 (46%), Gaps = 17/98 (17%)

Query  13   CEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSD  72
            CEGY+TKRGH+  +WK RY  L G+ L   Y+ S +    K    G+  +++        
Sbjct  123  CEGYLTKRGHVFTNWKTRYFTLRGNVL--EYFASDD----KSKKYGAVTVAKVAPWSGEA  176

Query  73   EGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWL  110
             G     F F      P      Y VY  S++++ KWL
Sbjct  177  HG-----FMFYTTKQIP------YYVYASSEVERAKWL  203

 Score = 42.0 bits (97),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 24/34 (71%), Gaps = 1/34 (3%)

Query  12   SCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYD  45
            SCEGY+TKRGHL+ S +  Y VL G T+L  Y D
Sbjct  218  SCEGYLTKRGHLVPSQRMAYYVLTG-TMLRHYAD  250

>CCA18875
Length=1514

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 56/107 (52%), Gaps = 16/107 (15%)

Query  8    IHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEK  67
            +   +C GY+TK+GH  KSWK+RY +L G+  ++SYY     Y    H KG   L+E + 
Sbjct  413  VEPVTCAGYLTKQGHKRKSWKKRYFILRGN--IISYYQD---YDLANHVKGK-ALAEVQV  466

Query  68   QDLSDEGASVKPFGFKFIG--HCPGQGYKEYSVYVESQIDQTKWLNV  112
            +D+         FGF F+     P      Y VY +++ ++ KW++ 
Sbjct  467  EDVQKWDGEA--FGFMFMTTEQVP------YYVYADNERERKKWMSA  505

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 47/97 (48%), Gaps = 17/97 (18%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDE  73
            EGY+TKRGH+  +WK R+ VL+G+ L   YY S+E    K    GS V+++         
Sbjct  223  EGYLTKRGHVFTNWKTRFFVLSGNVL--EYYSSEE----KTKRYGSVVVAKVAPWSGEAH  276

Query  74   GASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWL  110
            G     F F      P      Y VY  S+ ++ KWL
Sbjct  277  G-----FMFYTTKQIP------YYVYAASETEKAKWL  302

 Score = 39.7 bits (91),  Expect = 0.034, Method: Compositional matrix adjust.
 Identities = 29/112 (26%), Positives = 52/112 (46%), Gaps = 15/112 (13%)

Query  10   QTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQD  69
            + +CEGY+T+RGHL+ S +  Y VL+G  L   +Y  ++ Y           ++E E + 
Sbjct  314  EVTCEGYLTRRGHLVPSQRVCYYVLSGTCL--RHYADQQAYRDNDS-----AMAEVEVRS  366

Query  70   LSDEGASVKPFGFK-FIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKN  120
            ++   A V    FK   G+        +    E++ ++ +W+    N L  N
Sbjct  367  IAAWDAEVNGLMFKTMTGNV-------FYASTETETERQRWVFNHTNTLTTN  411

>PYIW_13172
Length=939

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 53/103 (51%), Gaps = 21/103 (20%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDE  73
            EGYVTKRGHL+++WK R+  L G+ L  SYY+SK    ++ H KG   ++  + + +S  
Sbjct  150  EGYVTKRGHLVRNWKNRFFTLEGNNL--SYYESKVDARNRNHLKGRVNVASVKIEKVSKS  207

Query  74   GASVKPFGFKF------IGHCPGQGYKEYSVYVESQIDQTKWL  110
            G     F F F      + HC           V +Q++Q  W+
Sbjct  208  GHG---FDFAFETSEGKVFHCS----------VPTQMEQLSWI  237

>PYIR_15309
Length=937

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 53/103 (51%), Gaps = 21/103 (20%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDE  73
            EGYVTKRGHL+++WK R+  L G+ L  SYY+SK    ++ H KG   ++  + + +S  
Sbjct  148  EGYVTKRGHLVRNWKNRFFTLEGNNL--SYYESKVDARNRSHLKGRVNVASVKVEKVSKS  205

Query  74   GASVKPFGFKF------IGHCPGQGYKEYSVYVESQIDQTKWL  110
            G     F F F      + HC           V +Q++Q  W+
Sbjct  206  GHG---FDFSFETSEGKVFHCS----------VPTQMEQLSWV  235

>H257_06722
Length=1482

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 36/99 (36%), Positives = 48/99 (48%), Gaps = 12/99 (12%)

Query  12   SCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLS  71
            +C G++TK+GH  KSWK+RY VL G+T L  Y D        G P G   + E    D  
Sbjct  351  ACAGWLTKQGHKRKSWKKRYFVLRGNT-LAYYTDFDASNLRHGKPLGEVTVREVSAWD--  407

Query  72   DEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWL  110
                  +P GF FI +        Y V+ ++  DQ KWL
Sbjct  408  -----GEPSGFMFITN----DSVPYYVFADNDRDQAKWL  437

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 33/54 (61%), Gaps = 7/54 (13%)

Query  13   CEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECE  66
            CEGY+TKRGHL+ S++ RY VL G T  + YY  +  Y S     G+  L+E E
Sbjct  251  CEGYLTKRGHLVPSYRMRYFVLCGST--IKYYADETAYRS-----GASALAEME  297

 Score = 36.6 bits (83),  Expect = 0.25, Method: Composition-based stats.
 Identities = 15/31 (48%), Positives = 20/31 (65%), Gaps = 0/31 (0%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYD  45
            GY+TKRGH++ +WK R+ VL     L  Y D
Sbjct  157  GYLTKRGHVVTNWKTRFFVLRAGGRLSYYAD  187

>PHYCA_503112
Length=214

 Score = 55.8 bits (133),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 52/97 (54%), Gaps = 9/97 (9%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDE  73
            EGYVTKRGHL+++WK R+  L G+  LVSYY++K    ++ H KG   ++  +   ++  
Sbjct  117  EGYVTKRGHLVRNWKSRFFTLEGN--LVSYYENKVDARNRSHLKGRVNVASVKMDKVAKN  174

Query  74   GASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWL  110
            G      GF F      +G K +   V +  DQ  W+
Sbjct  175  G-----HGFDFSFETT-EG-KVFYCSVPTHFDQLAWV  204

>PHALS_06533
Length=930

 Score = 57.0 bits (136),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 52/105 (50%), Gaps = 21/105 (20%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDE  73
            EGYVTKRGHL+++WK R+  L G+  LVSYY++K    ++ H KG   ++  +   ++  
Sbjct  111  EGYVTKRGHLVRNWKMRFFTLEGN--LVSYYENKVEARNRSHLKGRVNVASVKVDKVAKN  168

Query  74   GASVKPFGFKF------IGHCPGQGYKEYSVYVESQIDQTKWLNV  112
            G     F F F      + HC           V +  DQ  W++ 
Sbjct  169  GHG---FDFSFETTEGKVFHCS----------VPTHFDQLAWVHF  200

>CCI44752
Length=1526

 Score = 57.4 bits (137),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 56/107 (52%), Gaps = 16/107 (15%)

Query  8    IHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEK  67
            +   +C GY+TK+GH  KSWK+RY +L G+  ++SYY     Y    + KG   L+E + 
Sbjct  413  VEPVACAGYLTKQGHKRKSWKKRYFILRGN--IISYYQD---YDLANNAKGK-ALAEVQV  466

Query  68   QDLSDEGASVKPFGFKFIG--HCPGQGYKEYSVYVESQIDQTKWLNV  112
            +D+         FGF F+     P      Y VY +++ ++ KW++ 
Sbjct  467  EDVQKWDGEA--FGFMFMTTEQVP------YYVYADNERERKKWMSA  505

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 48/97 (49%), Gaps = 17/97 (18%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDE  73
            EGY+TKRGH+  +WK R+ VL+G+ L   YY S+E    K    GS V+++         
Sbjct  223  EGYLTKRGHVFTNWKTRFFVLSGNVL--EYYSSEE----KTKRYGSVVVAKVAPWSGEAH  276

Query  74   GASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWL  110
            G     F F      P      Y VY  S+ ++TKWL
Sbjct  277  G-----FMFYTTKQIP------YYVYAASEAEKTKWL  302

 Score = 38.5 bits (88),  Expect = 0.072, Method: Compositional matrix adjust.
 Identities = 29/113 (26%), Positives = 53/113 (47%), Gaps = 15/113 (13%)

Query  10   QTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQD  69
            + +CEGY+T+RGHL+ S +  Y VL+G T L  Y D       + +      ++E E + 
Sbjct  314  EVTCEGYLTRRGHLVPSQRVCYYVLSG-TYLRHYAD------QQAYRDNDSAMAEVEIRS  366

Query  70   LSDEGASVKPFGFK-FIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNS  121
            ++   A V    FK   G+        +    E++ ++ +W++   N    N+
Sbjct  367  IAAWDAEVNGLMFKTMTGNV-------FYASTETESERQRWVSNHSNTTTSNT  412

>PYU1_G001063
Length=783

 Score = 57.0 bits (136),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 57/121 (47%), Gaps = 26/121 (21%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDE  73
            EGYVTKRGHL+++WK R+  L G  L  SYY+SK    ++ H KG   ++  + +  S  
Sbjct  147  EGYVTKRGHLVRNWKNRFFTLEGTNL--SYYESKVDARNRSHLKGRVQVASVKLEKTSKS  204

Query  74   GASVKPFGFKF------IGHCPGQGYKEYSVYVESQIDQTKWL-----NVAHNALGKNSS  122
            G     F F F      + HC           V ++ DQ  W+      V  + + KNS 
Sbjct  205  GHG---FDFSFETSEGKVFHCS----------VPTKFDQLTWVYFLEAGVDCSNMRKNSK  251

Query  123  P  123
            P
Sbjct  252  P  252

>SPRG_05449
Length=723

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 53/100 (53%), Gaps = 10/100 (10%)

Query  13   CEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSD  72
             EG+V+K+GHL+++WK RY  L  +  L+SYY+SKE    + H KG   L+  +      
Sbjct  65   WEGFVSKKGHLVRNWKLRYFTLESN--LLSYYESKEDARKRRHLKGRVHLTRVQII----  118

Query  73   EGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNV  112
            EG S   + F F      Q  K + V   +++DQ  W+ V
Sbjct  119  EGKSAHGYDFTF----DTQEGKPFHVSTTTELDQIAWVKV  154

>PHYRA_77834
Length=936

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 51/103 (50%), Gaps = 21/103 (20%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDE  73
            EGYVTKRGHL+++WK R+  L G+  LVSYY++K    ++ H KG   ++  +   ++  
Sbjct  119  EGYVTKRGHLVRNWKMRFFTLEGN--LVSYYENKVDARNRSHLKGRVNVASVKVDKVAKN  176

Query  74   GASVKPFGFKF------IGHCPGQGYKEYSVYVESQIDQTKWL  110
            G     F F F      + HC           V +  DQ  W+
Sbjct  177  GHG---FEFSFETTEGKVFHCS----------VPTHFDQLAWV  206

>PYAR_19914
Length=788

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 60/115 (52%), Gaps = 14/115 (12%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDE  73
            EGYVTKRGHL+++WK R+  L G+ L  SYY++K    ++ H KG   +   + + +S  
Sbjct  146  EGYVTKRGHLVRNWKNRFFTLEGNNL--SYYENKVDARNRDHLKGRVNVVSVKAEKVSKS  203

Query  74   GASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWL-----NVAHNALGKNSSP  123
            G     F F  +     +G K +   V ++ ++  W+      V H+A  KN+ P
Sbjct  204  GHGFD-FSFDTV-----EG-KTFHCSVPTETERLMWVYFLEAGVDHSATKKNNKP  251

>SDRG_08800
Length=881

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 52/100 (52%), Gaps = 10/100 (10%)

Query  13   CEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSD  72
             EG+V+K+GHL+++WK RY  L  +  L+SYY+SKE    + H KG   L+         
Sbjct  65   WEGFVSKKGHLVRNWKLRYFTLESN--LLSYYESKEDARKRRHLKGRVHLTRVHII----  118

Query  73   EGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNV  112
            EG S   + F F      Q  K + V   +++DQ  W+ V
Sbjct  119  EGKSAHGYDFTF----DTQEGKPFHVSTTTELDQIAWVKV  154

>PPTG_13401
Length=927

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 52/97 (54%), Gaps = 9/97 (9%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDE  73
            EGYVTKRGHL+++WK R+  L G+  LVSYY++K    ++ H KG   ++  +   ++  
Sbjct  109  EGYVTKRGHLVRNWKMRFFTLEGN--LVSYYENKVDARNRSHLKGRVNVASVKMDKVAKN  166

Query  74   GASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWL  110
            G      GF F      +G K +   V +  DQ  W+
Sbjct  167  G-----HGFDFSFET-TEG-KVFYCSVPTHFDQIAWV  196

>PITG_18067
Length=924

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 52/97 (54%), Gaps = 9/97 (9%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDE  73
            EGYVTKRGHL+++WK R+  L G+  LVSYY++K    ++ H KG   ++  +   ++  
Sbjct  109  EGYVTKRGHLVRNWKMRFFTLEGN--LVSYYENKVDARNRSHLKGRVNVASVKMDKVAKN  166

Query  74   GASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWL  110
            G      GF F      +G K +   V +  DQ  W+
Sbjct  167  GH-----GFDFSFET-TEG-KVFYCSVPTHFDQLAWV  196

>PHYRA_82543
Length=1199

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/109 (28%), Positives = 57/109 (52%), Gaps = 12/109 (11%)

Query  9    HQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQ  68
            H+   EGYV K+G  +  W+ RY++L+G TL  +YY+SKE   S  + +G  ++S+   +
Sbjct  56   HEVHWEGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARNLRGRMIISKVRPE  113

Query  69   DLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNAL  117
            +        K  GF        QG+K + +   +++++  W+ +   A+
Sbjct  114  NYG------KAHGFLL----ETQGHKHFHLCCATELEKDMWVEMMQAAI  152

>PHYSO_544598
Length=1163

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/109 (28%), Positives = 57/109 (52%), Gaps = 12/109 (11%)

Query  9    HQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQ  68
            H+   EGYV K+G  +  W+ RY++L+G TL  +YY+SKE   S  + +G  ++S+   +
Sbjct  14   HEVHWEGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARNLRGRMIISKVRPE  71

Query  69   DLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNAL  117
            +        K  GF        QG+K + +   +++++  W+ +   A+
Sbjct  72   NYG------KAHGFLL----ETQGHKHFHLCCSTELEKDMWVEMMQAAI  110

>PPTG_19371
Length=1195

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/109 (28%), Positives = 57/109 (52%), Gaps = 12/109 (11%)

Query  9    HQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQ  68
            H+   EGYV K+G  +  W+ RY++L+G TL  +YY+SKE   S  + +G  ++S+   +
Sbjct  66   HEVHWEGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARNLRGRMIISKVRPE  123

Query  69   DLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNAL  117
            +        K  GF        QG+K + +   +++++  W+ +   A+
Sbjct  124  NYG------KAHGFLI----ETQGHKHFHLCCTTELEKDMWVEMMQAAI  162

>CCI41225
Length=981

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/111 (32%), Positives = 52/111 (47%), Gaps = 21/111 (19%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDE  73
            EGYVTKRGHL+++WK R+  L G+ L  SYY+SK     + H KG   ++      +S  
Sbjct  140  EGYVTKRGHLVRNWKMRFFTLEGNRL--SYYESKVDAQQRAHLKGRVKVASVRIDQVSKW  197

Query  74   GASVKPFGFKF------IGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALG  118
            G+    + F F      I HC           V + ++Q  W+      +G
Sbjct  198  GSG---YEFTFSTTEGKIFHCS----------VSTPLEQVLWVYFLEAGIG  235

>PYAP_17290
Length=835

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 60/120 (50%), Gaps = 22/120 (18%)

Query  13   CEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSD  72
             EGYVTKRGHL+++WK R+  L G+ L  SYY++K    ++ H KG   ++  +   +S 
Sbjct  152  WEGYVTKRGHLVRNWKMRFFTLEGNNL--SYYENKVDARNRDHLKGRVNVASVKLDKVSK  209

Query  73   EGASVKPFGFKF----IGHCPGQGYKEYSVYVESQIDQTKWL-----NVAHNALGKNSSP  123
             G     F F+     + HC           V ++++Q  W+      +  NA+ +N+ P
Sbjct  210  SGHG-HDFSFETTEGKVFHCS----------VPTEMEQLAWVYFLEAGIDSNAMKRNNKP  258

>CCA17102
Length=884

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 50/99 (51%), Gaps = 9/99 (9%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDE  73
            EGYV KRGHL+++WK R+  L G+ L  SYY+SK     + H KG   L+    + +S  
Sbjct  110  EGYVIKRGHLVRNWKMRFFTLEGNRL--SYYESKGDAQQRVHLKGRVKLASVRIEAVSRL  167

Query  74   GASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNV  112
            G      GF F         K +   V +++DQ  W++ 
Sbjct  168  GN-----GFDFTFETAES--KVFHCSVPTKLDQLLWIHF  199

>PYAP_22646
Length=815

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 32/124 (26%), Positives = 63/124 (51%), Gaps = 18/124 (15%)

Query  8    IHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIY---TSKGHPKGSFVLSE  64
            + +T  EGY+ K+GH+++SW+ RY +L+G T   SYY SK++    T K   +G   ++ 
Sbjct  97   MFETDWEGYIWKQGHVVRSWRYRYAILSGTTF--SYYISKDVAMLDTEKY--RGRVSVTG  152

Query  65   CEKQDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSPQ  124
             ++ D    G  +               +K +++Y  + ++   W+ +   A+   S+P+
Sbjct  153  AKRDDSRTNGVLIT-----------TTIHKIFALYTRTPVEAEIWVKMIQQAVANASTPK  201

Query  125  KSMS  128
             S+S
Sbjct  202  PSVS  205

>SDRG_14487
Length=964

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 37/56 (66%), Gaps = 3/56 (5%)

Query  12  SCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEK  67
           + EG++ K+G LM +WK+RYMVL G    ++YYD KE+   +   KG+F L+  E+
Sbjct  5   AWEGWIYKQGSLMPTWKKRYMVLKG--RHIAYYD-KEVSNPRAKEKGTFTLAAVER  57

 Score = 37.0 bits (84),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 22/31 (71%), Gaps = 2/31 (6%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYD  45
            G++ K G  +KSWK+R+ VL+G  L  +YYD
Sbjct  133  GWLEKEGQNVKSWKKRFFVLSGTDL--TYYD  161

>PYIW_18480
Length=755

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 36/122 (30%), Positives = 57/122 (47%), Gaps = 14/122 (11%)

Query  8    IHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHP-KGSFVLSECE  66
            + +T  EGYV K+GH+++SW+ RY +L+G T   SYY SKE+        +G   ++   
Sbjct  47   MFETDWEGYVWKQGHVVRSWRYRYAILSGTTF--SYYVSKEVAMVDTEKFRGRVTVTGAR  104

Query  67   KQDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSPQKS  126
            K D    G  V                K +S+Y  + I+   W+ +   A+   S  + S
Sbjct  105  KDDSRANGVLVT-----------TTINKVFSLYTRTPIESEIWVRMIQQAVVNASGQKPS  153

Query  127  MS  128
            MS
Sbjct  154  MS  155

>SPRG_02752
Length=831

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 37/56 (66%), Gaps = 3/56 (5%)

Query  12  SCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEK  67
           + EG++ K+G LM +WK+RYMVL G    ++YYD KE+   +   KG+F L+  E+
Sbjct  5   AWEGWIYKQGSLMPTWKKRYMVLKG--RHIAYYD-KEVTNPRAKEKGTFTLAAVER  57

 Score = 36.6 bits (83),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 22/31 (71%), Gaps = 2/31 (6%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYD  45
            G++ K G  +KSWK+R+ VL+G  L  +YYD
Sbjct  134  GWLEKEGQNVKSWKKRFFVLSGTDL--TYYD  162

>CCA19097
Length=688

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 57/127 (45%), Gaps = 16/127 (13%)

Query  8    IHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEK  67
            +H     G+V K+G ++K+WKRRYMVLNG+ L   YYDS    + K   KGS  +   E 
Sbjct  2    VHINQFSGWVHKQGAVIKTWKRRYMVLNGNVL--KYYDSA--LSIKMEEKGSVQILSVEM  57

Query  68   QDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNAL-GKNSSPQKS  126
                  G          I H  G+G +   +Y +S +   +W     N + G    P   
Sbjct  58   SGSIQNGR---------IMH--GKGGRVLKIYTDSSMQNKEWFEAITNVVCGIEKYPSID  106

Query  127  MSQRIEE  133
             +Q I E
Sbjct  107  EAQNINE  113

 Score = 38.1 bits (87),  Expect = 0.073, Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 25/33 (76%), Gaps = 2/33 (6%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSK  47
            G++ K+G  +K+WKRR+ +L GD L  SY+D++
Sbjct  144  GWLVKQGGRVKNWKRRFFLLRGDNL--SYFDTE  174

>H257_03361
Length=699

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 43/69 (62%), Gaps = 5/69 (7%)

Query  6   SKIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSEC  65
           + +H+   +G++ K+G ++ SWK+RY+VL+G    +SY+D KE+   +   KGSFVL+  
Sbjct  5   TSVHE--WQGWIQKQGSVVPSWKKRYLVLSGQN--ISYFD-KEVSNPRAKEKGSFVLAGV  59

Query  66  EKQDLSDEG  74
           +     D G
Sbjct  60  QPNKSYDNG  68

 Score = 39.7 bits (91),  Expect = 0.027, Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 50/113 (44%), Gaps = 21/113 (19%)

Query  9    HQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQ  68
            ++ +  G++ K+G +++SWK+RY VL G    ++Y+D     T  G+ KG   L++    
Sbjct  206  NRPTYTGWLDKQGEIVQSWKQRYFVLRGRN--IAYFD-----TVDGNQKGGGRLADVTMS  258

Query  69   DLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNS  121
            D           G  F  H      +  +V   S  D   W NV    LGK +
Sbjct  259  DT----------GLHF--HL--DNGRVVNVTASSSTDLQGWHNVVSQVLGKRT  297

>PITG_19213
Length=1201

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/109 (27%), Positives = 57/109 (52%), Gaps = 12/109 (11%)

Query  9    HQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQ  68
            H+   EGYV K+G  +  W+ RY++L+G TL  +YY+SKE   S  + +G  ++++   +
Sbjct  66   HEVHWEGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARNLRGRMIINKVRPE  123

Query  69   DLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNAL  117
            +        K  GF        QG+K + +   +++++  W+ +   A+
Sbjct  124  NYG------KAHGFLI----ETQGHKHFHLCCTTELEKDMWVEMMQAAI  162

>CCA24531
Length=374

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/111 (32%), Positives = 53/111 (48%), Gaps = 13/111 (12%)

Query  6    SKIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSEC  65
            + I +    G++ K+G L++SWK+RYMVL G  L  SYYD+  I + K   KGSF +   
Sbjct  18   TSIRRGQYSGWIFKQGSLVRSWKKRYMVLKGRQL--SYYDTDNILSLKVKEKGSFQVITV  75

Query  66   EKQDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNA  116
            E  +    G  V            G+G +   +Y E+  + + W N    A
Sbjct  76   ELSNEIKNGLLVH-----------GRGGRILKLYTETTEEASGWYNAIMEA  115

 Score = 36.2 bits (82),  Expect = 0.27, Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 61/157 (39%), Gaps = 41/157 (26%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDEG  74
            G++ K G   KSWK+RY VL G++L  +Y+ S+                        D G
Sbjct  184  GWLWKEGCRFKSWKKRYFVLRGNSL--AYFASE------------------------DTG  217

Query  75   ASVKPFGFKFIGHCPGQ----------GYKEYSVYVESQIDQTKWLNVAHNALGKNSSPQ  124
            AS K FG        GQ            +   + V++Q +  +WL    +A     +  
Sbjct  218  ASAKGFGRVCAVEVNGQRNNCLDVRFESGRLLRIVVDTQDEMEEWLCKLSDA-----AHV  272

Query  125  KSMSQRIEEITGPLLPCASVQLNCPRRDMIHITTLGH  161
             +M +R + + G L P +   +   +  M    TL H
Sbjct  273  SNMERRRDSLFGGLCPISRASVPYVKSIMSPPPTLAH  309

>CCA16487
Length=975

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 54/105 (51%), Gaps = 9/105 (9%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDE  73
            EGYVTKRGHL+++WK R+  L G+ L  SYY++K     + H KG   ++      +S  
Sbjct  138  EGYVTKRGHLVRNWKMRFFTLEGNRL--SYYENKVDAQQRAHLKGRVKVASVRIDQVSKW  195

Query  74   GASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALG  118
            G+     G++F      +G K +   V + ++Q  W+      +G
Sbjct  196  GS-----GYEFT-FSTTEG-KTFHCSVSTSLEQLLWVYFLEAGIG  233

>CCI47145
Length=390

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 51/105 (49%), Gaps = 13/105 (12%)

Query  8    IHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEK  67
            I +    G++ K+G L++SWK+RYMVL G  L  SYYD+  I + K   KGSF +   E 
Sbjct  32   IRRGQYSGWIFKQGSLVRSWKKRYMVLKGRQL--SYYDTDNILSLKVKEKGSFQVITVEL  89

Query  68   QDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNV  112
             +    G  V            G+G +   +Y E+  + + W N 
Sbjct  90   SNEIKNGLLVH-----------GRGGRILKLYTETTEEASGWYNA  123

 Score = 35.4 bits (80),  Expect = 0.54, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 24/34 (71%), Gaps = 2/34 (6%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKE  48
            G++ K G   KSWK+RY VL G++L  +Y+ S++
Sbjct  199  GWLWKEGCRFKSWKKRYFVLRGNSL--AYFASED  230

>PHALS_04098
Length=1183

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/109 (27%), Positives = 56/109 (51%), Gaps = 12/109 (11%)

Query  9    HQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQ  68
            H+   EGYV K+G  +  W+ RY++L+G TL  +YY+SKE   S  + +G   + +   +
Sbjct  70   HEVHWEGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARNMRGRMTVYKVRPE  127

Query  69   DLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNAL  117
            +        K  GF        Q +K++ +   +++++  W+ + H A+
Sbjct  128  NYG------KAHGFLL----ETQSHKQFHLCCATELEKDMWVEMMHAAV  166

>HYAP_04457
Length=1203

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 57/109 (52%), Gaps = 12/109 (11%)

Query  9    HQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQ  68
            H+   EGYV K+G  +  W+ RY++L+G TL  +YY+SKE   S  + +G  +L +   +
Sbjct  57   HEVHWEGYVRKKGDWLPRWEERYLILDGPTL--TYYNSKEDARSARNLRGRMLLLKVRPE  114

Query  69   DLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNAL  117
            +        K  GF F+     Q +K + +   S++++  W+ +   A+
Sbjct  115  NYG------KAHGF-FLE---TQSHKHFHLCCSSELEKDMWVEMMQAAI  153

>H310_00230
Length=1248

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 53/112 (47%), Gaps = 16/112 (14%)

Query  6    SKIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSEC  65
            S +   +C GY+TK+GH  KSWKRRY VL G   L+SYY   E    +        L+E 
Sbjct  219  SSLQPIACAGYLTKQGHKRKSWKRRYFVLRG--ALLSYYTDYESANKQ-------CLAEV  269

Query  66   EKQDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNAL  117
              +D+      +  F F             Y VY +++ ++ KWL VA  AL
Sbjct  270  GIEDVQVWDGEMHGFMFTTTEQV------MYYVYADTERERQKWL-VALKAL  314

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 50/109 (46%), Gaps = 18/109 (17%)

Query  13   CEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSK-------EIYTSKGHP---KGSFVL  62
            C GY+TKRGH++ +WK R+ VL     L SYY+ +       +++ +K  P    GS   
Sbjct  12   CSGYLTKRGHVVTNWKMRFFVLRPHANL-SYYEDESMSKKLGQVHLAKVAPWEYNGSLTR  70

Query  63   SECEKQDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLN  111
            S   K+DL     S   +GF F           Y +Y  S  +  KW N
Sbjct  71   S-LSKRDLRTSDDSR--YGFMFF----TTKRVVYYIYTSSANEHQKWFN  112

>PYAR_15463
Length=1091

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/109 (28%), Positives = 57/109 (52%), Gaps = 12/109 (11%)

Query  9    HQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQ  68
            H+   EGYV K+G  +  W+ RY+VL+G TL  +YY+SKE   S  + +G  ++S+   +
Sbjct  73   HEVHWEGYVRKKGDWLPRWEERYLVLDGATL--TYYNSKEEARSGRNLRGRMIISKVRPE  130

Query  69   DLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNAL  117
            +        K  GF        +G+K + +   +++++  W+ +   A+
Sbjct  131  NYG------KAHGFLI----ETKGHKLFHLCCSTELEKDMWVEMMQAAI  169

>CCA21715
Length=782

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/136 (26%), Positives = 63/136 (46%), Gaps = 20/136 (15%)

Query  5    LSKIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHP-KGSFVLS  63
              ++ +T  EGY+ K+GH+++SW+ RY VL+G     SYY SKEI  +     +G   ++
Sbjct  100  FEELFETDWEGYIWKQGHVVRSWRYRYAVLSGTCF--SYYSSKEIAMADTERYRGRVTVT  157

Query  64   ECEKQDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSP  123
              E+      G  ++               K +S+   S I+   W+ +   A+  ++  
Sbjct  158  GAERDGSRTNGVLIRT-----------TVNKVFSIQTSSTIESDLWIRMISQAVANSTGL  206

Query  124  QKSMSQRIEEITGPLL  139
            + S++      TG LL
Sbjct  207  KTSLT------TGSLL  216

>CCA21860
Length=782

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/136 (26%), Positives = 63/136 (46%), Gaps = 20/136 (15%)

Query  5    LSKIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHP-KGSFVLS  63
              ++ +T  EGY+ K+GH+++SW+ RY VL+G     SYY SKEI  +     +G   ++
Sbjct  100  FEELFETDWEGYIWKQGHVVRSWRYRYAVLSGTCF--SYYSSKEIAMADTERYRGRVTVT  157

Query  64   ECEKQDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSP  123
              E+      G  ++               K +S+   S I+   W+ +   A+  ++  
Sbjct  158  GAERDGSRTNGVLIRT-----------TVNKVFSIQTSSTIESDLWIRMISQAVANSTGL  206

Query  124  QKSMSQRIEEITGPLL  139
            + S++      TG LL
Sbjct  207  KTSLT------TGSLL  216

>CCI42457
Length=906

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 50/105 (48%), Gaps = 21/105 (20%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDE  73
            EGYV KRGHL+++WK R+  L G+   VSYY+SK     + H KG   +     + +S  
Sbjct  130  EGYVIKRGHLVRNWKMRFFTLEGNR--VSYYESKGDAQQRVHLKGRVKVVSVRMETISKL  187

Query  74   GASVKPFGFKF------IGHCPGQGYKEYSVYVESQIDQTKWLNV  112
            G     F F F      + HC           V +++ Q  W+++
Sbjct  188  GNG---FDFSFETAESKVFHCS----------VPTKLSQLLWVHL  219

>PHYKE_6662
Length=765

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/109 (26%), Positives = 56/109 (51%), Gaps = 12/109 (11%)

Query  9    HQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQ  68
            H+   EG+V K+G  +  W+ RY++L+G TL  +YY+SKE   S  + +G  ++ +   +
Sbjct  67   HEVHWEGFVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARNLRGRMIIVKVRPE  124

Query  69   DLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNAL  117
            +        K  GF        QG+K + +   +++++  W+ +   A+
Sbjct  125  NYG------KAHGFLI----ETQGHKHFHLCCSTELEKDMWVEMMQAAI  163

>CCA18023
Length=1138

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/109 (27%), Positives = 56/109 (51%), Gaps = 12/109 (11%)

Query  9    HQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQ  68
            HQ   EGYV K+G  +  W+ RY+VL+G TL  +YY++KE   S  + +G  ++ +   +
Sbjct  120  HQVHWEGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEEARSARNLRGKMMIVKVRPE  177

Query  69   DLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNAL  117
            +        K  GF        +G+K + +   +++++  W+ +   A+
Sbjct  178  NYG------KAHGFLI----ETKGHKHFHLCCATELEKDMWIEMMQAAI  216

>PHYKE_5678
Length=809

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 31/42 (74%), Gaps = 2/42 (5%)

Query  8    IHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEI  49
            I +T  EGY+ K+GH+++SW+ RY VL+G T   SYY SKE+
Sbjct  97   IFETDWEGYIWKQGHVVRSWRYRYAVLSGVTF--SYYVSKEV  136

>PYIR_15118
Length=1222

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/124 (27%), Positives = 59/124 (48%), Gaps = 22/124 (18%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDEG  74
            GY+ K+G   K+W+RRY +L  D  ++SYYDS E  T  G              +++ +G
Sbjct  193  GYLVKQGSFWKTWRRRYFILRRDIPVLSYYDSAEELTKLG--------------EITVDG  238

Query  75   AS-VKP-----FGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSPQKSMS  128
             + V+P     F F+F+     +G K   V  E +     W++   N + + ++  ++  
Sbjct  239  TTGVRPTPREGFPFQFV--VEHEGRKLTLVAEEGKPSTDAWISNIQNCIQRRAAEMENAR  296

Query  129  QRIE  132
            Q +E
Sbjct  297  QSVE  300

>H257_06721
Length=1238

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/110 (32%), Positives = 52/110 (47%), Gaps = 16/110 (15%)

Query  13   CEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSK-------EIYTSKGHP---KGSFVL  62
            C GY+TKRGH++ +WK RY VL     L SYY+ +       +++ +K  P    GS   
Sbjct  14   CRGYLTKRGHVVTNWKMRYFVLRPHASL-SYYEDESMAKKLGQVHLAKVAPWEYNGSLAK  72

Query  63   SECEKQDL-SDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLN  111
            S  +++   S  GA    +GF F           Y +Y  S I+  KW +
Sbjct  73   SVSKRESRGSSSGAEESRYGFMFF----TTKRVVYYIYTTSAIEHQKWFH  118

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 49/105 (47%), Gaps = 15/105 (14%)

Query  6    SKIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSEC  65
            S +   +C GY+TK+GH  KSWK+RY VL G   L+SYY   +    +        L+E 
Sbjct  225  SSLQPIACAGYLTKQGHKRKSWKKRYFVLRGS--LLSYYTDYDSTNKQ-------CLAEV  275

Query  66   EKQDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWL  110
              +D+      +  F F             Y VY ES+ ++ KWL
Sbjct  276  GIEDVQVWDGEMHGFMFTTSEQV------VYYVYAESERERQKWL  314

>PYAP_18636
Length=1009

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/109 (27%), Positives = 56/109 (51%), Gaps = 12/109 (11%)

Query  9    HQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQ  68
            H+   EGYV K+G  +  W+ RY+VL+G TL  +YY++KE   S  + +G  ++S+   +
Sbjct  98   HEVHWEGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEEARSGRNLRGRMIISKVRPE  155

Query  69   DLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNAL  117
            +        K  GF         G+K + +   +++++  W+ +   A+
Sbjct  156  NYG------KAHGFLLE----TMGHKHFHLCCSTELEKDMWVEMMQAAI  194

>PYIR_13120
Length=814

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/122 (28%), Positives = 57/122 (47%), Gaps = 14/122 (11%)

Query  8    IHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHP-KGSFVLSECE  66
            + +T  EGY+ K+GH+++SW+ RY +L+G T   SYY SKE+        +G   ++   
Sbjct  101  MFETDWEGYLWKQGHVVRSWRYRYAILSGTTF--SYYVSKEVAMVDTEKFRGRVTVTGAR  158

Query  67   KQDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSPQKS  126
            K +    G  V                K +++Y  S I+   W+ +   A+   S  + S
Sbjct  159  KDESRANGVLVT-----------TTINKVFALYTRSPIESEIWIRMIQQAVVNASGEKPS  207

Query  127  MS  128
            MS
Sbjct  208  MS  209

>CCI46235
Length=1155

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/109 (27%), Positives = 56/109 (51%), Gaps = 12/109 (11%)

Query  9    HQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQ  68
            HQ   EGYV K+G  +  W+ RY+VL+G TL  +YY++KE   S  + +G  ++ +   +
Sbjct  115  HQVHWEGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEEARSARNLRGKMMIVKVRPE  172

Query  69   DLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNAL  117
            +        K  GF        +G+K + +   +++++  W+ +   A+
Sbjct  173  NYG------KAHGFLI----ETKGHKHFHLCCATELEKDMWIEMMQAAI  211

>PYVX_18338
Length=746

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 35/51 (69%), Gaps = 2/51 (4%)

Query  1    MHVNLSKIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYT  51
            +H ++    +T  EGY+ K+GH+++SW+ RY VL+G T   SYY SK++ T
Sbjct  69   VHGSIEDAFETDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDVAT  117

>PITG_11303
Length=293

 Score = 49.3 bits (116),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 25/36 (69%), Gaps = 2/36 (6%)

Query  13   CEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKE  48
            CEGY+TKRGH+  +WK RY  L G+ L   YY S+E
Sbjct  214  CEGYLTKRGHVFTNWKTRYFTLRGNVL--EYYSSEE  247

>CCI10489
Length=777

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 31/42 (74%), Gaps = 2/42 (5%)

Query  8    IHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEI  49
            + +T  EGY+ KRGH+++SW+ R+ VL+G  L  SYY SKE+
Sbjct  101  MFKTDWEGYIWKRGHVVRSWRHRFAVLSGTCL--SYYTSKEV  140

>PHYSO_344112
Length=813

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 31/42 (74%), Gaps = 2/42 (5%)

Query  8    IHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEI  49
            I +T  EGY+ K+GH+++SW+ RY VL+G T   SYY SK++
Sbjct  98   IFETDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDV  137

>PYU1_G004386
Length=837

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 60/121 (50%), Gaps = 19/121 (16%)

Query  8    IHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIY---TSKGHPKGSFVLSE  64
            + +T  EGY+ K+GH+++SW+ RY +L+G T   SYY SK++    T K   +G   ++ 
Sbjct  133  MFETDWEGYLWKQGHVVRSWRYRYAILSGTTF--SYYVSKDVAMIDTEKF--RGRVTVTG  188

Query  65   CEKQDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSPQ  124
              K D    G  V                K +++Y  + I+   W+ +   A+ +N+S Q
Sbjct  189  ARKDDARTNGVLVT-----------TTINKVFALYTRTAIESEIWIKMIQQAV-QNASGQ  236

Query  125  K  125
            K
Sbjct  237  K  237

>PYAR_19883
Length=833

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/124 (22%), Positives = 59/124 (48%), Gaps = 14/124 (11%)

Query  5    LSKIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHP-KGSFVLS  63
              ++ +T  EGY+ K+GH++++W+ RY +L+G T   SYY SK++        +G   ++
Sbjct  94   FEEMFETDWEGYIWKQGHVVRNWRYRYAILSGTTF--SYYISKDVAMQDTEKYRGRVSVT  151

Query  64   ECEKQDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSP  123
               + D    G  +               +K +++Y  + ++   W+ +   A+   + P
Sbjct  152  GASRDDSRANGVLIT-----------TTIHKAFALYTRTPVEAEIWVRMIQQAVANATLP  200

Query  124  QKSM  127
            + S+
Sbjct  201  KPSV  204

>PPTG_05519
Length=810

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 31/42 (74%), Gaps = 2/42 (5%)

Query  8    IHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEI  49
            I +T  EGY+ K+GH+++SW+ RY VL+G T   SYY SK++
Sbjct  98   IFETDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDV  137

>PITG_02762
Length=810

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 31/42 (74%), Gaps = 2/42 (5%)

Query  8    IHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEI  49
            I +T  EGY+ K+GH+++SW+ RY VL+G T   SYY SK++
Sbjct  98   IFETDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDV  137

>PHYCA_506137
Length=810

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 31/42 (74%), Gaps = 2/42 (5%)

Query  8    IHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEI  49
            I +T  EGY+ K+GH+++SW+ RY VL+G T   SYY SK++
Sbjct  98   IFETDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDV  137

>PYIR_18382
Length=1154

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/109 (26%), Positives = 56/109 (51%), Gaps = 12/109 (11%)

Query  9    HQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQ  68
            H+   EGYV K+G  +  W+ RY+VL+G  L  +YY++KE   S  + +G  ++S+   +
Sbjct  124  HEVHWEGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEEARSARNLRGRMIISKVRPE  181

Query  69   DLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNAL  117
            +        K  GF        +G+K + +   +++++  W+ +   A+
Sbjct  182  NYG------KAHGFLI----ETKGHKHFHLCCSTELEKDMWVEMMQAAI  220

>PHYRA_79281
Length=809

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 31/42 (74%), Gaps = 2/42 (5%)

Query  8    IHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEI  49
            I +T  EGY+ K+GH+++SW+ RY VL+G T   SYY SK++
Sbjct  97   IFETDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDV  136

>PYU1_G008848
Length=765

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/109 (26%), Positives = 56/109 (51%), Gaps = 12/109 (11%)

Query  9    HQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQ  68
            H+   EGYV K+G  +  W+ RY+VL+G  L  +YY++KE   S  + +G  ++S+   +
Sbjct  129  HEVHWEGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEEARSARNLRGRMIISKVRPE  186

Query  69   DLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNAL  117
            +        K  GF        +G+K + +   +++++  W+ +   A+
Sbjct  187  NYG------KAHGFLI----ETKGHKHFHLCCSTELEKDMWVEMMQAAI  225

>PYIR_23372
Length=1415

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 65/137 (47%), Gaps = 21/137 (15%)

Query  12   SCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLS  71
            S EGY+ K+  L++SWK  Y VL GDT+  +YY+S+E + S     G   +   E  ++ 
Sbjct  322  SFEGYLNKKSDLLQSWKATYCVLEGDTM--AYYESREDFISNSKLMGRIQIQGVEDDNMG  379

Query  72   DEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKW---LNVAHNALGKNSSP-----  123
                  KP GF+ I     +G++   +   +  ++ +W   + VA     ++S P     
Sbjct  380  ------KPNGFRVI----TEGHRTNHLSSRTGFEKDQWKRAITVAITKAPESSRPHVAFG  429

Query  124  -QKSMSQRIEEITGPLL  139
             Q  ++ +   + G LL
Sbjct  430  SQPLVATKFYRLLGALL  446

>PYVX_19030
Length=556

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 68/146 (47%), Gaps = 25/146 (17%)

Query  12   SCEGYVTKRGHLMKS-------WKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSE  64
            +  G+V   G L K        WK+RY V++ D L + YY + E +  KG  +G    S 
Sbjct  18   TASGHVVIAGILFKKPERNSLLWKKRYCVIHKDVLQIVYYLTLEDF-EKGAIRGKIPFSS  76

Query  65   CEKQDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSPQ  124
              K D        KP GF+F  + P    K + VY E+  +QT+W++   + +  ++SP 
Sbjct  77   VHKWD-------GKPNGFQF--YTPYN--KCFRVYTETPEEQTRWVDAMQSLI--DASPD  123

Query  125  KSMSQRIEEITGPLLPCASVQLNCPR  150
            ++  + ++       P AS   + PR
Sbjct  124  RNDGEAVQYAR----PIASSPTSSPR  145

>PYU1_G009508
Length=328

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 38/76 (50%), Gaps = 18/76 (24%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDEG  74
            GY+ K+G   K+W+RRY +L  DT ++SYYDS E  T  G             +   D  
Sbjct  166  GYLVKQGSYWKTWRRRYFILRRDTPVLSYYDSAEELTKLG-------------EITVDAT  212

Query  75   ASVKP-----FGFKFI  85
             +VKP     F F+F+
Sbjct  213  TTVKPTPREGFPFQFV  228

>SDRG_01408
Length=916

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 78/172 (45%), Gaps = 31/172 (18%)

Query  4    NLSKIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLS  63
            ++  + +   EG+V K+G  +  W+ RY+VL+G TL  +YY  +    S  + +G  VL+
Sbjct  115  DIGNVQEVHWEGHVRKKGDWLPRWEPRYLVLDGTTL--TYYSKQHDARSGKNLRGRMVLT  172

Query  64   ECEKQDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKN---  120
                  +  +    K  GF        +G+K + +   +++++  W+ +   AL +    
Sbjct  173  Y-----VGPDFKGKKAHGFMI----ETKGHKRFHLCCATELEKDMWVEMMQTALDEANGA  223

Query  121  -----------SSPQKSMSQRIEEITGPLLPCASVQLNC-PRRDMIHITTLG  160
                       SSP   +S+     +GP+LP ++ +  C P   + H T+L 
Sbjct  224  ANKPAQDDDFMSSPSYDLSR-----SGPVLPKSATRSGCSPASSIGHTTSLA  270

>PYIW_16987
Length=821

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/109 (26%), Positives = 56/109 (51%), Gaps = 12/109 (11%)

Query  9    HQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQ  68
            H+   EGYV K+G  +  W+ RY+VL+G  L  +YY++KE   S  + +G  ++S+   +
Sbjct  115  HEVHWEGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEEARSARNLRGRMIISKVRPE  172

Query  69   DLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNAL  117
            +        K  GF        +G+K + +   +++++  W+ +   A+
Sbjct  173  NYG------KAHGFLIE----TKGHKHFHLCCSTELEKDMWVEMMQAAI  211

>PITG_02109
Length=522

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/111 (31%), Positives = 57/111 (51%), Gaps = 16/111 (14%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDEG  74
            G+V K+G L+K+WK+R+MVL+G  L  +YYD+ ++  +   PKGSF +   E       G
Sbjct  138  GWVYKQGSLVKNWKKRFMVLSGRQL--TYYDTSKLNPTV-KPKGSFQVITVELSPDIQNG  194

Query  75   ASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSPQK  125
              V            G+G + + +Y  S    + W N+  +A    ++PQ+
Sbjct  195  LLVH-----------GRGGRVFKLYTASAEATSAWYNMILDAT--TAAPQQ  232

 Score = 40.0 bits (92),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 25/34 (74%), Gaps = 2/34 (6%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKE  48
            G++ K G  +KSWKRRY VL G+ L  SY++S++
Sbjct  281  GWLKKEGARVKSWKRRYFVLRGNAL--SYFNSED  312

>SPRG_00889
Length=994

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 80/168 (48%), Gaps = 22/168 (13%)

Query  4    NLSKIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLS  63
            +L  + +   EG+V K+G  +  W+ RY+VL+G TL  +YY  +    S  + +G  VL+
Sbjct  113  DLGNVQEVHWEGHVRKKGDWLPRWEPRYLVLDGTTL--TYYSKQHDARSGKNLRGRMVLT  170

Query  64   ECEKQDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSS-  122
                  +  +  S K  GF        +G+K + +   +++++  W+ +   AL + SS 
Sbjct  171  Y-----VGPDFKSKKAHGFMI----ETKGHKRFHLCCATELEKDMWVEMMQTALDEASSA  221

Query  123  ------PQKS-MSQRIEEI--TGPLLPCASVQLN-CPRRDMIHITTLG  160
                  PQ   MS    ++  +GP++P ++ +    P   + H T+L 
Sbjct  222  STKPPPPQDDFMSSPSYDLSRSGPVVPKSATRSGYSPASSITHTTSLA  269

>H310_06378
Length=837

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/98 (32%), Positives = 50/98 (51%), Gaps = 10/98 (10%)

Query  13   CEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSD  72
             EG+V K+GHL+++WK RY  L G+  L+SYY++KE    +   KG   L+      +  
Sbjct  58   WEGFVQKKGHLVRNWKVRYFTLEGN--LLSYYETKEDARKRRFLKGRVHLTTV----MLV  111

Query  73   EGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWL  110
            EG S   +   F      Q  K + V   ++++Q  W+
Sbjct  112  EGRSAHGYDLTFT----TQESKPFHVSTTTELEQIAWV  145

>HYAP_08026
Length=798

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 31/42 (74%), Gaps = 2/42 (5%)

Query  8    IHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEI  49
            + +T  EGY+ K+GH+++SW+ RY VL+G T   SYY SK++
Sbjct  85   LFETDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDV  124

>SDRG_00080
Length=298

 Score = 47.8 bits (112),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 31/49 (63%), Gaps = 5/49 (10%)

Query  12   SCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSF  60
            +  GYV K+G  +K+WKRRYMVL+ DTL   YY S+   T    P+G F
Sbjct  72   AFSGYVRKQGSFVKNWKRRYMVLHDDTLF--YYVSERATTK---PRGFF  115

>PHALS_06568
Length=388

 Score = 47.8 bits (112),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 57/114 (50%), Gaps = 16/114 (14%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDEG  74
            G+V K+G ++KSWK+RYMVL+G  L  +YYD+ ++   K  PKGS  +   E       G
Sbjct  12   GWVYKQGSIVKSWKKRYMVLSGRQL--TYYDTAKV-DQKVKPKGSCQVITVELSTDIQNG  68

Query  75   ASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSPQKSMS  128
              V            G+G +   +Y  S    + W N+  +A    ++PQ+ M+
Sbjct  69   LLVH-----------GRGGRVLKLYTASAEATSAWYNMILDA--TKAAPQQFMA  109

 Score = 38.9 bits (89),  Expect = 0.034, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 28/39 (72%), Gaps = 2/39 (5%)

Query  10   QTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKE  48
            Q +  G++ K G  +KSW+RR+ VL G++L  SY++S++
Sbjct  148  QVTHSGWLKKEGARVKSWRRRFFVLRGNSL--SYFNSED  184

>PHALS_03645
Length=830

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 31/42 (74%), Gaps = 2/42 (5%)

Query  8    IHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEI  49
            I +T  EGY+ K+GH+++SW+ RY VL+G   + SYY SK++
Sbjct  98   IFETDWEGYIWKQGHVVRSWRYRYAVLSGT--IFSYYVSKDV  137

>H257_16349
Length=262

 Score = 47.0 bits (110),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 43/79 (54%), Gaps = 14/79 (18%)

Query  7    KIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHP-KGSFVLSEC  65
            + HQ   +G+V KRG   +SWKRR+ VL  + L  +YYD       +G P KG  V+   
Sbjct  168  RAHQDVMKGWVEKRGSRFRSWKRRFFVLRDNIL--AYYD----INLEGQPQKGGDVV---  218

Query  66   EKQDLSDEGASVKPFGFKF  84
                LS E ++VKP G +F
Sbjct  219  ----LSIENSTVKPNGLEF  233

>H310_04842
Length=1081

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/138 (25%), Positives = 65/138 (47%), Gaps = 13/138 (9%)

Query  8    IHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEK  67
            +H    EG V K+G  +  W+ RY+VL+G  L   YY  ++      H +G  +L+    
Sbjct  112  MHSVHWEGQVRKKGDWLPRWESRYLVLDGTVL--RYYSKQDDARLGKHLRGKLILTH---  166

Query  68   QDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSPQKSM  127
              +S E    K   F         G K + +  ++++++  W+ +   A+ + ++PQ+  
Sbjct  167  --VSPEIHKKKEHTFA----VETTGRKMFFMSCDTELEKDMWVEMIQAAISEAAAPQRQH  220

Query  128  SQRIEEITGPLLPCASVQ  145
            + R  +   PL+P +S Q
Sbjct  221  ANRHGQ--PPLVPASSAQ  236

>PYIW_18491
Length=1684

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 45/78 (58%), Gaps = 10/78 (13%)

Query  12   SCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLS  71
            S EGY+ K+  L+++WK  Y VL GDT+  +YY+S+E + S      S ++   + Q + 
Sbjct  307  SFEGYLNKKSDLLQTWKATYSVLEGDTM--AYYESREDFISN-----SKLIGRIQIQGVE  359

Query  72   DEGASVKPFGFKFI--GH  87
            D+    KP GF+ I  GH
Sbjct  360  DDNMG-KPNGFRIITEGH  376

>PYIW_18911
Length=1196

 Score = 47.8 bits (112),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 26/40 (65%), Gaps = 0/40 (0%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKG  54
            GY+ K+G   K+W+RRY +L  D  ++SYYDS E  T  G
Sbjct  174  GYLVKQGSFWKTWRRRYFILRRDIPVLSYYDSAEELTKLG  213

>PPTG_14630
Length=398

 Score = 47.0 bits (110),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 57/112 (51%), Gaps = 18/112 (16%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYD-SKEIYTSKGHPKGSFVLSECEKQDLSDE  73
            G+V K+G L+K+WK+R+MVL+G  L  +YYD SK + T K  PKGSF +   E       
Sbjct  12   GWVYKQGSLVKNWKKRFMVLSGRQL--TYYDTSKLVPTVK--PKGSFQVITVELSTDIQN  67

Query  74   GASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSPQK  125
            G  V            G+G +   +Y  S    + W N+  +A    ++PQ+
Sbjct  68   GLLVH-----------GRGGRVLKLYTASAEATSAWYNMILDA--TTATPQQ  106

 Score = 40.8 bits (94),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 28/43 (65%), Gaps = 2/43 (5%)

Query  6    SKIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKE  48
            S   Q +  G++ K G  +KSWKRRY VL G+ L  SY++S++
Sbjct  146  SGSEQVTHSGWLKKEGARVKSWKRRYFVLRGNAL--SYFNSED  186

>H310_04843
Length=968

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/109 (25%), Positives = 55/109 (50%), Gaps = 12/109 (11%)

Query  9    HQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQ  68
            H+   EGYV K+G  +  W+ RY+VL+G +L  +YY+SKE   +  + +G  +++     
Sbjct  98   HEVHWEGYVRKKGDWLPRWEERYLVLDGASL--TYYNSKEEARTGKNLRGRMIITRV---  152

Query  69   DLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNAL  117
             L +       F  + +GH      K + +   +++++  W+ +   A+
Sbjct  153  -LPENYGKAHGFLIETMGH------KHFHLCCTTELEKDMWVEMMQAAI  194

>PYAR_25500
Length=473

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/101 (27%), Positives = 54/101 (53%), Gaps = 14/101 (14%)

Query  12   SCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLS  71
            + EGY+ K+  ++  W+  Y VL GDTL  +YY+S+E + S      + ++   + QD+ 
Sbjct  60   AFEGYLHKKSEVLSHWRATYCVLEGDTL--AYYESREDFISN-----TKLIGRIQVQDVG  112

Query  72   DEGASV---KPFGFKFIGHCPGQGYKEYSVYVESQIDQTKW  109
            D+  S    KP GF+ +     +G++ + +   +  ++ +W
Sbjct  113  DDDQSAPNGKPHGFRIM----TEGHRAHHLSSRTAFEKDQW  149

>CCA25510
Length=1139

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 26/40 (65%), Gaps = 0/40 (0%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKG  54
            GY+ K+G   KSW+RRY +L  D  +++YY SKE  T  G
Sbjct  197  GYLVKQGSFWKSWRRRYFILRRDVPILAYYTSKENLTKLG  236

>PYIR_22246
Length=559

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 58/125 (46%), Gaps = 20/125 (16%)

Query  27   WKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDEGASVKPFGFKFIG  86
            WK+RY V+  ++L + Y+ S+  Y  KG  +G    S   K D        KP GF+F  
Sbjct  43   WKKRYCVIYKESLQIVYFQSEADY-EKGTIRGKIPFSTVHKWD-------GKPNGFQF--  92

Query  87   HCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSPQKSMSQRIEEITGPL-LPCASVQ  145
            + P    K + VY E+  +Q +WL     A+  ++SP KS    +     P   P AS  
Sbjct  93   YTPSN--KCFRVYTETAEEQEQWLAAMQTAI--DNSPDKSAVTSV-----PYQRPIASSP  143

Query  146  LNCPR  150
             + PR
Sbjct  144  TSSPR  148

>PYAP_24144
Length=1022

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 59/117 (50%), Gaps = 10/117 (9%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDE  73
            EGY+ K+  L+  W+  Y VL GDTL  +YY+S+E +       G   +   +  +L   
Sbjct  314  EGYLHKKSDLLAQWRAIYCVLEGDTL--AYYESREDFILNARLIGRIQVQGVDDDNLP--  369

Query  74   GASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGK--NSSPQKSMS  128
             A+ KP GF+ +     +G++ + +   +  ++ +W     +A+ K  NSS +  ++
Sbjct  370  AATGKPHGFRVL----TEGHRIHHLGSRTAFEKDQWKRAIKSAIAKATNSSARPQIA  422

>PYAP_13695
Length=348

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 35/53 (66%), Gaps = 3/53 (6%)

Query  8   IHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSF  60
           +H     G++ K+G L+K+WKRR+MVL G  L  +YYD++ I + +   KGSF
Sbjct  5   MHGGEYAGWIYKQGSLVKNWKRRFMVLRGKQL--TYYDTERI-SPRVKEKGSF  54

 Score = 42.0 bits (97),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 26/39 (67%), Gaps = 2/39 (5%)

Query  10   QTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKE  48
            Q    G++TK G  +K+WKRR+  L GDTL  SY+DS +
Sbjct  151  QVQHSGWLTKEGMRVKNWKRRWFTLRGDTL--SYFDSAD  187

>H310_05457
Length=269

 Score = 46.2 bits (108),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 44/79 (56%), Gaps = 14/79 (18%)

Query  7    KIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHP-KGSFVLSEC  65
            +  Q   +G+V KRG  ++SWKRR+ +L  +  L+SYYD       +G P KG  V+   
Sbjct  175  RTRQDVMKGWVEKRGSRIRSWKRRFFILREN--LLSYYD----INLEGQPQKGGDVV---  225

Query  66   EKQDLSDEGASVKPFGFKF  84
                LS E ++VKP G +F
Sbjct  226  ----LSIENSTVKPNGLEF  240

 Score = 32.3 bits (72),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 24/45 (53%), Gaps = 6/45 (13%)

Query  15  GYVTKRGHLMKSWKRRYMVLNGDTLLVSYY-DSKEIYTSKGHPKG  58
           GYV +   L K WKRR+MVL G  L  SYY +  E       PKG
Sbjct  39  GYVYR---LSKKWKRRFMVLEGRDL--SYYGNETEAMEPSTPPKG  78

>PYIR_13555
Length=355

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 33/46 (72%), Gaps = 3/46 (7%)

Query  15  GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSF  60
           G+V K+G L+++WK+RYMVL G  L  +YYD+  + T+K   KGSF
Sbjct  10  GWVFKQGSLVRNWKKRYMVLRGKQL--TYYDTASL-TAKTKEKGSF  52

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 36/57 (63%), Gaps = 8/57 (14%)

Query  5    LSKIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSK---GHPKG  58
            ++ IH +   G++ K G  +KSWK+RY  L+G+TL  SYYDS +  ++    GH KG
Sbjct  153  VAGIHHS---GWLKKEGSRVKSWKKRYFTLHGNTL--SYYDSADTGSAAKGYGHVKG  204

>PYVX_13312
Length=1016

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/109 (26%), Positives = 54/109 (50%), Gaps = 12/109 (11%)

Query  9    HQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQ  68
            H+   EGYV K+G  +  W+ RY++L+G  L  +YY+SK+   S  + +G   LS    +
Sbjct  71   HEVHWEGYVRKKGDWLPRWEERYLILDGAAL--TYYNSKDEARSGRNLRGRMQLSRVRPE  128

Query  69   DLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNAL  117
            +        K  GF        +G+K + +   +++++  W+ +   A+
Sbjct  129  NYG------KAHGFLIE----TRGHKSFHLCCTTELEKDMWVEMMQAAI  167

>SPRG_00364
Length=255

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 40/72 (56%), Gaps = 16/72 (22%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPK--GSFVLSECEKQDLSD  72
            G+V KRG +M++WKRRY VL  + L  +YYD       +G PK  G FV         S 
Sbjct  166  GWVEKRGAVMRTWKRRYFVLRENVL--AYYD----INLEGQPKKGGDFV--------QSI  211

Query  73   EGASVKPFGFKF  84
            E +++KP G +F
Sbjct  212  ETSTIKPNGLEF  223

 Score = 32.0 bits (71),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 30/59 (51%), Gaps = 8/59 (14%)

Query  15  GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGH-PKGSFVLSECEKQDLSD  72
           GY  +   L K WKRR+ VL G  L  SY+ S++     G  PKG+  ++ C     SD
Sbjct  24  GYAYR---LSKKWKRRFFVLEGRRL--SYFGSEDDANDSGRAPKGT--ITVCAAYHWSD  75

>SDRG_03531
Length=255

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 39/70 (56%), Gaps = 12/70 (17%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDEG  74
            G+V KRG +M+SWKRRY VL  + L  +YYD       +G PK    L +      S E 
Sbjct  166  GWVEKRGAVMRSWKRRYFVLRENVL--AYYD----INLEGQPKKGGDLVQ------SIET  213

Query  75   ASVKPFGFKF  84
            ++VKP G +F
Sbjct  214  STVKPNGLEF  223

 Score = 31.2 bits (69),  Expect = 9.6, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 29/59 (49%), Gaps = 8/59 (14%)

Query  15  GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGH-PKGSFVLSECEKQDLSD  72
           GY  +   L K WKRR+ VL G  L  SY+ +++     G  PKG+  +  C     SD
Sbjct  24  GYAYR---LSKKWKRRFFVLEGRRL--SYFGNEDEANDPGRAPKGAITV--CAAYHWSD  75

>PYAR_14615
Length=517

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 46/106 (43%), Gaps = 10/106 (9%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDE  73
            EG++ K+G   KSWKRR+ V +G TL  SYY S++       P     L  C  +D    
Sbjct  38   EGFLQKKGQRFKSWKRRWFVCDGRTL--SYYISRK----DRKPNAIIPLESCTVED----  87

Query  74   GASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGK  119
            G   + +    I    G     Y +  E     T WLNV   A+ K
Sbjct  88   GGISETWNSPRIYLTDGTTGTMYCLSAEDGEVVTAWLNVLRTAIAK  133

>PYAP_19753
Length=1340

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 54/117 (46%), Gaps = 16/117 (14%)

Query  1    MHVNLSKI-HQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGS  59
            M    SKI H+    GY+ KRG   +S+KRRYM LNG TL  SYY  K         K  
Sbjct  145  MDSQTSKITHENDISGYLRKRGEHNRSYKRRYMELNGATL--SYYKKKP-------EKNG  195

Query  60   FVLSECEKQDLS------DEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWL  110
              LS  +K+         D  +S++P   +  G       + +++  ES+ D  +WL
Sbjct  196  IPLSRDDKKSYERGSIDLDRVSSIQPIDSEPFGMHLVTTTRTWAISAESEQDFLRWL  252

>PYVX_14527
Length=1269

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/97 (32%), Positives = 47/97 (48%), Gaps = 14/97 (14%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDEG  74
            G+V K+G L+++WK+R+MVL+G  L  +YYD+  + T     KGSF L   E       G
Sbjct  903  GWVYKQGSLVRNWKKRFMVLHGRQL--TYYDTARL-TPSVKAKGSFTLITVELSTEIQNG  959

Query  75   ASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLN  111
              V            G+G +   +Y +S    + W N
Sbjct  960  LLVH-----------GRGGRVLKLYTDSAESTSMWYN  985

 Score = 40.4 bits (93),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 24/34 (71%), Gaps = 2/34 (6%)

Query  15    GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKE  48
             G++ K G  +KSWKRR+  L GD L  SY+DS++
Sbjct  1049  GWLKKEGSRVKSWKRRFFALRGDAL--SYFDSED  1080

 Score = 35.4 bits (80),  Expect = 0.61, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 23/35 (66%), Gaps = 2/35 (6%)

Query  10   QTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYY  44
            Q +  G+V K G L++SWK+R++V  G  L  +YY
Sbjct  584  QVTYAGWVFKEGSLVRSWKKRFLVAKGADL--AYY  616

 Score = 33.5 bits (75),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 0/28 (0%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTLLVS  42
            G++ K G   K+WK+RY VL G+ L  S
Sbjct  714  GWLEKEGQHFKTWKKRYFVLRGNRLTYS  741

>H310_00209
Length=1198

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 57/119 (48%), Gaps = 13/119 (11%)

Query  3    VNLSKIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVL  62
            +N       + EGY++K+G L+ +WK  Y VL G TL +  YDS+E + +    K   +L
Sbjct  250  INKDAFGGIAFEGYLSKKGDLLAAWKSCYCVLEGLTLAI--YDSREDFMADAGLKVRVIL  307

Query  63   SECEKQDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNS  121
                  D++D+ A  +P GF        +G+K   +   +  +Q +W+      L K +
Sbjct  308  V-----DVNDDVA--RPHGFAI----KTEGHKTLHLASRTAFEQEQWVRAIRLQLTKGN  355

>PITG_20103
Length=1301

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 40/75 (53%), Gaps = 8/75 (11%)

Query  12   SCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLS  71
            S EGY++K+  ++ SWK  Y VL  DTL  ++Y+++E + S     G   L   E +D+ 
Sbjct  224  SFEGYLSKKSDVLMSWKATYCVLEEDTL--AFYETREDFISNSKLIGRIQLQSIEDEDMG  281

Query  72   DEGASVKPFGFKFIG  86
                  KP GF+ I 
Sbjct  282  ------KPNGFRVIA  290

>SPRG_00890
Length=883

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/123 (24%), Positives = 61/123 (50%), Gaps = 14/123 (11%)

Query  9    HQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQ  68
            H+   EGYV K+G  +  W+ RY+VL+G +L  +YY++K+   S  + +G  +++    +
Sbjct  26   HEVHWEGYVRKKGDWLPRWEERYLVLDGASL--TYYNTKDEARSGRNLRGRMIITRVLPE  83

Query  69   DLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNAL--GKNSSPQKS  126
            +        K  GF        +G+K + +   +++++  W+ +   A+  G +  P  +
Sbjct  84   NYG------KAHGFLI----ETKGHKHFHLCCTTELEKDMWVEMMQAAIDEGISHPPHLT  133

Query  127  MSQ  129
              Q
Sbjct  134  TQQ  136

>PHYRA_79348
Length=1240

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 39/73 (53%), Gaps = 8/73 (11%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDE  73
            EGY++K+  ++ SWK  Y VL  DTL  ++YD++E + S     G   L   E +D+   
Sbjct  268  EGYLSKKSDVLMSWKATYCVLEEDTL--AFYDTREDFISNTKLIGRIQLQGIEDEDMG--  323

Query  74   GASVKPFGFKFIG  86
                KP GF+ I 
Sbjct  324  ----KPNGFRLIA  332

>H257_03093
Length=975

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/109 (24%), Positives = 56/109 (51%), Gaps = 12/109 (11%)

Query  9    HQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQ  68
            H+   EGYV K+G  +  W+ RY+VL+G +L  +YY+SK+   +  + +G  ++++    
Sbjct  99   HEVHWEGYVRKKGDWLPRWEERYLVLDGASL--TYYNSKDEARTGTNLRGRMIITKV---  153

Query  69   DLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNAL  117
             L +       F  + +GH      K + +   +++++  W+ +   A+
Sbjct  154  -LPENYGKAHGFLIETMGH------KHFHLCCTTELEKDMWVEMMQAAI  195

>PYAP_22195
Length=901

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 45/106 (42%), Gaps = 10/106 (9%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDE  73
            EGY+ K+G  +K WKRR+ V NG TL  SYY S++       P     L  C  +D    
Sbjct  38   EGYLQKKGQRLKGWKRRWFVCNGRTL--SYYISRK----DRKPNAVIPLETCTVED----  87

Query  74   GASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGK  119
            G   + +    I    G     Y +  E       WL V  NA+ K
Sbjct  88   GGLSETWNSPRIYLTDGTSGVMYCLSAEDAEVVNAWLTVLRNAVAK  133

>SPRG_17022
Length=107

 Score = 42.7 bits (99),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/45 (42%), Positives = 29/45 (64%), Gaps = 2/45 (4%)

Query  4   NLSKIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKE  48
           +   I  T  EGY+ K+GH++++W+ RY VL+G     +YY SKE
Sbjct  25  SFEDIMDTDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKE  67

>PYAR_24323
Length=883

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/110 (31%), Positives = 48/110 (44%), Gaps = 17/110 (15%)

Query  9    HQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQ  68
            H+    GY+ KRG   +S+KRRYM LNG  L  +YY  K      G P        CE+ 
Sbjct  150  HENDISGYLRKRGEHNRSYKRRYMELNGSVL--AYYKKKP--EKNGIPLSREDKKSCERG  205

Query  69   DLS-DEGASVK-------PFGFKFIGHCPGQGYKEYSVYVESQIDQTKWL  110
             +  D   S++       PFG   +        + +S+  ES  D  +WL
Sbjct  206  AIDLDRVTSIQPIDAKSEPFGINLV-----TTNRTWSIAAESDQDYQRWL  250

>H257_13567
Length=836

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 28/36 (78%), Gaps = 2/36 (6%)

Query  13  CEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKE  48
            EG+V K+GHL+++WK RY  L G+  L+SYY++KE
Sbjct  60  WEGFVQKKGHLVRNWKVRYFTLEGN--LLSYYETKE  93

>SPRG_16312
Length=261

 Score = 45.1 bits (105),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 34/57 (60%), Gaps = 6/57 (11%)

Query  15  GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSF-VLSECEKQDL  70
           GYV K+G  +K+WKRR+MVL+ DTL   YY S+    +   P+G F V S     DL
Sbjct  43  GYVRKQGSFVKNWKRRFMVLHDDTLF--YYVSER---AMAKPRGFFRVTSVAYAPDL  94

>PHYSO_350197
Length=557

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 50/106 (47%), Gaps = 14/106 (13%)

Query  27   WKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDEGASVKPFGFKFIG  86
            WK+RY V+  D L + Y+ S E +  +   +G    S     D        KP GF+F  
Sbjct  42   WKKRYCVVYKDELQIVYFLSLEDFEKRAI-RGKIPFSSVHAWD-------GKPNGFQF--  91

Query  87   HCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSPQKSMSQRIE  132
            + P      + VY E+  DQ KWL V   AL  +++P K   +++E
Sbjct  92   YTPSNNC--FRVYTETPEDQLKWLEVMQKAL--DNAPDKKDGEKVE  133

>SDRG_14486
Length=308

 Score = 45.1 bits (105),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 35/53 (66%), Gaps = 3/53 (6%)

Query  14  EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECE  66
           +G+V K+G L++SWK+RYMVL    L  SY+D++ + T+    KGSF +   E
Sbjct  7   QGWVFKQGSLVRSWKKRYMVLKNKQL--SYFDTENV-TASTKAKGSFAVITIE  56

 Score = 38.9 bits (89),  Expect = 0.034, Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 29/47 (62%), Gaps = 5/47 (11%)

Query  13   CEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGS  59
            C G++ K G  +K+WKRR+  L G +L  +YYD+ ++    G  KG+
Sbjct  137  CSGWLAKEGGRVKNWKRRFFFLQGRSL--TYYDNDKM---AGSAKGN  178

>SDRG_01407
Length=815

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/109 (24%), Positives = 56/109 (51%), Gaps = 12/109 (11%)

Query  9    HQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQ  68
            H+   EGYV K+G  +  W+ RY+VL+G +L  +YY++K+   S  + +G  +++    +
Sbjct  80   HEVHWEGYVRKKGDWLPRWEERYLVLDGASL--TYYNTKDEARSGRNLRGRMIITRVLPE  137

Query  69   DLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNAL  117
            +        K  GF        +G+K + +   +++++  W+ +   A+
Sbjct  138  NYG------KAHGFLI----ETKGHKHFHLCCTTELEKDMWVEMMQAAI  176

>PYIR_17453
Length=2619

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 68/147 (46%), Gaps = 28/147 (19%)

Query  13    CEGYVTKRGHLM-KSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDL-  70
             CEGYV  R H +  +W+ R+ VL  DT L  Y D+     S+G  + +      EK DL 
Sbjct  2160  CEGYVRVRHHFLGAAWRERFAVLE-DTRLYLYPDTSAAL-SEGREQKAL-----EKHDLI  2212

Query  71    ----------SDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKN  120
                       ++ G     FGF+        GY E +V +E +  QTKWL    NA+ + 
Sbjct  2213  AVKKWHPTYSTNLGNGSSRFGFRVENE--AGGYLECTVIIEDE--QTKWLAAITNAVSEI  2268

Query  121   SS--PQKSMSQRIEEITGPLLPCASVQ  145
             S+    K M++   +   P +P A+++
Sbjct  2269  STHVSSKVMTR---DAALPFIPGAAME  2292

 Score = 38.5 bits (88),  Expect = 0.065, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query  14    EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKG-HPKGSF  60
             EGY+ KRGHL+ S ++RY VL  +TL   Y+ + E   +    P GSF
Sbjct  1222  EGYLVKRGHLIPSMRKRYCVLVKNTL--EYFATHEDSRNPAIRPHGSF  1267

>H257_09028
Length=556

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 71/155 (46%), Gaps = 29/155 (19%)

Query  11   TSCEGYVTKRGHLMKS--WKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQ  68
            T C GYV  + H   S  WK+RY VL  ++L + +YD+ E  T +G  KG    S     
Sbjct  20   TLCTGYVYNQ-HEKNSIIWKKRYCVLQENSLYIFHYDNAEAAT-QGELKGKIPYSSVHDW  77

Query  69   DLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSPQKSMS  128
                EG   KP GF+F  + P    K Y VY +++ ++ KW+          S+ QK + 
Sbjct  78   ----EG---KPHGFQF--YTPTN--KCYKVYTDTEEEKLKWV----------STMQKQLD  116

Query  129  QRIEEITGPLLPC----ASVQLNCPRRDMIHITTL  159
               +   G  +P     AS  +  PR+   H ++L
Sbjct  117  DAPDVPDGEQVPYARFGASSPVGSPRQGGGHPSSL  151

>SPRG_02753
Length=309

 Score = 45.1 bits (105),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 35/53 (66%), Gaps = 3/53 (6%)

Query  14  EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECE  66
           +G+V K+G L++SWK+RYMVL    L  SY+D++ + T+    KGSF +   E
Sbjct  7   QGWVFKQGSLVRSWKKRYMVLKNKQL--SYFDTENV-TASTKAKGSFAVITIE  56

 Score = 38.9 bits (89),  Expect = 0.035, Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 29/47 (62%), Gaps = 5/47 (11%)

Query  13   CEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGS  59
            C G++ K G  +K+WKRR+  L G +L  +YYD+ ++    G  KG+
Sbjct  138  CSGWLAKEGGRVKNWKRRFFFLQGRSL--TYYDNDKM---AGSAKGN  179

>PPTG_06823
Length=1321

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 40/75 (53%), Gaps = 8/75 (11%)

Query  12   SCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLS  71
            S EGY++K+  ++ SWK  Y VL  DTL  ++Y+++E + S     G   L   E +D+ 
Sbjct  247  SFEGYLSKKSDVLMSWKATYCVLEEDTL--AFYETREDFISNSKLIGRIQLQGIEDEDMG  304

Query  72   DEGASVKPFGFKFIG  86
                  KP GF+ I 
Sbjct  305  ------KPNGFRVIA  313

>H257_06698
Length=1199

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 59/120 (49%), Gaps = 13/120 (11%)

Query  2    HVNLSKIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFV  61
            H+N   +   + EGY++K+G L+ +WK  Y VL G TL +  YDS+E + +    K   +
Sbjct  245  HMNKDSLGGIAFEGYLSKKGDLLAAWKSCYCVLEGLTLAI--YDSREDFMADVGLKVRVI  302

Query  62   LSECEKQDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNS  121
            L E     ++D+ A  KP GF        +G+K   +   +  ++ +W+      L K +
Sbjct  303  LLE-----VNDDVA--KPHGFAI----KTEGHKTQHLASRTAFEKEQWIRAIRLQLVKGN  351

>H310_12448
Length=555

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 49/99 (49%), Gaps = 13/99 (13%)

Query  13   CEGYVTKRGHLMKS-WKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLS  71
            C GYV  +       WK+RY VL  ++L + +YDS E   +KG  KG    S        
Sbjct  22   CTGYVYNQPEKNSIIWKKRYCVLQENSLYIFHYDSAEA-AAKGELKGKIPYSSVHDW---  77

Query  72   DEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWL  110
             EG   KP GF+F  + P    K Y VY +++ ++ KW+
Sbjct  78   -EG---KPHGFQF--YTPTN--KCYKVYTDTEDEKVKWI  108

>PHYKE_4911
Length=46

 Score = 40.4 bits (93),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 17/35 (49%), Positives = 27/35 (77%), Gaps = 2/35 (6%)

Query  15  GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEI  49
           G+V K+G L+K+WK+R+MVL G  L  +YYD+ ++
Sbjct  9   GWVYKQGSLVKNWKKRFMVLRGRQL--TYYDTAKM  41

>HYAP_11712
Length=558

 Score = 45.1 bits (105),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/127 (28%), Positives = 54/127 (43%), Gaps = 24/127 (19%)

Query  27   WKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDEGASVKPFGFKFI-  85
            WK+RY V+  + L + Y+ S E +  +   +G    S     D        KP GF+F  
Sbjct  42   WKKRYCVIYANELQIVYFLSLEDFERRTI-RGKIPFSSVHAWD-------GKPNGFQFYT  93

Query  86   --GHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSPQKSMSQRIEEITGPLLPCAS  143
               HC       + VY E+  DQ KWL V    +  +++P +    R+E +     P AS
Sbjct  94   PADHC-------FRVYTETAADQLKWLEVMQKCI--DNAPDRKDGARVEYVR----PVAS  140

Query  144  VQLNCPR  150
                 P+
Sbjct  141  SPAASPK  147

>PYU1_G006732
Length=954

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 50/116 (43%), Gaps = 10/116 (9%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDE  73
            EGY+ K+G  +K WKRR+ V +  TL  SYY S++       P     L  C  QD    
Sbjct  21   EGYLQKKGQRLKGWKRRWFVCDARTL--SYYISRK----DRKPNAVIPLEGCSVQD----  70

Query  74   GASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSPQKSMSQ  129
            G   + +    I    G     Y +  E     T+WL V  NA+ K +    S S+
Sbjct  71   GGLSETWNSPRIYLTDGTNGVMYCLSSEDGEAVTQWLAVLRNAVAKVNGTSDSASE  126

>CCI43793
Length=1117

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 26/40 (65%), Gaps = 0/40 (0%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKG  54
            GY+ K+G   KSW+RR+ +L  D  +++YY SKE  T  G
Sbjct  175  GYLVKQGSFWKSWRRRFFILRRDIPVLAYYASKEHLTKLG  214

>PHALS_09729
Length=949

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 51/108 (47%), Gaps = 14/108 (13%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQD--LS  71
            EG++ K+G  +K WKRR+ V +G TL  SYY S++       P     L  C  QD  LS
Sbjct  38   EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISRK----DRRPNAVIPLEGCTVQDGGLS  91

Query  72   DEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGK  119
            +   S + +        P  G   Y +  E  I  T+WL+V   A+ +
Sbjct  92   ETWNSPRIYLTD-----PATGIM-YCLSAEEGIVVTQWLDVLQVAVAR  133

>SDRG_05150
Length=787

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 28/41 (68%), Gaps = 2/41 (5%)

Query  8   IHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKE  48
           I  T  EGY+ K+GH++++W+ RY VL+G     +YY SKE
Sbjct  29  IMDTDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKE  67

>PHYSO_478611
Length=522

 Score = 44.7 bits (104),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 57/123 (46%), Gaps = 17/123 (14%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEI-YTSKGHPKGSFVLSECEKQDLSDE  73
            G+V K+G L+K+WK+R+MVL G  L  +YYD+ ++  T K   KGSF +   E       
Sbjct  141  GWVYKQGSLVKNWKKRFMVLRGRQL--TYYDTAKVDPTVKA--KGSFQVITVELSTDIQN  196

Query  74   GASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSPQKSMSQRIEE  133
            G  V            G+G +   +Y  S    + W N+  +A    + PQ +   R   
Sbjct  197  GLLVH-----------GRGGRVLKLYTASAEATSSWYNMILDATA-TAPPQFAPPDRFST  244

Query  134  ITG  136
            ++ 
Sbjct  245  LSA  247

 Score = 41.2 bits (95),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 31/47 (66%), Gaps = 3/47 (6%)

Query  10   QTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEI-YTSKGH  55
            Q +  G++ K G  +KSWKRRY VL G+ L  SY++S++    +KG+
Sbjct  278  QVAHSGWLKKEGARVKSWKRRYFVLRGNAL--SYFNSEDTGAAAKGY  322

>PYU1_G012870
Length=352

 Score = 44.3 bits (103),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 34/52 (65%), Gaps = 3/52 (6%)

Query  15  GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECE  66
           G+V K+G L+++WK+R+MVL G  L  +YYD+  I + K   KGSF +   E
Sbjct  7   GWVFKQGSLVRNWKKRFMVLRGKQL--TYYDTASI-SPKTKEKGSFQVITAE  55

 Score = 40.4 bits (93),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 36/62 (58%), Gaps = 8/62 (13%)

Query  8    IHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSK---GHPKGSFVLSE  64
            IH +   G++ K G  +K+WK+RY  L+G+TL  SYYDS +  ++    GH K   V  E
Sbjct  150  IHHS---GWLKKEGSRIKNWKKRYFTLHGNTL--SYYDSADTGSAAKGYGHVKSVEVNGE  204

Query  65   CE  66
             E
Sbjct  205  RE  206

>SPRG_08346
Length=797

 Score = 44.7 bits (104),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 28/41 (68%), Gaps = 2/41 (5%)

Query  8   IHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKE  48
           I  T  EGY+ K+GH++++W+ RY VL+G     +YY SKE
Sbjct  29  IMDTDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKE  67

>H257_07514
Length=810

 Score = 44.7 bits (104),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 28/41 (68%), Gaps = 2/41 (5%)

Query  8   IHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKE  48
           + +T  EGYV K+GH++++W+ RY +L G     +YY SKE
Sbjct  47  LFETDWEGYVWKQGHVVRNWRNRYGILTGTCF--TYYSSKE  85

>H310_07701
Length=811

 Score = 44.7 bits (104),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 28/41 (68%), Gaps = 2/41 (5%)

Query  8   IHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKE  48
           + +T  EGYV K+GH++++W+ RY +L G     +YY SKE
Sbjct  47  LFETDWEGYVWKQGHVVRNWRNRYGILTGTCF--TYYSSKE  85

>PYU1_G012859
Length=1183

 Score = 44.7 bits (104),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 57/125 (46%), Gaps = 20/125 (16%)

Query  10   QTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQD  69
            Q++C G++ K+G  +K+WKRRY  L+G TL    Y  +E     G    SF +S  EKQ 
Sbjct  808  QSNCHGWLNKQGGTIKTWKRRYFSLHGTTLR---YFKRET----GSMLRSFTISHVEKQP  860

Query  70   LSDEGASV-KPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSPQKSMS  128
                G  V    G K +            +  ES+ D  +WL     ++   SS  KS +
Sbjct  861  QVALGLEVMTTSGRKLM------------LTAESKEDYGRWLRALQASISAESSVPKSPT  908

Query  129  QRIEE  133
              +++
Sbjct  909  APVQQ  913

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 22/38 (58%), Gaps = 0/38 (0%)

Query  2    HVNLSKIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTL  39
            H   S     +CEG++ K+GH  K WKRRY  LN D L
Sbjct  348  HTLPSSASSQTCEGWLLKQGHKSKRWKRRYFTLNNDML  385

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 23/25 (92%), Gaps = 0/25 (0%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTL  39
            G++ K+GHL++SWK+RY VL+GD+L
Sbjct  497  GWLLKQGHLIRSWKQRYFVLHGDSL  521

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 51/117 (44%), Gaps = 16/117 (14%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDE  73
            +G++ K G  MK+WK+R++VL G+ L  SYY  +   T    P GS V+ + E       
Sbjct  197  KGWLLKEGKRMKNWKKRFVVLRGNVL--SYYADE---TPSSPPLGSLVIRQVETN-----  246

Query  74   GASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSPQKSMSQR  130
                  F   F      +G +   +  +S  D   W  V   A+  +SS  + M  R
Sbjct  247  ------FTTPFTLDVHTEGGRILRIAADSLDDIEAWDLVLSQAVSGDSSDNQEMDSR  297

 Score = 35.0 bits (79),  Expect = 0.90, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 21/32 (66%), Gaps = 2/32 (6%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYD  45
            EG++ K+G   K+WK+RY VL    L+  YYD
Sbjct  613  EGWLLKKGQNFKTWKQRYFVLERSRLM--YYD  642

>PHYCA_564296
Length=957

 Score = 44.7 bits (104),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 51/108 (47%), Gaps = 14/108 (13%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQD--LS  71
            EG++ K+G  +K WKRR+ V +G TL  SYY S++       P     L  C  QD  LS
Sbjct  38   EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISRK----DRKPNAVIPLEGCTVQDGGLS  91

Query  72   DEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGK  119
            +   S + +        P  G   Y +  E  I  T+WL+V   A+ +
Sbjct  92   ETWNSPRIYLTD-----PATGIM-YCLSAEEGIVVTQWLDVLRVAVAR  133

>PHYSO_558498
Length=967

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 51/108 (47%), Gaps = 14/108 (13%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQD--LS  71
            EG++ K+G  +K WKRR+ V +G TL  SYY S++       P     L  C  QD  LS
Sbjct  38   EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISRK----DRKPNAVIPLEGCTVQDGGLS  91

Query  72   DEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGK  119
            +   S + +        P  G   Y +  E  I  T+WL+V   A+ +
Sbjct  92   ETWNSPRIYLTD-----PATGIM-YCLSAEEGIVVTQWLDVLRVAVAR  133

>H257_06469
Length=76

 Score = 40.4 bits (93),  Expect = 0.001, Method: Composition-based stats.
 Identities = 16/30 (53%), Positives = 23/30 (77%), Gaps = 0/30 (0%)

Query  14  EGYVTKRGHLMKSWKRRYMVLNGDTLLVSY  43
           EGYV K+GH++KSW+RRY  L+  T ++ Y
Sbjct  2   EGYVFKQGHVVKSWQRRYFRLDTSTSVLEY  31

>SDRG_06288
Length=641

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 34/56 (61%), Gaps = 3/56 (5%)

Query  13  CEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQ  68
             G+V K+G L+KSWK+R++V+ G    VSYYD + ++      KGS VL +  + 
Sbjct  5   WSGFVFKQGSLIKSWKKRFLVVQGRH--VSYYD-RSVHEPDPREKGSLVLGDVTQN  57

 Score = 34.3 bits (77),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 13/31 (42%), Positives = 21/31 (68%), Gaps = 2/31 (6%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYY  44
             G++ K G  +++WKRRY VL GD   ++Y+
Sbjct  167  RGWLYKEGQRVRNWKRRYFVLTGDH--IAYF  195

 Score = 34.3 bits (77),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 20/29 (69%), Gaps = 0/29 (0%)

Query  12   SCEGYVTKRGHLMKSWKRRYMVLNGDTLL  40
            S  G++ K G  +KSWKRR+  L+G T+L
Sbjct  360  SHHGWLQKEGSGVKSWKRRFFTLHGRTIL  388

 Score = 31.6 bits (70),  Expect = 8.4, Method: Compositional matrix adjust.
 Identities = 15/43 (35%), Positives = 27/43 (63%), Gaps = 1/43 (2%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPK  57
            G + K+G  +K+W++RY  ++G +  +SY D+ E    KG+ K
Sbjct  263  GILLKKGRTVKAWRKRYFSIDGVSNQLSYSDA-ETEPPKGYGK  304

>PITG_10462
Length=1028

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 51/108 (47%), Gaps = 14/108 (13%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQD--LS  71
            EG++ K+G  +K WKRR+ V +G TL  SYY S++       P     L  C  QD  LS
Sbjct  118  EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISRK----DRKPNAVIPLEGCTVQDGGLS  171

Query  72   DEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGK  119
            +   S + +        P  G   Y +  E  I  T+WL+V   A+ +
Sbjct  172  ETWNSPRIYLTD-----PATGIM-YCLSAEEGIVVTQWLDVLRVAVAR  213

>PHYRA_82040
Length=1054

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 51/108 (47%), Gaps = 14/108 (13%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQD--LS  71
            EG++ K+G  +K WKRR+ V +G TL  SYY S++       P     L  C  QD  LS
Sbjct  143  EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISRK----DRKPNAVIPLEGCTVQDGGLS  196

Query  72   DEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGK  119
            +   S + +        P  G   Y +  E  I  T+WL+V   A+ +
Sbjct  197  ETWNSPRIYLTD-----PATGIM-YCLSAEEGIVVTQWLDVLRVAVAR  238

>PPTG_08785
Length=944

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 51/108 (47%), Gaps = 14/108 (13%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQD--LS  71
            EG++ K+G  +K WKRR+ V +G TL  SYY S++       P     L  C  QD  LS
Sbjct  38   EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISRK----DRKPNAVIPLEGCTVQDGGLS  91

Query  72   DEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGK  119
            +   S + +        P  G   Y +  E  I  T+WL+V   A+ +
Sbjct  92   ETWNSPRIYLTD-----PATGIM-YCLSAEEGIVVTQWLDVLRVAVAR  133

>PYAP_16658
Length=294

 Score = 43.5 bits (101),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 24/34 (71%), Gaps = 0/34 (0%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKE  48
            GY+ K+G   K+WKRRY +L  D  +++YY S+E
Sbjct  152  GYLVKQGSFWKTWKRRYFILRRDINVLAYYTSQE  185

>CCI43456
Length=126

 Score = 41.6 bits (96),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/64 (30%), Positives = 33/64 (52%), Gaps = 7/64 (11%)

Query  2   HVNLSKIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFV  61
           ++++ +I   + EG +TKR   MK W++RY +L G+ L  S        +    P G   
Sbjct  9   NLSIDRIQNPAFEGELTKRSMWMKEWRKRYFILKGNKLYFS-------KSKNDAPHGFID  61

Query  62  LSEC  65
           L++C
Sbjct  62  LADC  65

>PYVX_16714
Length=1030

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 46/106 (43%), Gaps = 10/106 (9%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDE  73
            EG++ K+G  +K WKRR+ V +G  L  SYY S++       P     L  C  QD    
Sbjct  160  EGFLQKKGQRLKGWKRRWFVCDGRAL--SYYISRK----DRKPNAVIPLEGCTVQD----  209

Query  74   GASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGK  119
            G   + +    I    G     Y +  E     T+WL V  NA+ +
Sbjct  210  GGISETWNSPRIYLTDGATGVMYCLSAEDGTAVTQWLAVLRNAVAR  255

>PHYCA_504801
Length=398

 Score = 43.5 bits (101),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 56/112 (50%), Gaps = 18/112 (16%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIY-TSKGHPKGSFVLSECEKQDLSDE  73
            G+V K+G L+K+WK+R+MVL G  L  +YYD+ ++  T+K   KGSF +   E       
Sbjct  12   GWVYKQGSLVKNWKKRFMVLRGRQL--TYYDTAKVNPTTKA--KGSFQVITVELSTDIQN  67

Query  74   GASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSPQK  125
            G  V            G+G +   +Y  S    + W N+  +A    ++PQ+
Sbjct  68   GLLVH-----------GRGGRVLKLYTASAEATSAWYNMILDA--TTAAPQQ  106

 Score = 40.8 bits (94),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 27/39 (69%), Gaps = 2/39 (5%)

Query  10   QTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKE  48
            Q +  G++ K G  +KSWKRRY VL G+ L  SY++S++
Sbjct  151  QVTHSGWLKKEGARVKSWKRRYFVLRGNAL--SYFNSED  187

>PYIW_20891
Length=291

 Score = 43.1 bits (100),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 33/52 (63%), Gaps = 3/52 (6%)

Query  9   HQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSF  60
           H     G+V K+G L+++WK+R++VL G  L  +YYD+  + T K   KGSF
Sbjct  3   HDGEHAGWVFKQGSLVRNWKKRFLVLRGKQL--TYYDTASL-TPKTKEKGSF  51

 Score = 40.0 bits (92),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 35/58 (60%), Gaps = 8/58 (14%)

Query  4    NLSKIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSK---GHPKG  58
             ++ IH     G++ K G  +K+WK+RY  L+G+TL  SY+DS +  ++    GH KG
Sbjct  89   GVASIHHA---GWLKKEGSRVKNWKKRYFTLHGNTL--SYFDSADTGSAAKGYGHVKG  141

>PHYSO_315255
Length=1301

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 40/75 (53%), Gaps = 8/75 (11%)

Query  12   SCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLS  71
            + EGY++K+  ++ SWK  Y VL  DTL  ++Y+++E + S     G   L   E +D+ 
Sbjct  224  AFEGYLSKKSDVLMSWKATYCVLEEDTL--AFYETREDFISNTKLIGRIQLQGIEHEDMG  281

Query  72   DEGASVKPFGFKFIG  86
                  KP GF+ I 
Sbjct  282  ------KPNGFRVIA  290

>HYAP_09304
Length=1144

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 23/34 (68%), Gaps = 0/34 (0%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKE  48
            GY+ K+G   KSW+RR+ +L  D  ++SYY S E
Sbjct  125  GYLVKQGSFWKSWRRRFFILRRDCPVLSYYTSAE  158

>PHYKE_1044
Length=521

 Score = 43.5 bits (101),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 51/108 (47%), Gaps = 14/108 (13%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQD--LS  71
            EG++ K+G  +K WKRR+ V +G TL  SYY S++       P     L  C  QD  LS
Sbjct  38   EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISRK----DRKPNAVIPLEGCTVQDGGLS  91

Query  72   DEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGK  119
            +   S + +        P  G   Y +  E  I  T+WL+V   A+ +
Sbjct  92   ETWNSPRIYLTD-----PATGIM-YCLSAEEGIVVTQWLDVLRVAVAR  133

>HYAP_01795
Length=856

 Score = 43.5 bits (101),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 62/129 (48%), Gaps = 18/129 (14%)

Query  10   QTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQD  69
            +   EGY+ K+  L+KSW  RY+ L   T  VS Y SK    +K   +G +V+    KQ 
Sbjct  114  EVEWEGYLYKQRKLVKSWTPRYITLQNRT--VSIYKSKTHALAKEQYRGQWVI----KQI  167

Query  70   LSD------EGASVKP--FGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNS  121
            LS        G+ +KP   GF F+      G   + +   S +++  W+++ H +L    
Sbjct  168  LSSLPSAGFGGSKLKPEELGFSFLA---ANGNMIHFI-AASAVEKAMWMHMMHLSLHNTK  223

Query  122  SPQKSMSQR  130
            + + SM Q+
Sbjct  224  TREVSMLQQ  232

>PHYKE_9146
Length=557

 Score = 43.5 bits (101),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 49/106 (46%), Gaps = 14/106 (13%)

Query  27   WKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDEGASVKPFGFKFIG  86
            WK+RY V+  D L ++Y+ S E +  K   +G    S     D        KP GF+F  
Sbjct  42   WKKRYCVVYKDELQITYFLSLEDF-EKRSIRGKIPFSSVHAWD-------GKPNGFQF--  91

Query  87   HCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSPQKSMSQRIE  132
            + P      + VY E+  DQ KWL V    L  ++SP K   + +E
Sbjct  92   YTPSNTC--FRVYTETAEDQLKWLEVMQKVL--DNSPDKKDGEFVE  133

>SPRG_09211
Length=549

 Score = 43.5 bits (101),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 42/147 (29%), Positives = 60/147 (41%), Gaps = 31/147 (21%)

Query  27   WKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDEGASVKPFGFKFIG  86
            WKRRY VL    L + YY+S+E   ++G  KG   +  C   D        KP GF+F  
Sbjct  34   WKRRYCVLQESALAIFYYESEEA-AAEGSLKGK--IPYCSVHDWDG-----KPHGFQF--  83

Query  87   HCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSPQKSMSQRIEEITGPLLPCASVQL  146
            + P    K + VY +S  ++ KW+          +S Q  +    E   G L P A    
Sbjct  84   YTPTN--KCFRVYCDSDDERNKWM----------TSMQAQLDNAPEVADGELAPYARNGA  131

Query  147  NCPRRDMIHITTLGHKESAGLMQSLEA  173
              P          G   +AG  ++L A
Sbjct  132  ASP---------TGSPRAAGSFRTLRA  149

>PHYRA_73430
Length=395

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 55/111 (50%), Gaps = 16/111 (14%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDEG  74
            G+V K+G L+++WK+R+MVL G  L  +YYD+ ++  +    KGSF +   E       G
Sbjct  12   GWVFKQGSLVRNWKKRFMVLRGRQL--TYYDTAKVDPTV-KAKGSFQVITVELSTDIQNG  68

Query  75   ASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSPQK  125
              V            G+G +   +Y  S    + W N+  +A   +++PQ+
Sbjct  69   LLVH-----------GRGGRVLKLYTASAEATSAWFNMILDA--TSAAPQQ  106

 Score = 42.0 bits (97),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 27/39 (69%), Gaps = 2/39 (5%)

Query  10   QTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKE  48
            Q +  G++ K G  +KSWKRRY VL G+ L  SY++S++
Sbjct  147  QVTHSGWIKKEGARVKSWKRRYFVLRGNAL--SYFNSED  183

>PYIW_17818
Length=1188

 Score = 43.5 bits (101),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 25/32 (78%), Gaps = 2/32 (6%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDS  46
            G++ K+G L+KSWKRRY VL GD+L   Y+D+
Sbjct  505  GWLLKQGSLIKSWKRRYFVLEGDSL--QYFDN  534

 Score = 40.0 bits (92),  Expect = 0.023, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query  13   CEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEI---YTSKGHPKGS  59
            C G++ K G  +K+WKRRY  L+G TL     + K++   YT   H  G+
Sbjct  830  CSGWLNKEGGTIKTWKRRYFSLHGTTLRYFKSERKKLLGSYTDALHAAGA  879

 Score = 36.6 bits (83),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 34/58 (59%), Gaps = 8/58 (14%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPK-GSFVLSECEKQDLS  71
            G++ K G  +KSWK+R+ VL G+ L  +YY+ +     +  PK G+ V+ + E   L+
Sbjct  179  GWLLKEGSKVKSWKKRFFVLRGNVL--TYYEDE-----RSSPKLGALVVRDVETNFLT  229

 Score = 36.6 bits (83),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 19/29 (66%), Gaps = 0/29 (0%)

Query  11   TSCEGYVTKRGHLMKSWKRRYMVLNGDTL  39
            ++CEG++ K+G   K WKRRY  L  D L
Sbjct  343  STCEGWLLKQGRASKQWKRRYFSLAHDQL  371

 Score = 34.7 bits (78),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 19/38 (50%), Gaps = 0/38 (0%)

Query  3    VNLSKIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLL  40
            VNL     TS  G++ K G   K+WKRRY       LL
Sbjct  935  VNLDGKTVTSYSGWLEKEGQRFKTWKRRYFTYKKGALL  972

 Score = 33.5 bits (75),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 22/35 (63%), Gaps = 0/35 (0%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKE  48
            EG++ K+G   K+WK+RY VL    L+    D+K+
Sbjct  627  EGWLFKKGQNFKTWKQRYFVLERTRLVYYASDAKD  661

 Score = 33.1 bits (74),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 6/48 (13%)

Query  15  GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVL  62
           G+ +K+G  +K+WK+R+ VL G  L+  YY      +S G  KG   +
Sbjct  10  GWGSKQGSKVKTWKKRFFVLRGRELV--YYSG----SSGGDEKGRLTI  51

>PYVX_13084
Length=1267

 Score = 43.5 bits (101),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 24/34 (71%), Gaps = 0/34 (0%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKE  48
            GY+ K+G   K+W+RRY VL  D  ++SY+ SK+
Sbjct  242  GYLVKQGSFWKTWRRRYFVLRRDLPVMSYFSSKD  275

>SDRG_02154
Length=822

 Score = 43.5 bits (101),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 26/97 (27%), Positives = 45/97 (46%), Gaps = 14/97 (14%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDE  73
             G++ K+G ++K+WKRR+MVL   +  + Y+++ ++ T    PKGSF +   E+      
Sbjct  127  RGWICKQGSVVKNWKRRFMVLQ--SCHLHYFETDKL-TPTLKPKGSFQVLAIERASDLQH  183

Query  74   GASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWL  110
            G   K           G G + +  Y +     T W 
Sbjct  184  GLVAK-----------GSGNRVFKFYADDAQSCTAWF  209

>CCA27157
Length=553

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 33/118 (28%), Positives = 58/118 (49%), Gaps = 21/118 (18%)

Query  15   GYVTKRGHLMKS-------WKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEK  67
            G +  RG L K        WK+RY V+  ++L + YY+++E +  KG  +G    +   K
Sbjct  23   GEILLRGFLYKRPEQNSLLWKKRYCVIVKNSLQIVYYENEEDF-EKGVIRGKIPFASVHK  81

Query  68   QDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSPQK  125
             D        KP GF+F  + P    K Y VY ++  +Q +W+ +    +  +++P+K
Sbjct  82   WD-------GKPNGFQF--YTPSN--KCYRVYTDTPKEQEEWVAIMQAQI--DAAPEK  126

>SPRG_11900
Length=605

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 53/113 (47%), Gaps = 20/113 (18%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDE  73
             G+V K+G L+KSWK+R++V+ G    V+YYD + ++      KGS VL +  +      
Sbjct  6    SGFVFKQGALIKSWKKRFLVVQGRH--VTYYD-RSVHEPNPREKGSLVLVDVTQN-----  57

Query  74   GASVKPFGFK--FIGH-CPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSP  123
                  FG K   + H   G+  K Y++   S  D  +       A G N+ P
Sbjct  58   ------FGLKNGLVLHDVKGRQMKMYTL---SATDLDECFTALQAACGANARP  101

 Score = 33.9 bits (76),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 44/100 (44%), Gaps = 20/100 (20%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSF--VLSECEKQDLSD  72
            GY+ K+G  +K+W++RY  ++G +  +SY D      + G P   F  V+  C       
Sbjct  239  GYLLKKGRTVKAWRKRYFSIDGVSNQLSYSD------ADGAPPKGFGHVVDVCVNTK---  289

Query  73   EGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNV  112
                 +PF   +I    G   +  +V   +Q +   WL V
Sbjct  290  -----RPFAL-YIHLASG---RRLAVAGSTQAEADTWLAV  320

 Score = 33.5 bits (75),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 13/31 (42%), Positives = 21/31 (68%), Gaps = 2/31 (6%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYY  44
             G++ K G  +++WKRR+ VL GD   V+Y+
Sbjct  143  RGWLYKEGQRVRNWKRRFFVLTGDH--VAYF  171

 Score = 32.0 bits (71),  Expect = 6.0, Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 19/26 (73%), Gaps = 0/26 (0%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTLL  40
            G++ K G  +KSWKRR+  L+G +L+
Sbjct  339  GWLQKEGSGVKSWKRRFFTLHGRSLV  364

>H257_03363
Length=316

 Score = 42.7 bits (99),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 89/205 (43%), Gaps = 32/205 (16%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDEG  74
            G+V K+G ++KSWK+RYMVL    L  +Y+++++I       KGSF +   E       G
Sbjct  8    GWVYKQGSMVKSWKKRYMVLKNKQL--TYFENEKI-EGNSKAKGSFQVITIEIAHDIKNG  64

Query  75   ASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSPQKSMSQRIEEI  134
              V            G G +   +Y +S      W+    NA+ + +S Q  +  ++  +
Sbjct  65   LLVH-----------GTGGRVMKLYTDSAESCEDWI----NAITQVTSAQPPLVPQV-SV  108

Query  135  TGPLLPCASVQLNCPRRDMIHITTLGHKESA-----------GLMQSLEAQMKNVKKTSQ  183
             GP+   +S+ L  P RD    +T+    ++           G +     +++N K+   
Sbjct  109  RGPVNGSSSLSL--PPRDSRSNSTVSSLRNSLTGDDDNGVCTGWLAKEGGRVRNWKRRYF  166

Query  184  ELLQQAINDAKEADRIGDATVNEMV  208
             L  +++     A+ IG A  N  V
Sbjct  167  SLQGRSLTYFDNANMIGAAKGNGQV  191

 Score = 37.0 bits (84),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 28/44 (64%), Gaps = 3/44 (7%)

Query  13   CEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKE-IYTSKGH  55
            C G++ K G  +++WKRRY  L G +L  +Y+D+   I  +KG+
Sbjct  147  CTGWLAKEGGRVRNWKRRYFSLQGRSL--TYFDNANMIGAAKGN  188

>H310_01921
Length=341

 Score = 42.7 bits (99),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 38/138 (28%), Positives = 65/138 (47%), Gaps = 20/138 (14%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDEG  74
            G+V K+G ++KSWK+RYMVL    L  +Y++S+++       KGSF +   E       G
Sbjct  24   GWVYKQGSMIKSWKKRYMVLKNKQL--TYFESEKV-EGNSKAKGSFQVITVEIAHDIKNG  80

Query  75   ASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSPQKSMSQRIEEI  134
              V            G G +   +Y ++     +W+    NA+ + +S Q  +  ++  +
Sbjct  81   LLVH-----------GTGGRVMKLYTDTAEGCEEWI----NAIAQATSGQPPLVAQV-SV  124

Query  135  TGPLLPCASVQLNCPRRD  152
             GPL    S  ++ P RD
Sbjct  125  RGPLNGSGS-SMSFPPRD  141

 Score = 37.0 bits (84),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (60%), Gaps = 5/47 (11%)

Query  13   CEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGS  59
            C G++ K G  +K+WKRRY  L G +L  +Y+D+  +    G  KG+
Sbjct  164  CFGWLAKEGGRVKNWKRRYFSLQGRSL--TYFDNANM---TGAAKGN  205

>CCA19118
Length=125

 Score = 40.4 bits (93),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 32/64 (50%), Gaps = 9/64 (14%)

Query  4   NLS--KIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFV  61
           NLS  +I   + EG +TKR   MK W++RY +L G+ L  S        +    P G   
Sbjct  8   NLSTERIQNPAFEGELTKRSMWMKEWRKRYFILKGNKLYFS-------KSKNDAPHGFID  60

Query  62  LSEC  65
           L++C
Sbjct  61  LADC  64

>SPRG_08326
Length=501

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 32/51 (63%), Gaps = 1/51 (2%)

Query  14   EGYVTKRGH-LMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLS  63
            EGY+ K+   + + W+RR+  ++  TL+++Y+ SKE       P+GSF LS
Sbjct  368  EGYLEKKSSSIFRGWERRWFKVDTRTLVLTYFHSKEDQMRGFAPRGSFALS  418

>SDRG_14771
Length=549

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 42/84 (50%), Gaps = 12/84 (14%)

Query  27   WKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDEGASVKPFGFKFIG  86
            WKRRY VL    L + YY+S+E   ++G  KG   +  C   D        KP GF+F  
Sbjct  34   WKRRYCVLQESALAIFYYESEEA-AAEGSLKGK--IPYCSVHDWDG-----KPHGFQF--  83

Query  87   HCPGQGYKEYSVYVESQIDQTKWL  110
            + P    K + VY +S  ++ KW+
Sbjct  84   YTPTN--KCFRVYCDSDDERNKWM  105

>PYU1_G012274
Length=873

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 28/108 (26%), Positives = 51/108 (47%), Gaps = 12/108 (11%)

Query  12   SCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLS  71
            S EGY+ K+  L++SWK  Y VL G+T+  +YY+S+E +       G   +   E   + 
Sbjct  310  SFEGYLNKKSDLLQSWKALYCVLEGETM--AYYESREDFIMNTKLIGRIHIQSVEDDHMG  367

Query  72   DEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGK  119
                  KP GF+ +     +G++   +   +  ++ +W      A+ K
Sbjct  368  ------KPNGFRIL----TEGHRTNHLSSRTAFEKDQWKRAITAAITK  405

>SDRG_05128
Length=512

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 32/51 (63%), Gaps = 1/51 (2%)

Query  14   EGYVTKRGH-LMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLS  63
            EGY+ K+   + + W+RR+  ++  TL+++Y+ SKE       P+GSF LS
Sbjct  376  EGYLEKKSSSIFRGWERRWFKVDTRTLVMTYFHSKEDQMRGFAPRGSFALS  426

>PHALS_02608
Length=557

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 56/124 (45%), Gaps = 18/124 (15%)

Query  27   WKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDEGASVKPFGFKFIG  86
            WK+RY V+    L + Y+ S + +  +   +G    S     D        KP GF+F  
Sbjct  42   WKKRYCVIYAGELQIVYFLSLDDFEKRAI-RGKIPFSSVHPWD-------GKPNGFQF--  91

Query  87   HCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSPQKSMSQRIEEITGPLLPCASVQL  146
            + P      + VY +S  +Q KWL+V    L  +++P K   +++E       P AS  L
Sbjct  92   YTPADNC--FRVYTDSAEEQQKWLDVMQQCL--DNAPDKKDGEKVEYTR----PVASSPL  143

Query  147  NCPR  150
            + P+
Sbjct  144  SSPK  147

>H257_16768
Length=137

 Score = 40.4 bits (93),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 37/143 (26%), Positives = 59/143 (41%), Gaps = 22/143 (15%)

Query  1    MHVNLSKIHQTSCEGYVTKRGH----LMKS-WKRRYMVLNGDTLLVSYYDSKEIYTSKGH  55
            MH   + +     EG + K+G     L +S WKRRY  L  + LL  Y+D  +     GH
Sbjct  1    MHATPTTVPVMIKEGSLFKKGAGGGLLHRSNWKRRYFKLTDNELL--YFDPTD-----GH  53

Query  56   PKGSFVLSEC-------EKQDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTK  108
             KG+  LS C       + +D +  G S     ++F    P    +   +  +++ D T 
Sbjct  54   LKGALNLSACGHGSLEIQPEDCTKTGTSASSGVWRFALRTPS---RRLVLAAKTEDDMTA  110

Query  109  WLNVAHNALGKNSSPQKSMSQRI  131
            W+      L  N      + QR+
Sbjct  111  WIQALQVVLDANEVKSTHIQQRM  133

>H310_14019
Length=683

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 30/45 (67%), Gaps = 2/45 (4%)

Query  11   TSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGH  55
            T+CEG++ K+G L+K+WK+R+  L G+ L  SY D +     KG+
Sbjct  342  TTCEGWLYKQGSLVKNWKKRWFTLLGEVL--SYRDMQSSVAIKGY  384

 Score = 39.7 bits (91),  Expect = 0.025, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 0/28 (0%)

Query  12   SCEGYVTKRGHLMKSWKRRYMVLNGDTL  39
            S EG++ KRG  +K+WKRRY  LNG  L
Sbjct  171  SFEGWLLKRGQRVKNWKRRYFTLNGQEL  198

>CCI41909
Length=282

 Score = 41.6 bits (96),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 50/112 (45%), Gaps = 16/112 (14%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDE  73
            +G++ K+   ++SW RRY  LNG  L  +Y+DS++I      P+G     +       D 
Sbjct  51   KGWMRKQKETLRSWPRRYFTLNGKVL--TYFDSEDISRP---PRGVIKFIDVSSLTTEDN  105

Query  74   GASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSPQK  125
            G S+            G   KE  +  ++ +  + WL V   AL K  S +K
Sbjct  106  GLSLH--------QASG---KEVRLIADTHVAYSAWLAVLSAALKKPESNKK  146

>PHYSO_343629
Length=977

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 23/30 (77%), Gaps = 0/30 (0%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSY  43
            EGYVTKRGHL+++WK R+  L G+ +  ++
Sbjct  130  EGYVTKRGHLVRNWKMRFFTLEGNLVSCTW  159

>SPRG_08834
Length=825

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 26/97 (27%), Positives = 45/97 (46%), Gaps = 14/97 (14%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDE  73
             G++ K+G ++K+WKRR+MVL   +  + Y+++ ++ T    PKGSF +   E+      
Sbjct  127  RGWICKQGSVVKNWKRRFMVL--QSCHLHYFETDKL-TPTLKPKGSFQVLVIERASDLQH  183

Query  74   GASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWL  110
            G   K           G G + +  Y +     T W 
Sbjct  184  GLVAK-----------GPGNRVFKFYADDAQSCTAWF  209

>H310_06666
Length=887

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 2/34 (6%)

Query  14  EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSK  47
           EGY+ K+G L+K WK+R+ V +G +L  SYY SK
Sbjct  24  EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYSSK  55

>HYAP_11713
Length=417

 Score = 42.0 bits (97),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 50/112 (45%), Gaps = 20/112 (18%)

Query  27   WKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDEGASVKPFGFKFI-  85
            WK+RY V+  + L + Y+ S E +  +   +G    S     D        KP GF+F  
Sbjct  42   WKKRYCVIYANELQIVYFLSLEDFERRTI-RGKIPFSSVHAWD-------GKPNGFQFYT  93

Query  86   --GHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSPQKSMSQRIEEIT  135
               HC       + VY E+  DQ KWL V    +  +++P +    R+++ T
Sbjct  94   PADHC-------FRVYTETAADQLKWLEVMQKCI--DNAPDRKDGARVDKST  136

>SPRG_04912
Length=261

 Score = 41.6 bits (96),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 28/46 (61%), Gaps = 5/46 (11%)

Query  15  GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSF  60
           GYV K+G  +K+WKRR M L+ DTL   YY S+    +   P+G F
Sbjct  43  GYVRKQGSFVKNWKRRIMALHDDTLF--YYVSER---AMAKPRGVF  83

>HYAP_07348
Length=973

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 50/108 (46%), Gaps = 14/108 (13%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQD--LS  71
            EG++ K+G  +K WKRR+ V +G TL  SYY SK+       P     L  C  +D  LS
Sbjct  40   EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISKK----DRKPNAVIPLEGCSVEDGGLS  93

Query  72   DEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGK  119
            +   S + +        P  G   Y +  E     T+WL+V   A+ +
Sbjct  94   ETWNSPRIYLTD-----PATGIM-YCLSAEEGTVVTQWLHVLRAAVAR  135

>HYAP_09511
Length=1295

 Score = 42.4 bits (98),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 27/101 (27%), Positives = 51/101 (50%), Gaps = 12/101 (12%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDE  73
            EGY++K+  ++ SWK  Y VL  DT+  ++Y+++E + S        ++   + Q + DE
Sbjct  243  EGYLSKKSDVLVSWKATYCVLEEDTM--AFYETREDFISNMK-----LIGRIQLQAIEDE  295

Query  74   GASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAH  114
             A  KP GF+ I     +G +   +   +  ++ +W    H
Sbjct  296  DAD-KPNGFRLI----AEGNRINHLSSRTAFEKEQWKRAIH  331

>CCI45895
Length=1721

 Score = 42.4 bits (98),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 58/125 (46%), Gaps = 6/125 (5%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDE  73
            EGY+ KRGH + S ++RY VL      + Y+++KE   ++G   GS  L E +  ++   
Sbjct  843  EGYLLKRGHRIPSMRKRYFVLQSVDPTLRYFETKE--DAEGFECGSKPLGEFQVANVCSW  900

Query  74   GASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSPQKSMSQRIEE  133
                     +       +  + Y     S+I++  W+   H+A+      ++++ +  E 
Sbjct  901  HGRTLTQTHRNGMQIEARDGRIYFCVASSEIEKENWIRAFHHAIAS----REALCEGPET  956

Query  134  ITGPL  138
            ++ PL
Sbjct  957  LSSPL  961

>CCA19033
Length=1883

 Score = 42.4 bits (98),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 52/180 (29%), Positives = 76/180 (42%), Gaps = 29/180 (16%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDE  73
            EGY+TK+ H     +RRY VL G  LL   Y +++ Y S   P+        E  D+ D 
Sbjct  108  EGYLTKKSHRFAQMQRRYCVLKGTMLLC--YLTQDEYKSHIVPRKVL-----EVVDVHDR  160

Query  74   GASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSPQKSMSQRIEE  133
            G S   F  + +G       + Y     S  +Q KW+N    AL +   P +   + IEE
Sbjct  161  GHS--SFEVEQLGG------RTYFCTCTSDSNQAKWMNAMKEALEE---PDRIAQEEIEE  209

Query  134  ITGPLLPCASVQLNCPRRDMIHITTLGHKESAGLMQS-----LEAQ-MKNVKKTSQELLQ  187
                L    + Q     R+ +   T   + + G  QS     LE Q MK ++   +E LQ
Sbjct  210  AQRFLFKEENDQ-----REAVEQATEAIRMAQGFTQSVVEIDLETQEMKLLQAKVEETLQ  264

 Score = 37.7 bits (86),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 58/128 (45%), Gaps = 12/128 (9%)

Query  14    EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDE  73
             EGY+ KRGH + S ++RY VL      + Y+++KE   S  +  G   L E +  ++ D 
Sbjct  1021  EGYLLKRGHRIPSMRKRYFVLQSVNETLRYFETKEDADSFQY--GLKALGEFQIGNVCDW  1078

Query  74    GASVKPFGFKF---IGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSPQKSMSQR  130
                     +K    +  C G   + Y     S+ ++  W+   H+A+      ++++ + 
Sbjct  1079  NGRTLTQTYKNGMQVEACDG---RVYFCAASSENERESWIRAFHHAIVS----REALCEA  1131

Query  131   IEEITGPL  138
              E +  PL
Sbjct  1132  PESLFSPL  1139

>PYU1_G011261
Length=1328

 Score = 42.0 bits (97),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 51/117 (44%), Gaps = 20/117 (17%)

Query  6    SKIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTS---------KGHP  56
            S +  T   G++ K+G   +S+KRRYM LNG  L  SYY  K    S         K + 
Sbjct  160  STVESTFISGFLRKKGEKNRSFKRRYMELNGTVL--SYYKKKPEKKSGIPLSAAEKKAYE  217

Query  57   KGSFVLSECEK-QDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNV  112
            +GS  L      Q + ++    +PFG   +        + + +  ES  D  +WL V
Sbjct  218  RGSIDLDRVSSLQPMENKS---EPFGIHLVTTA-----RTWVIAAESDQDYQRWLKV  266

>CCA26890
Length=1530

 Score = 42.0 bits (97),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 33/59 (56%), Gaps = 6/59 (10%)

Query  8    IHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTS----KGHPKGSFVL  62
            + + +  GY+ KRG   KS++RRYM LNG+ L  SYY  K    S    K  P+GS  L
Sbjct  290  VTEMAISGYLRKRGETNKSFRRRYMELNGNIL--SYYKKKPSTKSREENKTCPRGSIQL  346

>PYAP_16161
Length=889

 Score = 42.0 bits (97),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 60/139 (43%), Gaps = 15/139 (11%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDE  73
            EGY+ K+G ++K WK+R+ V +G TL  SYY S+        P     L  C  +D    
Sbjct  30   EGYLQKKGQMLKGWKQRWFVCDGRTL--SYYGSRR----DSKPSVVMELKYCTVED----  79

Query  74   GASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSPQKSMSQRIEE  133
            G   + +    I          Y +  E     T+WL V  N +G+ ++ ++   QR+  
Sbjct  80   GGRSETWNSTRIHLTDSATGTLYCLSSEDGQIATEWLTVLKNCIGRIATERR---QRLA-  135

Query  134  ITGPLLPCASVQLNCPRRD  152
             + P +P  S     P  D
Sbjct  136  -SQPSMPPQSAPAIKPAAD  153

>SDRG_08236
Length=864

 Score = 42.0 bits (97),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 48/112 (43%), Gaps = 22/112 (20%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDE  73
            EGY+ K+G L+K WK+R+ V +G +L  SYY    I +    P     L          E
Sbjct  23   EGYLQKKGQLLKGWKKRWFVCDGRSL--SYY----ISSKDKKPNAVIPL----------E  66

Query  74   GASVKPFGFKFIGHCP------GQGYKEYSVYVESQIDQTKWLNVAHNALGK  119
             ASV+  G     H P      G     Y +  E +   + WL+V   A+ +
Sbjct  67   SASVQDGGLSETWHSPRIYLTDGTSGTMYCLSAEEKGVASDWLSVLTKAVAR  118

>PPTG_18989
Length=1213

 Score = 42.0 bits (97),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 22/34 (65%), Gaps = 0/34 (0%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKE  48
            GY+ K+G   KSW+RR+ +L  D  ++ YY S E
Sbjct  188  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTSAE  221

>PYIR_23012
Length=965

 Score = 42.0 bits (97),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 44/106 (42%), Gaps = 10/106 (9%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDE  73
            EGY+ K+G  +K WKRR+ V +  TL  SYY    I      P     L  C  QD    
Sbjct  38   EGYLQKKGQRLKGWKRRWFVCDARTL--SYY----INRKDRKPNAVIPLEGCTVQD----  87

Query  74   GASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGK  119
            G   + +    I    G     Y +  E     T+WL V  NA+ K
Sbjct  88   GGLSETWNSPRIYLTDGTSGVMYCLSAEDGEAVTQWLLVLRNAVTK  133

>PPTG_09008
Length=1660

 Score = 42.0 bits (97),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 46/95 (48%), Gaps = 9/95 (9%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTLLVS--YYDSKEIY--TSKGHPKGSFVLSECEKQDL  70
            G++ K+ ++MK+WKRRY VL   T L +  Y+ S + Y  ++ G  +G   L +      
Sbjct  225  GWLFKQANVMKTWKRRYFVLTKRTNLATGEYWASLQYYRGSNFGKLRGEMHLQDGMSVRF  284

Query  71   SDEGASVKPFGFKFIGH-----CPGQGYKEYSVYV  100
             +   + +PF F+  G      C G    + S +V
Sbjct  285  LEPDETRRPFCFEVAGEDFSFVCSGSNDDDASAWV  319

>PYU1_G003229
Length=810

 Score = 41.6 bits (96),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 34/50 (68%), Gaps = 7/50 (14%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSE  64
            G++ K+GH MKSWKRR+ V+ G T  ++Y++  +++     PKGS V+ +
Sbjct  402  GWLNKQGHRMKSWKRRFFVVEGST--ITYFE--QVHE---DPKGSGVIQQ  444

 Score = 39.7 bits (91),  Expect = 0.029, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 11/50 (22%)

Query  11  TSCE--GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKG  58
           T C+  G+ +K+G ++KSWKRRY VL G  L         IY S+  P G
Sbjct  25  TYCDYSGWASKQGSIIKSWKRRYFVLKGREL---------IYFSERSPSG  65

 Score = 37.0 bits (84),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 32/62 (52%), Gaps = 10/62 (16%)

Query  13   CEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSD  72
            CEG++ KRG    +WK+R+  LNG  L   Y DS        +PKG   + + +   L D
Sbjct  260  CEGWLYKRGQRSTAWKKRFFTLNGFQL--QYQDS-----PGENPKGEGSVVDIQ---LGD  309

Query  73   EG  74
            EG
Sbjct  310  EG  311

 Score = 35.8 bits (81),  Expect = 0.49, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 21/34 (62%), Gaps = 2/34 (6%)

Query  13   CEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDS  46
            C G++ K G  +K+WK RY  L G TL  +Y+ S
Sbjct  702  CSGWLRKEGSTVKNWKLRYFTLKGTTL--TYFKS  733

 Score = 35.0 bits (79),  Expect = 0.83, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 20/29 (69%), Gaps = 0/29 (0%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVS  42
            +G++ K+G   K+WKRRY VL+G  L  S
Sbjct  520  KGWLMKKGKNFKTWKRRYFVLDGKKLSYS  548

>PHYRA_77134
Length=1267

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 51/108 (47%), Gaps = 25/108 (23%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKE----IYTSKGHPKGSFVLSECEKQDL  70
            G + KRG   K++K+RYM L+G TL  +YY  K     I  S+   KG      CEK ++
Sbjct  148  GVLRKRGEGFKAFKKRYMELDGSTL--AYYRKKPEKHGIPLSRDEKKG------CEKGNI  199

Query  71   SDEGAS--------VKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWL  110
              E  S         +PFGF  +        + + +  ES+++  +W+
Sbjct  200  DLEKVSSLQPMDNKSEPFGFLLVTTA-----RTWVLAAESEVEYHRWI  242

>PHALS_07930
Length=1200

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 22/34 (65%), Gaps = 0/34 (0%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKE  48
            GY+ K+G   KSW+RR+ +L  D  ++ YY S E
Sbjct  184  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTSAE  217

>PYAR_18690
Length=2455

 Score = 42.0 bits (97),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 35/117 (30%), Positives = 56/117 (48%), Gaps = 16/117 (14%)

Query  9     HQTSC---EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYY----DSKEIYTSKGHPKGSFV  61
             H+TS    EGY+ KRGHL+ S ++RY VL  + L  +YY    DS+   TS+  P GSF 
Sbjct  1130  HETSSILMEGYLVKRGHLVPSMRKRYCVLVKNVL--TYYLTQEDSRNSDTSQ--PLGSFR  1185

Query  62    LSECEKQDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALG  118
             +     + +SD         ++F         K +     S  ++T+W+   H+ + 
Sbjct  1186  V-----EIVSDWHGKTAMQTYEFGMELETHDGKTFFCAAFSSEEKTQWIRAFHHGIA  1237

 Score = 32.3 bits (72),  Expect = 5.5, Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 57/135 (42%), Gaps = 15/135 (11%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIY-----TSKGHPKGSFVLSECEKQ  68
            EGY+ K+  L  + K++Y VL  D L +  +DS E Y      S  H     VL  C   
Sbjct  461  EGYLVKKSSLFPTMKKKYCVL--DQLQLGIFDSHEQYDASRAASSQHGDHEQVLV-CGVS  517

Query  69   DLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKN----SSPQ  124
            D    G  ++ +   F  H       + S   E+  ++ KW+   H AL K     SSP 
Sbjct  518  DWDGHGTLLQ-YHHGFQIHTVNHHMIQCSAANEN--EKAKWITGIHEALLKYKDQLSSPT  574

Query  125  KSMSQRIEEITGPLL  139
            +   Q ++E    +L
Sbjct  575  RREEQLLQETRSAIL  589

>PHYSO_330858
Length=548

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 29/122 (24%), Positives = 53/122 (43%), Gaps = 8/122 (7%)

Query  14   EGYVTKR-GHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSD  72
            EG + K+   + + W++R+  ++  T ++SY+ SK+ Y     P+G F +S      L  
Sbjct  428  EGMLEKKSASIFRGWEKRWFKVDPKTFILSYHFSKDDYARGFTPRGGFAVSRI-SNILVQ  486

Query  73   EGASVKPFGFKFI----GHCPGQGYKEYSVYVESQIDQTKWLNVAH--NALGKNSSPQKS  126
              A    F F  +         QG + Y +  E +     W+   H   A+ + + P+ S
Sbjct  487  RHARGNHFHFDVVVDLSTRLNPQGSRTYELRCEDEESLRYWVETLHYYKAMAQKTPPRPS  546

Query  127  MS  128
             S
Sbjct  547  TS  548

>PYAR_19122
Length=554

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 57/125 (46%), Gaps = 19/125 (15%)

Query  27   WKRRYMVL-NGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDEGASVKPFGFKFI  85
            WK+RY V+ +G TL + YY+S++ +  K + +G    +   K D        KP GF+F 
Sbjct  36   WKKRYCVIYSGSTLQIVYYESQDDF-EKRNIRGKIAFASVHKWD-------GKPNGFQF-  86

Query  86   GHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSPQKSMSQRIEEITGPLLPCASVQ  145
             + P    + Y VY  ++ +Q  WL+     +  ++ P K       E      P AS  
Sbjct  87   -YTPSN--QCYRVYTATEDEQRNWLSTMQRLI--DAMPDKKDG----ETVAYARPVASSP  137

Query  146  LNCPR  150
             + PR
Sbjct  138  ASSPR  142

>PHYRA_81944
Length=1149

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 22/34 (65%), Gaps = 0/34 (0%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKE  48
            GY+ K+G   KSW+RR+ +L  D  ++ YY S E
Sbjct  123  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTSAE  156

>CCI11474
Length=553

 Score = 41.2 bits (95),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 58/118 (49%), Gaps = 21/118 (18%)

Query  15   GYVTKRGHLMKS-------WKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEK  67
            G +  RG L K        WK+RY V+  ++L + YY+++E +  KG+ +G    +   K
Sbjct  23   GEILLRGFLYKRPEQNSLLWKKRYCVIIKNSLQIVYYENEEDF-EKGNIRGKIPFASVHK  81

Query  68   QDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSPQK  125
             D        KP GF+F  + P    + Y VY ++  +   W+++    +  +++P+K
Sbjct  82   WD-------GKPNGFQF--YTPTN--QCYRVYTDTPKEHEDWVSIMQTQI--DAAPEK  126

>SPRG_06061
Length=1159

 Score = 41.2 bits (95),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 39/74 (53%), Gaps = 6/74 (8%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDE  73
            EGY+ K+G L+ +WK  Y VL G TL V  YD++E + +    K   +L   ++++    
Sbjct  224  EGYLNKKGDLLAAWKSCYCVLEGKTLAV--YDTREDFIADVGLKVRMLLLAVDEEN----  277

Query  74   GASVKPFGFKFIGH  87
            GA    F  +  GH
Sbjct  278  GAKANGFSIRTEGH  291

>SDRG_02135
Length=306

 Score = 40.8 bits (94),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 25/33 (76%), Gaps = 2/33 (6%)

Query  14  EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDS  46
           EGY+ K+GH++K+W+RRY  L   +L  +YYDS
Sbjct  2   EGYLLKQGHVVKNWRRRYFRLVDASL--AYYDS  32

>SPRG_01860
Length=674

 Score = 41.2 bits (95),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 48/112 (43%), Gaps = 22/112 (20%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDE  73
            EGY+ K+G L+K WK+R+ V +G +L  SYY    I +    P     L          E
Sbjct  23   EGYLQKKGQLLKGWKKRWFVCDGRSL--SYY----ISSKDKKPNAVIPL----------E  66

Query  74   GASVKPFGFKFIGHCP------GQGYKEYSVYVESQIDQTKWLNVAHNALGK  119
             ASV+  G     H P      G     Y +  E +   + WL+V   A+ +
Sbjct  67   SASVQDGGLSETWHSPRIYLTDGTSGTMYCLSAEEKGVASDWLSVLTKAVAR  118

>PHYKE_8531
Length=269

 Score = 40.4 bits (93),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 29/41 (71%), Gaps = 4/41 (10%)

Query  14  EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKG  54
           +G++ K+   ++SW RRY  LNG TL  +YYDS++  TS+G
Sbjct  36  QGWMRKQKETLRSWARRYFTLNGKTL--TYYDSED--TSRG  72

>PYIW_21108
Length=2593

 Score = 41.2 bits (95),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 35/126 (28%), Positives = 60/126 (48%), Gaps = 9/126 (7%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDE  73
            EGY+ KRG L+ + +RRY VL G   +++YY +++    +  P+   VL   + +D   +
Sbjct  2    EGYLWKRGGLLSTMQRRYCVLKG--TMLAYYTNEDECKRQATPRD--VLEVVQARDW--D  55

Query  74   GASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSPQKSMSQRIEE  133
            GAS     +K        G   Y  + +S  D+  W+    +AL +   P + +   IE+
Sbjct  56   GASALRQHYKHAFEIDYLGGATYQCHCDSLEDKQLWMQAIQHALDE---PNRIVQDEIED  112

Query  134  ITGPLL  139
                LL
Sbjct  113  AQRRLL  118

 Score = 39.7 bits (91),  Expect = 0.032, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 48/121 (40%), Gaps = 34/121 (28%)

Query  14    EGYVTKRGHLMKS-WKRRYMVLNGDTLLVSYYDSKE----------------IYTSKGHP  56
             EGYV  R H + + W+ R+ VL G  LL+ Y DS                  I   K HP
Sbjct  2157  EGYVRVRHHFLGAIWRERFAVLEGTRLLL-YTDSSAAMDEDRERTALEKHDLIAVEKWHP  2215

Query  57    KGSFVLSECEKQDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNA  116
               S  L    +            FGF+        GY E +V  E +  QTKWL V  +A
Sbjct  2216  TYSANLGSGSR------------FGFRVENE--AGGYLECTVTTEDE--QTKWLAVVSDA  2259

Query  117   L  117
             +
Sbjct  2260  V  2260

 Score = 37.4 bits (85),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 0/47 (0%)

Query  14    EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSF  60
             EGY+ KRGHL+ S ++RY VL  +  L  +   ++       P GSF
Sbjct  1234  EGYLVKRGHLIPSMRKRYCVLLKNASLEYFATHEDSRNPAIRPHGSF  1280

>SPRG_14312
Length=661

 Score = 41.2 bits (95),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 52/102 (51%), Gaps = 8/102 (8%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDEG  74
            G + K+ + +K+WK+R+MVL G +L   YY S    +   +PKG   L   E Q L D  
Sbjct  113  GVLVKQANHLKNWKKRFMVLRGQSLF--YYVSGAA-SEDSYPKGLISLVGVEVQ-LVDVA  168

Query  75   ASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNA  116
               K F F+ + H     Y+   +  +++ D T+W++   +A
Sbjct  169  RFKKQFCFE-LSH---PYYRPLYLMAKNEADLTQWMSCIKSA  206

>PYIR_13168
Length=1353

 Score = 41.2 bits (95),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 53/106 (50%), Gaps = 17/106 (16%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSE----CEKQDL  70
            G++TK+GH+ K+WK R+ VL  D    +YY +K     K   +G  +L++     +  D+
Sbjct  116  GWLTKQGHMWKTWKTRFFVLYADGTF-AYYKNK----GKKKMQGCLMLNDGIVTVKHVDV  170

Query  71   SDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNA  116
               G   KP+ F+       +G+ +   Y  SQ++   W++   +A
Sbjct  171  RKIG---KPYVFQV-----EKGFYKLICYCCSQLEAELWVSALRSA  208

>H257_01308
Length=897

 Score = 41.2 bits (95),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 25/34 (74%), Gaps = 2/34 (6%)

Query  14  EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSK  47
           EGY+ K+G L+K WK+R+ V +G +L  SYY +K
Sbjct  24  EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYSTK  55

>CCI45127
Length=202

 Score = 40.0 bits (92),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 35/178 (20%), Positives = 81/178 (46%), Gaps = 3/178 (2%)

Query  174  QMKNVKKTSQELLQQAINDAKEADRIGDATVNEMVYQEDVLNDAEGTVDTMGRQMDHAED  233
            Q+K +K    + + +A+   + A   G A  +E+V Q + L   E  +  +   ++H+E 
Sbjct  20   QVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQLGKVEQNLSNIESDLNHSEK  79

Query  234  LGRSLKHPILYKLTHLFtrkksykkggrgsktrkggakasrssrvsrvKLqppqqqhaaa  293
            L +S++HP+ Y  +     +K        +             R +  K++   ++    
Sbjct  80   LIKSIRHPLRYFFSKTHHHEKDAMSKNNTNHRSHHHQTGILHMRKNDGKIEHVAEEICVP  139

Query  294  qpEDDQLDQLSKILAKLGQTADTISDITARTTEQVDRIDQKVTSVDDRVKKEAKLVQA  351
                + L++L+  L +L   A  I+    ++ +Q+ RI+ +++ ++DR++ +   V A
Sbjct  140  T---NDLEKLAMALKELEVQAQLINSEAVKSNDQITRIEGQLSGINDRIQSQTTQVVA  194

>SDRG_02438
Length=224

 Score = 40.0 bits (92),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 37/133 (28%), Positives = 56/133 (42%), Gaps = 16/133 (12%)

Query  2    HVNLSKIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFV  61
            H    KIH +  EG + ++G L K W  RY VL    LL  YY S    +     + +F 
Sbjct  100  HALTRKIHGSLREGQLYRQGVLFKFWHARYFVLTPTALL--YYASPR--SPAPRRELTFA  155

Query  62   LSECEKQDLSDEGASVKPFGFKFIGH----CPGQGYKEYSVYVESQIDQTKWLNVAHNAL  117
               C  Q L     + K FG   + H    C    +K   +   ++ D+T WL     A+
Sbjct  156  GRRCSVQSLR----ATKKFGSVAVVHLLRVC--VDHKHIVLACATESDKTAWLTALQQAM  209

Query  118  GKN--SSPQKSMS  128
             ++  S+P   M+
Sbjct  210  TQSLPSAPSHVMA  222

>H310_09363
Length=1954

 Score = 41.2 bits (95),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 33/56 (59%), Gaps = 4/56 (7%)

Query  10   QTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEI---YTSKGHPKGSFVL  62
            +TSC GY+ KRG +  + +RRYM+L  D  LV Y  + E+   +  K  P+GS  L
Sbjct  843  RTSCAGYLMKRGEVNVTMQRRYMILQ-DNELVYYKTNPELNKGWFGKEKPRGSLHL  897

>PHALS_05587
Length=1361

 Score = 41.2 bits (95),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 46/96 (48%), Gaps = 9/96 (9%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDEG  74
            G++ K+GH+ KSWK R+ VL  D  +V YY +K     KG+   +  +   +  D+   G
Sbjct  139  GWLKKQGHMWKSWKARFFVLFSDGTVV-YYKNKSRKKIKGYMHLNDGVVSVQHVDIRVAG  197

Query  75   ASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWL  110
               K + F+       +G+     +  SQID   W+
Sbjct  198  ---KAYVFQI-----EKGFYRLLCHCSSQIDAELWV  225

>PYVX_22589
Length=1375

 Score = 40.8 bits (94),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 10/78 (13%)

Query  12   SCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLS  71
            S EGY+ K+  L+ +WK  Y VL  DTL  +Y++S+E + S     G   +   E  D+ 
Sbjct  279  SFEGYLNKKSDLLPNWKVTYCVLEEDTL--AYFESREDFISNSKLIGRVQIQAVEDDDMG  336

Query  72   DEGASVKPFGFKFI--GH  87
                  K  GF+ +  GH
Sbjct  337  ------KSNGFRIVTEGH  348

>PPTG_09889
Length=183

 Score = 39.7 bits (91),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 29/108 (27%), Positives = 42/108 (39%), Gaps = 30/108 (28%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDE  73
            +GY+  RG L+ SWK+R+M L                       G   +     Q LSD 
Sbjct  93   QGYLHVRGGLLPSWKKRFMTLT---------------------DGHLTVRRRRTQRLSDP  131

Query  74   GASVKPF----GFKFIGHCPG-----QGYKEYSVYVESQIDQTKWLNV  112
              + KPF      ++ GH  G     + +KE  VY +   D + WL  
Sbjct  132  QEADKPFEVISAVRWSGHDNGLCIRLENHKELYVYADHDADASMWLEA  179

>PHALS_11367
Length=1329

 Score = 40.8 bits (94),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 37/69 (54%), Gaps = 8/69 (12%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDE  73
            EGY++K+  ++ SWK  Y VL  DTL  ++Y+++E + S     G   L   E +++   
Sbjct  259  EGYLSKKSDVLMSWKATYCVLEEDTL--AFYETREDFISNSKLIGRIQLQAIEDEEMG--  314

Query  74   GASVKPFGF  82
                KP GF
Sbjct  315  ----KPNGF  319

>PHALS_07062
Length=122

 Score = 38.5 bits (88),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 55/122 (45%), Gaps = 18/122 (15%)

Query  2    HVNLSKIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFV  61
            H +LS   +   EG +TKR   +K W++RY VL G+ L            +KG P    +
Sbjct  7    HCDLS---EPDFEGELTKRSVWLKEWRKRYFVLKGNKLYFC--------RAKGEPAHGLI  55

Query  62   -LSECEKQDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKN  120
             L++C     ++E  + +   F F    P      + +Y E++  + +W+     A+ K 
Sbjct  56   DLADCLTVKSAEEKTNKR---FCFEVATPDS---TFYMYAENEKQKDEWIGAIGRAIVKY  109

Query  121  SS  122
            SS
Sbjct  110  SS  111

>H257_08182
Length=859

 Score = 40.8 bits (94),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 31/54 (57%), Gaps = 3/54 (6%)

Query  9   HQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVL  62
           H     G++ K+G  +K+WK+RYMVL G    V+YYD K +       KG+ VL
Sbjct  4   HVGQWSGWIYKQGSRVKTWKKRYMVLQGRH--VTYYD-KSVLEPNPTEKGALVL  54

 Score = 38.9 bits (89),  Expect = 0.047, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 35/56 (63%), Gaps = 8/56 (14%)

Query  10   QTSC----EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFV  61
            +TSC    EG++ K+G  +KSWKRRY V++G  L  +YY  +   T  G  +G+FV
Sbjct  656  RTSCMMTQEGWMLKQGKQVKSWKRRYFVVHGTDL--AYYKDELRGTVLG--QGTFV  707

 Score = 38.5 bits (88),  Expect = 0.062, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 49/103 (48%), Gaps = 19/103 (18%)

Query  11   TSC---EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEK  67
            TSC    G++ K G  +KSWKRRY  L+G  +LV Y D ++     GH  G  ++     
Sbjct  437  TSCAHHRGWLQKEGLAIKSWKRRYFTLHG-RMLVYYKDMED----GGHAVGQGLV-----  486

Query  68   QDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWL  110
             D + EG S +PF      H   +  +   V   S+ D+  WL
Sbjct  487  -DAAAEGTS-RPFAIDI--HF--ETGRVLRVAANSERDRAAWL  523

 Score = 35.4 bits (80),  Expect = 0.54, Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 21/31 (68%), Gaps = 2/31 (6%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYY  44
             G++ K G  +++WKRRY VL GD L  +YY
Sbjct  233  RGWLYKEGQHVRNWKRRYFVLTGDHL--AYY  261

>H257_03931
Length=695

 Score = 40.8 bits (94),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 54/108 (50%), Gaps = 12/108 (11%)

Query  11   TSCEGYVTKRGHLMKSWKRRYMVLNGDTLL--VSYYDSKEIYTSKGHPKGSFVLSECEKQ  68
            TS  G + K+ + +K+WK+R+MVL G ++   VS   S+E +     P+G   LS  +  
Sbjct  109  TSKSGVLVKQANHLKNWKKRFMVLRGQSMFYYVSGTSSEETF-----PRGVISLSGVDVH  163

Query  69   DLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNA  116
             L D     K F F+ I H     Y+   +  +++ D  +WL+   +A
Sbjct  164  PL-DTAKFKKQFCFE-ISH---PNYRSLYMVAKNEADLVQWLSSIKSA  206

>SPRG_02502
Length=121

 Score = 38.1 bits (87),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 52/119 (44%), Gaps = 15/119 (13%)

Query  5    LSKIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGH-PKGSFVLS  63
            ++ + Q   EG +TKR   +K W+ RY VL G+ L            ++G  P G   LS
Sbjct  4    VADLAQPDFEGELTKRSVWLKEWRARYFVLKGNKLYFC--------RAQGEAPHGVIDLS  55

Query  64   ECEKQDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSS  122
            EC     ++E  + K F F+            Y ++ ES+  +  W+     A+ K SS
Sbjct  56   ECLTVKSAEEKTN-KRFCFEI-----ATPESTYYMHAESEEKKDAWIGAIGRAIVKFSS  108

>CCI40991
Length=801

 Score = 40.4 bits (93),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 23/29 (79%), Gaps = 0/29 (0%)

Query  8    IHQTSCEGYVTKRGHLMKSWKRRYMVLNG  36
            + +T  EGY+ K+GH+++SW+ RY VL+G
Sbjct  103  LFETDWEGYIWKQGHVVRSWRYRYAVLSG  131

>PYAR_16504
Length=1258

 Score = 40.8 bits (94),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 31/105 (30%), Positives = 48/105 (46%), Gaps = 17/105 (16%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQD-----  69
            G++ ++G  +K+WKRRY VL   T L++   S  +   KG   G  +  E    D     
Sbjct  32   GWLVRQGQHLKTWKRRYFVLIKRTNLLTGETSASLQYYKGSNFGK-LRGEIHLHDGGPLT  90

Query  70   --LSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQ--TKWL  110
                D G S KPF       C G    E+S+Y + + D+  + W+
Sbjct  91   VRFVDVGESKKPF-------CFGISRGEFSLYCQGKDDEDVSAWV  128

>CCI45857
Length=905

 Score = 40.4 bits (93),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 29/56 (52%), Gaps = 6/56 (11%)

Query  14  EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQD  69
           EGY+ K+G  +K WK+R+ V +G TL  SYY    I +    P     L  C  QD
Sbjct  40  EGYLQKKGQRLKGWKQRWFVCDGRTL--SYY----ITSKDRRPNAIISLDGCTVQD  89

>SDRG_05608
Length=121

 Score = 38.1 bits (87),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 52/119 (44%), Gaps = 15/119 (13%)

Query  5    LSKIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGH-PKGSFVLS  63
            ++ + Q   EG +TKR   +K W+ RY VL G+ L            ++G  P G   LS
Sbjct  4    VADLAQPDFEGELTKRSVWLKEWRARYFVLKGNKLYFC--------RAQGEAPHGMIDLS  55

Query  64   ECEKQDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSS  122
            EC     ++E  + K F F+            Y ++ ES+  +  W+     A+ K SS
Sbjct  56   ECLTVKSAEEKTN-KRFCFEI-----ATPESTYYMHAESEEKKDAWIGAIGRAIVKFSS  108

>H310_13911
Length=369

 Score = 40.0 bits (92),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 29/44 (66%), Gaps = 5/44 (11%)

Query  15  GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKG  58
           G++ K+   +K+W RR+  L+G TL  SYYDS++I    G P+G
Sbjct  30  GWMRKQKAHLKTWNRRFFALSGSTL--SYYDSEDI---SGAPRG  68

>SDRG_12776
Length=1184

 Score = 40.4 bits (93),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 39/74 (53%), Gaps = 6/74 (8%)

Query  14   EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDE  73
            EGY+ K+G L+ +WK  Y VL G TL V  Y+S+E + +    K   +L   ++++    
Sbjct  228  EGYLNKKGDLLAAWKSCYCVLEGKTLAV--YESREDFIADVGLKVRMLLLAVDEEN----  281

Query  74   GASVKPFGFKFIGH  87
            GA    F  +  GH
Sbjct  282  GAKANGFSIRTEGH  295

>HYAP_13690
Length=377

 Score = 40.0 bits (92),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 26/39 (67%), Gaps = 2/39 (5%)

Query  10   QTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKE  48
            Q +  G++ K G  +KSWKRRY VL G  L  SY++S++
Sbjct  133  QVTHTGWLKKEGARVKSWKRRYFVLRGSVL--SYFNSED  169

>CCI10928
Length=1530

 Score = 40.4 bits (93),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 52/112 (46%), Gaps = 13/112 (12%)

Query  10   QTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTS----KGHPKGSFVLSEC  65
            + +  GY+ KRG   KS++RRYM L G+ L  SYY  K    S    K + +GS  L   
Sbjct  297  EVTISGYLRKRGETNKSFRRRYMELKGNVL--SYYKKKPSLKSREENKTYLRGSIHLESV  354

Query  66   EKQDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNAL  117
                L    +  + +G   +        + + + VE++I+  +WL    NA+
Sbjct  355  --TSLQPLESKTEKYGVVLV-----TTSRTWELVVENEIEYHRWLKELCNAV  399

>SPRG_20275
Length=394

 Score = 40.0 bits (92),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 30/117 (26%), Positives = 48/117 (41%), Gaps = 14/117 (12%)

Query  11   TSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDL  70
            T+ EG+V K G L  SWK+ Y+V+ G  L+   Y  +E    +   K    L+   +   
Sbjct  5    TTWEGWVHKHGGLFPSWKKVYLVVRGRQLV---YLDREASNPRAKEKAKATLTAVARSTD  61

Query  71   SDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSPQKSM  127
               G ++            G   K   +Y ++  + T  LN  + AL     P+ SM
Sbjct  62   VKNGLTIT-----------GADGKHARIYTKTSEEVTGCLNAMNAALRPEPKPRPSM  107

>CCA23572
Length=868

 Score = 40.4 bits (93),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 29/56 (52%), Gaps = 6/56 (11%)

Query  14  EGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQD  69
           EGY+ K+G  +K WK+R+ V +G TL  SYY    I +    P     L  C  QD
Sbjct  3   EGYLQKKGQRLKGWKQRWFVCDGRTL--SYY----ITSKDRRPNAIISLDGCTVQD  52

>SPRG_13975
Length=331

 Score = 39.7 bits (91),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 28/109 (26%), Positives = 48/109 (44%), Gaps = 21/109 (19%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDEG  74
            G++ K+    K+W RR+ VL  +T ++SYYDS+++      P+G+             E 
Sbjct  21   GWMKKQKLHFKTWSRRFFVLTANTRVMSYYDSEDL----RQPRGTL------------EV  64

Query  75   ASVKPFGFKFIG---HCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKN  120
             SV P   +  G   HC     KE  +  ++ +    W  V   A+  +
Sbjct  65   LSVHPLPGESNGLSLHCASG--KEEKLICDTNVAYNAWFAVLTRAVNPD  111

>PYIR_16780
Length=1352

 Score = 40.4 bits (93),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 33/115 (29%), Positives = 51/115 (44%), Gaps = 17/115 (15%)

Query  6    SKIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKE----IYTS----KGHPK  57
            S +  T   G++ K+G   +S+KRRYM LNG  L  SYY  K     I  S    K + +
Sbjct  153  STVETTFISGFLRKKGETNRSFKRRYMELNGSIL--SYYKKKPEKHGIPLSREDKKAYER  210

Query  58   GSFVLSECEKQDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNV  112
            G+  L       L    +  +P+G   +        + + +  ES+ D  +WL V
Sbjct  211  GNIDLERV--SSLQPMESKSEPYGIHLVTTA-----RTWVIAAESEQDYHRWLKV  258

>PHYKE_5588
Length=751

 Score = 40.0 bits (92),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 25/41 (61%), Gaps = 2/41 (5%)

Query  13   CEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSK  53
            C G++ K G  +K+WKRRY  L+G TL   Y+ S  + + K
Sbjct  441  CSGWLRKEGGTVKNWKRRYFTLHGPTL--CYFKSDNVRSKK  479

 Score = 35.8 bits (81),  Expect = 0.45, Method: Compositional matrix adjust.
 Identities = 14/27 (52%), Positives = 17/27 (63%), Gaps = 0/27 (0%)

Query  13   CEGYVTKRGHLMKSWKRRYMVLNGDTL  39
            CEG++ KRG     W+RRY  L G TL
Sbjct  252  CEGWLYKRGQRSTEWQRRYFKLKGFTL  278

 Score = 33.5 bits (75),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 18/29 (62%), Gaps = 0/29 (0%)

Query  11   TSCEGYVTKRGHLMKSWKRRYMVLNGDTL  39
             S +G++ K G   K+WKRRYM L   T+
Sbjct  136  VSMQGWLLKEGQNFKTWKRRYMTLRDRTI  164

>PHYRA_73297
Length=119

 Score = 37.7 bits (86),  Expect = 0.019, Method: Composition-based stats.
 Identities = 15/37 (41%), Positives = 22/37 (59%), Gaps = 0/37 (0%)

Query  10  QTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDS  46
           QT  +GY+ +RG  +KSW+RRY +     LL    D+
Sbjct  2   QTVVDGYLERRGRHLKSWRRRYFIFEDGMLLYKKNDN  38

>SDRG_07012
Length=331

 Score = 39.7 bits (91),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 28/109 (26%), Positives = 48/109 (44%), Gaps = 21/109 (19%)

Query  15   GYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEKQDLSDEG  74
            G++ K+    K+W RR+ VL  +T ++SYYDS+++      P+G+             E 
Sbjct  21   GWMKKQKLHFKTWSRRFFVLTANTRVMSYYDSEDL----RQPRGTL------------EV  64

Query  75   ASVKPFGFKFIG---HCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKN  120
             SV P   +  G   HC     KE  +  ++ +    W  V   A+  +
Sbjct  65   LSVHPLPGESNGLSLHCASG--KEEKLICDTNVAYNAWFAVLTRAVNPD  111

Lambda      K        H        a         alpha
   0.314    0.130    0.366    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 23662248564

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40