Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
H257_06293147551231236404e-87
H310_09224147551231235279e-70
SPRG_06335147551231243576e-44
SDRG_01782147551231243561e-43
PHYCA_11834147551341233041e-35
PHYSO_321155147551361232971e-34
PPTG_17126147551361232875e-33
PHYRA_95903147551341232841e-32
PYU1_G001736147551231192822e-32
PHYKE_8392147551381252832e-32
PYIW_19970147551301192813e-32
PHALS_06479147551361232797e-32
PITG_18455147551321212762e-31
CCA17542147551201182561e-28
PYIR_13454147551291202535e-28
PYVX_18180147551351202536e-28
HYAP_07103147551641562522e-27
PYAP_17747147551341222483e-27
CCI44820147551231172412e-26
H310_08884609981466800.051
PHALS_115641114710761760.067
PYIW_1411916535856146790.068
PYAP_192237150109791750.25
CCA175211114710471710.38
H257_15862609982963710.90
PYVX_208541114710453671.2
PHALS_002448680124069701.3
PYIR_190005775573941691.5
HYAP_084991114710855662.0
HYAP_085006526017255672.0
PYIR_16217298743776672.3
PHYSO_51801814234271663672.6
PITG_200411578772129664.3
PYIW_22787298743876645.9
PHYRA_785151578775429646.2
PHYKE_9561902552855646.5
SDRG_1550312961669230646.6
PPTG_091281578764629647.5
PHYCA_5751391578763329638.6
PYIW_2692316620519776629.2
PYIR_13111238027885629.3
PYIW_23200837947491206310.0
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= H257_06293

Length=123
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

H257_06293                                                            251        4e-87
H310_09224                                                            207        9e-70
SPRG_06335                                                            142        6e-44
SDRG_01782                                                            141        1e-43
PHYCA_11834                                                           121        1e-35
PHYSO_321155                                                          119        1e-34
PPTG_17126                                                            115        5e-33
PHYRA_95903                                                           114        1e-32
PYU1_G001736                                                          113        2e-32
PHYKE_8392                                                            113        2e-32
PYIW_19970                                                            112        3e-32
PHALS_06479                                                           112        7e-32
PITG_18455                                                            110        2e-31
CCA17542                                                              103        1e-28
PYIR_13454                                                            102        5e-28
PYVX_18180                                                            102        6e-28
HYAP_07103                                                            101        2e-27
PYAP_17747                                                            100        3e-27
CCI44820                                                              97.4       2e-26
H310_08884                                                            35.4       0.051
PHALS_11564                                                           33.9       0.067
PYIW_14119                                                            35.0       0.068
PYAP_19223                                                            33.5       0.25 
CCA17521                                                              32.0       0.38 
H257_15862                                                            32.0       0.90 
PYVX_20854                                                            30.4       1.2  
PHALS_00244                                                           31.6       1.3  
PYIR_19000                                                            31.2       1.5  
HYAP_08499                                                            30.0       2.0  
HYAP_08500                                                            30.4       2.0  
PYIR_16217                                                            30.4       2.3  
PHYSO_518018                                                          30.4       2.6  
PITG_20041                                                            30.0       4.3  
PYIW_22787                                                            29.3       5.9  
PHYRA_78515                                                           29.3       6.2  
PHYKE_9561                                                            29.3       6.5  
SDRG_15503                                                            29.3       6.6  
PPTG_09128                                                            29.3       7.5  
PHYCA_575139                                                          28.9       8.6  
PYIW_26923                                                            28.5       9.2  
PYIR_13111                                                            28.5       9.3  
PYIW_23200                                                            28.9       10.0 

>H257_06293
Length=123

 Score = 251 bits (640),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%)

Query  1    MEKSVRTAYKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEELDKLVMKAQSKISY  60
            MEKSVRTAYKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEELDKLVMKAQSKISY
Sbjct  1    MEKSVRTAYKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEELDKLVMKAQSKISY  60

Query  61   LKIVTPKRTPQSGPQRFIYKDGKRLDSQSLDDGGNRTIKTTDVNAMMERHVKLIRRQHFM  120
            LKIVTPKRTPQSGPQRFIYKDGKRLDSQSLDDGGNRTIKTTDVNAMMERHVKLIRRQHFM
Sbjct  61   LKIVTPKRTPQSGPQRFIYKDGKRLDSQSLDDGGNRTIKTTDVNAMMERHVKLIRRQHFM  120

Query  121  DRK  123
            DRK
Sbjct  121  DRK  123

>H310_09224
Length=123

 Score = 207 bits (527),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 110/123 (89%), Gaps = 0/123 (0%)

Query  1    MEKSVRTAYKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEELDKLVMKAQSKISY  60
            MEKSVRTAYKKLIKLAQSLPA+QKP ALDK+RH+FRS GVI+++++LDK+VMKAQSKISY
Sbjct  1    MEKSVRTAYKKLIKLAQSLPAEQKPVALDKVRHEFRSHGVITSSDQLDKIVMKAQSKISY  60

Query  61   LKIVTPKRTPQSGPQRFIYKDGKRLDSQSLDDGGNRTIKTTDVNAMMERHVKLIRRQHFM  120
            LKIVTPKR PQ+ PQR+IYKDGKRLD   +D   N TIKT D NAMMERHVKL+RRQHFM
Sbjct  61   LKIVTPKRAPQTSPQRYIYKDGKRLDPGCIDQSTNATIKTVDFNAMMERHVKLVRRQHFM  120

Query  121  DRK  123
            DRK
Sbjct  121  DRK  123

>SPRG_06335
Length=123

 Score = 142 bits (357),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 95/124 (77%), Gaps = 2/124 (2%)

Query  1    MEKSVRTAYKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEELDKLVMKAQSKISY  60
            M+ ++R AYKKL+KLA+S+P +Q+   L+K+R +FR+    +T EELD+L+ KAQSKISY
Sbjct  1    MDTTIRAAYKKLLKLAKSVPQEQRAQTLEKVRTEFRAHTGAATPEELDQLLRKAQSKISY  60

Query  61   LKIVTPKRTPQSGP-QRFIYKDGKRLDSQSLDDGGNRTIKTTDVNAMMERHVKLIRRQHF  119
            LKIVTPK++P  G    F+YK+G+R+D + L    + TIKT D NAMM +HV+L+RRQHF
Sbjct  61   LKIVTPKKSPSPGQGNHFVYKNGQRIDGREL-SADSATIKTADYNAMMTKHVQLVRRQHF  119

Query  120  MDRK  123
            MDRK
Sbjct  120  MDRK  123

>SDRG_01782
Length=123

 Score = 141 bits (356),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 95/124 (77%), Gaps = 2/124 (2%)

Query  1    MEKSVRTAYKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEELDKLVMKAQSKISY  60
            M+ ++R AYKKL+KLA+S+P +Q+   L+K+RH+FR+    +T EELD+L+ KAQSKISY
Sbjct  1    MDATIRAAYKKLLKLAKSVPQEQRAQTLEKVRHEFRAHEGAATPEELDQLLRKAQSKISY  60

Query  61   LKIVTPKRTPQSGP-QRFIYKDGKRLDSQSLDDGGNRTIKTTDVNAMMERHVKLIRRQHF  119
            LKIVTPK++  S     F+YK+G+R+D + L    + TIKT D NAMM +HV+L+RRQHF
Sbjct  61   LKIVTPKKSSSSTQGSHFVYKNGQRIDGREL-SADSATIKTHDYNAMMTKHVQLVRRQHF  119

Query  120  MDRK  123
            MDRK
Sbjct  120  MDRK  123

>PHYCA_11834
Length=134

 Score = 121 bits (304),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 90/123 (73%), Gaps = 2/123 (2%)

Query  3    KSVRTAYKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEELDKLVMKAQSKISYLK  62
            + +R  YKKL++LAQSLP  ++ T++D+IR +FRS   ++  +E+ KL+ +AQS + YLK
Sbjct  4    RELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGYLK  63

Query  63   IVTPKRTPQSGPQRFIYKDGKRLDSQSLDDGG--NRTIKTTDVNAMMERHVKLIRRQHFM  120
            IVTP+    +G QRFIY+DGKR++++ L+  G  N   KT D+ A ++RH +L+RRQ+FM
Sbjct  64   IVTPRAESNTGVQRFIYRDGKRVNAEELEGKGEENARWKTQDMEAGLKRHHQLLRRQYFM  123

Query  121  DRK  123
            DRK
Sbjct  124  DRK  126

>PHYSO_321155
Length=136

 Score = 119 bits (297),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 87/123 (71%), Gaps = 2/123 (2%)

Query  3    KSVRTAYKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEELDKLVMKAQSKISYLK  62
            + +R  YKKL++LAQSLP  ++  +LD+IR +FRS G ++  E +  L+ +AQS +SYLK
Sbjct  6    RELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSSLSYLK  65

Query  63   IVTPKRTPQSGPQRFIYKDGKRLDSQSLDDGG--NRTIKTTDVNAMMERHVKLIRRQHFM  120
            IVTP+    +G QRFIY++G+R+++   +  G  N   KT D+ A ++RH +L+RRQ+FM
Sbjct  66   IVTPRGESNTGVQRFIYRNGQRVNAAEFEAKGEENARYKTQDIEAGLKRHHQLLRRQYFM  125

Query  121  DRK  123
            DRK
Sbjct  126  DRK  128

>PPTG_17126
Length=136

 Score = 115 bits (287),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 87/123 (71%), Gaps = 2/123 (2%)

Query  3    KSVRTAYKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEELDKLVMKAQSKISYLK  62
            + +R  YKKL++LAQSLP  ++ +++D+IR DFR+ G ++  +E+  L+ +AQS +SYLK
Sbjct  6    RELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLSYLK  65

Query  63   IVTPKRTPQSGPQRFIYKDGKRLDSQSLDDGG--NRTIKTTDVNAMMERHVKLIRRQHFM  120
            IVTP+     G QR+IY++G+R+++   ++ G  N   KT D+   + RH +L+RRQ+F+
Sbjct  66   IVTPRAESNMGVQRYIYRNGQRVNADEFEEKGEENARWKTQDMEGGLRRHHQLLRRQYFL  125

Query  121  DRK  123
            DRK
Sbjct  126  DRK  128

>PHYRA_95903
Length=134

 Score = 114 bits (284),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 54/123 (44%), Positives = 85/123 (69%), Gaps = 2/123 (2%)

Query  3    KSVRTAYKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEELDKLVMKAQSKISYLK  62
            + +R  YKKL++LAQSLP  ++  +LD+IR +FRS   ++  +E+  L+ +AQS + YLK
Sbjct  4    RELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLGYLK  63

Query  63   IVTPKRTPQSGPQRFIYKDGKRLDSQSLDDGG--NRTIKTTDVNAMMERHVKLIRRQHFM  120
            IVTP+     G QR+IY++G+R+++  ++  G  N   KT D+   ++RH +L+RRQHFM
Sbjct  64   IVTPRAESNKGIQRYIYRNGQRVNADEVEAHGEENARYKTQDIEGGLKRHHQLLRRQHFM  123

Query  121  DRK  123
            DRK
Sbjct  124  DRK  126

>PYU1_G001736
Length=123

 Score = 113 bits (282),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 84/119 (71%), Gaps = 1/119 (1%)

Query  5    VRTAYKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEELDKLVMKAQSKISYLKIV  64
            +R  YKKL+KLAQ+LPAD++ T +++IR +FR+       +E+  L+ +AQS I YLKIV
Sbjct  6    LRPMYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGYLKIV  65

Query  65   TPKRTPQSGPQRFIYKDGKRLDSQSLDDGGNRTIKTTDVNAMMERHVKLIRRQHFMDRK  123
            TP+ T  +G + ++Y  GKR+++    + G R  KT D NA M+RHV+L+RRQHFMDRK
Sbjct  66   TPRATSDAGVKNYVYIKGKRVEAAGAAEDGAR-YKTADYNAQMQRHVQLLRRQHFMDRK  123

>PHYKE_8392
Length=138

 Score = 113 bits (283),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 90/125 (72%), Gaps = 4/125 (3%)

Query  3    KSVRTAYKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEELDKLVMKAQSKISYLK  62
            + +R  YKKL+++AQ+LP  ++  +L +IR +FR+ G +S  +E+ KL+  AQS +SYLK
Sbjct  6    RELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEVSKLLQLAQSSLSYLK  65

Query  63   IVTPKRTPQ--SGPQRFIYKDGKRLDSQSLDDGG--NRTIKTTDVNAMMERHVKLIRRQH  118
            IVTP+   +  SG QR+IY++G+R+++  L++ G  N   KT D+ A ++RH +L+RRQH
Sbjct  66   IVTPRDETESNSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQLMRRQH  125

Query  119  FMDRK  123
            FMDRK
Sbjct  126  FMDRK  130

>PYIW_19970
Length=130

 Score = 112 bits (281),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 86/119 (72%), Gaps = 1/119 (1%)

Query  5    VRTAYKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEELDKLVMKAQSKISYLKIV  64
            +R  YKKL++LA++LP  ++ T   +IR +FRSR  +S  +EL+ L+ +AQS ISYLKIV
Sbjct  13   LRPVYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKIV  72

Query  65   TPKRTPQSGPQRFIYKDGKRLDSQSLDDGGNRTIKTTDVNAMMERHVKLIRRQHFMDRK  123
            TP+++  +G + +IYK+G+R+++ ++ + G +  +  D N  M RH KL+RRQHFMDRK
Sbjct  73   TPRKSSDAGVKNYIYKNGQRVEAAAVMEDGAK-YQLPDYNGQMLRHQKLLRRQHFMDRK  130

>PHALS_06479
Length=136

 Score = 112 bits (279),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 86/123 (70%), Gaps = 2/123 (2%)

Query  3    KSVRTAYKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEELDKLVMKAQSKISYLK  62
            + +R  YKKL++LAQ+LP  ++ +++D+IR +FR    ++  +E+ + + +AQS +SYLK
Sbjct  6    RELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSYLK  65

Query  63   IVTPKRTPQSGPQRFIYKDGKRLDSQSLDDGGNRT--IKTTDVNAMMERHVKLIRRQHFM  120
            I+TP+    +G QRFIY++G+R+++   +  GN     KT D+ A  +RH +L+RRQ+FM
Sbjct  66   IITPRTESNTGVQRFIYRNGQRVNAADFEKKGNENARWKTQDMEAGYKRHHQLLRRQYFM  125

Query  121  DRK  123
            DRK
Sbjct  126  DRK  128

>PITG_18455
Length=132

 Score = 110 bits (276),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 86/121 (71%), Gaps = 2/121 (2%)

Query  5    VRTAYKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEELDKLVMKAQSKISYLKIV  64
            +R  YKKL++LAQSLP  ++ +++D+IR DFRS G  +  +E+  L+ +AQS +SYLKIV
Sbjct  4    LRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYLKIV  63

Query  65   TPKRTPQSGPQRFIYKDGKRLDSQSLDDGG--NRTIKTTDVNAMMERHVKLIRRQHFMDR  122
            TP+    +G QR+IY++G+R+++   ++ G  N   K  D+   ++RH +L++RQ+FM+R
Sbjct  64   TPRAESNTGVQRYIYRNGQRVNAAEFEEKGVENARWKMQDMEGGLKRHHQLLQRQYFMNR  123

Query  123  K  123
            K
Sbjct  124  K  124

>CCA17542
Length=120

 Score = 103 bits (256),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 79/118 (67%), Gaps = 1/118 (1%)

Query  5    VRTAYKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEELDKLVMKAQSKISYLKIV  64
             R+ YK+LI+LA+SLPA+++   L  IR +FR    IS   +L +L+ +AQS I YLKIV
Sbjct  4    TRSIYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTIGYLKIV  63

Query  65   TPKRTPQSGPQRFIYKDGKRLDSQSLDDGGNRTIKTTDVNAMMERHVKLIRRQHFMDR  122
            TP +   SG +RF++KDG+R++ ++L        K  D+   ++RH +L+RRQHFMDR
Sbjct  64   TPHKRSDSGVKRFMFKDGERIE-ENLKASERARFKVQDIGEGLKRHHQLLRRQHFMDR  120

>PYIR_13454
Length=129

 Score = 102 bits (253),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 88/120 (73%), Gaps = 3/120 (3%)

Query  5    VRTAYKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEELDKLVMKAQSKISYLKIV  64
            +R  YKKL+KLA++LP  ++   L +IR +FR+R  +S  +EL+ L+ +AQS I YLKIV
Sbjct  12   LRPVYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSIGYLKIV  71

Query  65   TPKRTPQSGPQRFIYKDGKRLDSQS-LDDGGNRTIKTTDVNAMMERHVKLIRRQHFMDRK  123
            TP+++  +G + +IYK+G+R+++ S L+DG   +I   D NA M+RH KL+RRQHFMDRK
Sbjct  72   TPRKSSDAGVKNYIYKNGQRVEATSVLEDGAKYSI--PDYNAQMQRHQKLLRRQHFMDRK  129

>PYVX_18180
Length=135

 Score = 102 bits (253),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 84/120 (70%), Gaps = 2/120 (2%)

Query  5    VRTAYKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEELDKLVMKAQSKISYLKIV  64
            +R  YKKL++LAQSLP  ++ + + +IR +FRS   ++ A E+ KL+ +AQS++ YLKIV
Sbjct  7    LRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQLGYLKIV  66

Query  65   TPKRTPQSGPQRFIYKDGKRLDSQSLDDGGNRT--IKTTDVNAMMERHVKLIRRQHFMDR  122
            TP+    SG +R+IY++G+R+D+ + +  G      KT D+   ++RH +L+RRQHFMDR
Sbjct  67   TPRGPSASGVKRYIYRNGQRVDADAAEAAGEDGARYKTPDMEGALKRHHQLLRRQHFMDR  126

>HYAP_07103
Length=164

 Score = 101 bits (252),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 85/156 (54%), Gaps = 37/156 (24%)

Query  5    VRTAYKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEELDKLVMKAQSKISYLKIV  64
            +R  YKKL++LAQSLP  ++  +LD+IR +FR  G ++  +E+  L+ +AQS I +LKIV
Sbjct  1    MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKIV  60

Query  65   TPKRT-----------------------------------PQSGPQRFIYKDGKRLDSQS  89
            TP+                                       +G QRF+Y+DGKR+D+  
Sbjct  61   TPRAESGGFMASLAFSIMCLTLSLFSVLLLLLHHYFSCFFSDTGIQRFVYRDGKRIDAAE  120

Query  90   LDDGG--NRTIKTTDVNAMMERHVKLIRRQHFMDRK  123
            L   G  N   KT D+ A M+RH +L+RRQHFMDRK
Sbjct  121  LKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRK  156

>PYAP_17747
Length=134

 Score = 100 bits (248),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 80/122 (66%), Gaps = 6/122 (5%)

Query  5    VRTAYKKLIKLAQSLPADQKPTA-LDKIRHDFRSRGVISTAEELDKLVMKAQSKISYLKI  63
            +R  YK+L++LA+SLP + K  A + +IR +FRS       +E+  LV +AQ+KI YLKI
Sbjct  6    LRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIGYLKI  65

Query  64   VTPKRTPQSGPQRFIYKDGKRLDS---QSLDDGGNRTIKTTDVNAMMERHVKLIRRQHFM  120
            VTP+ T  +G + F+Y +GKR+DS   Q+ ++G     KT D    M RH +L+RRQHFM
Sbjct  66   VTPRSTADAGVKSFVYVNGKRVDSSDVQTREEGAR--YKTIDFEGNMRRHNQLLRRQHFM  123

Query  121  DR  122
            DR
Sbjct  124  DR  125

>CCI44820
Length=123

 Score = 97.4 bits (241),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 76/117 (65%), Gaps = 1/117 (1%)

Query  6    RTAYKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEELDKLVMKAQSKISYLKIVT  65
            R  +KK++KLA+SLP +++   L  IR +FR    I    +L +L+ +AQS I YLKIVT
Sbjct  8    RRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTIGYLKIVT  67

Query  66   PKRTPQSGPQRFIYKDGKRLDSQSLDDGGNRTIKTTDVNAMMERHVKLIRRQHFMDR  122
            P +   SG + F+YKDG+R++ +SL  G     K  D+   ++RH +LIRRQ+FMDR
Sbjct  68   PHKRSDSGVKHFVYKDGERIE-KSLQAGEKAKFKVQDMEEGLKRHNQLIRRQYFMDR  123

>H310_08884
Length=814

 Score = 35.4 bits (80),  Expect = 0.051, Method: Composition-based stats.
 Identities = 22/66 (33%), Positives = 35/66 (53%), Gaps = 3/66 (5%)

Query  5    VRTAYKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEELDKLVMKAQSKISYLKIV  64
            V  A K+++ L + LP D++PT++  + H   S G I T   L     KAQS ++ + + 
Sbjct  145  VNEAVKEILALYKDLPEDRRPTSVVVVGH---SMGGIVTRTALTLPNYKAQSILTIVTLS  201

Query  65   TPKRTP  70
            TP   P
Sbjct  202  TPHVAP  207

>PHALS_11564
Length=107

 Score = 33.9 bits (76),  Expect = 0.067, Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 35/61 (57%), Gaps = 0/61 (0%)

Query  3   KSVRTAYKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEELDKLVMKAQSKISYLK  62
           K V   Y++L+KLAQ  P+ ++   +  I+ +F +  +I+ A+++ + +  A + I  L 
Sbjct  5   KQVLRVYRRLLKLAQHYPSIKREAIIRDIKEEFHANAIITDAQKICEAMASAHAGIKELS  64

Query  63  I  63
           +
Sbjct  65  M  65

>PYIW_14119
Length=561

 Score = 35.0 bits (79),  Expect = 0.068, Method: Composition-based stats.
 Identities = 16/46 (35%), Positives = 23/46 (50%), Gaps = 0/46 (0%)

Query  37  SRGVISTAEELDKLVMKAQSKISYLKIVTPKRTPQSGPQRFIYKDG  82
           S GVIS    L K +    + +   K  +  R+P  GP+ F Y+DG
Sbjct  53  SSGVISLGSMLGKTIQSNYNSLQEAKFTSASRSPWPGPEWFAYQDG  98

>PYAP_19223
Length=1097

 Score = 33.5 bits (75),  Expect = 0.25, Method: Composition-based stats.
 Identities = 30/91 (33%), Positives = 40/91 (44%), Gaps = 6/91 (7%)

Query  12   LIKLAQSLPADQ---KPTALDKIRHDFRSRGVISTAEELDKLV--MKAQSKISYLKIVTP  66
            L+ LAQ + A Q   K  ALD + H   +R  +ST      +V    A  +I  L +  P
Sbjct  72   LLSLAQDVIARQRLGKAGALDAVAHTL-ARFKVSTHTSGSDVVGLEDAMHRIIALLVSEP  130

Query  67   KRTPQSGPQRFIYKDGKRLDSQSLDDGGNRT  97
               P+  P  F +      DSQS D  G RT
Sbjct  131  ANIPRVSPSVFQFLLSHHDDSQSGDATGERT  161

>CCA17521
Length=104

 Score = 32.0 bits (71),  Expect = 0.38, Method: Compositional matrix adjust.
 Identities = 19/71 (27%), Positives = 37/71 (52%), Gaps = 6/71 (8%)

Query  9   YKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEELDKLVMKAQSKI------SYLK  62
           Y+++++LA+  P+ ++   ++ IR +FR    I+TA  +D  +  A + I      + L 
Sbjct  10  YRRILRLARRYPSIKRDAIINDIRMEFRESRDITTAAIIDHKIASANAGIKELLMYANLN  69

Query  63  IVTPKRTPQSG  73
            V P  T + G
Sbjct  70  PVDPNWTVEIG  80

>H257_15862
Length=829

 Score = 32.0 bits (71),  Expect = 0.90, Method: Composition-based stats.
 Identities = 20/63 (32%), Positives = 33/63 (52%), Gaps = 3/63 (5%)

Query  8    AYKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEELDKLVMKAQSKISYLKIVTPK  67
            A K+++ +  SLPAD++P+++  I H   S G I T   L       QS ++ + + TP 
Sbjct  146  AIKEILAMYTSLPADRRPSSVVVIGH---SMGGIVTRTALTLPNYNPQSILTIVTLSTPH  202

Query  68   RTP  70
              P
Sbjct  203  VAP  205

>PYVX_20854
Length=104

 Score = 30.4 bits (67),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 33/53 (62%), Gaps = 0/53 (0%)

Query  9   YKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEELDKLVMKAQSKISYL  61
           Y++++KLAQ  P+ ++ + +  I+ +F     +S A+++ + +M A++ I  L
Sbjct  11  YRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGIQEL  63

>PHALS_00244
Length=1240

 Score = 31.6 bits (70),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 19/69 (28%), Positives = 36/69 (52%), Gaps = 1/69 (1%)

Query  43   TAEELDKLVMKAQSKISY-LKIVTPKRTPQSGPQRFIYKDGKRLDSQSLDDGGNRTIKTT  101
            +A  +   V  AQ+ +S  +K    +R   SG +R +Y  G++  S  ++D G+      
Sbjct  153  SAATVCNTVNLAQATLSTPIKNPANQRYESSGTKRQVYSTGRQTLSTRVEDDGDSVFNDV  212

Query  102  DVNAMMERH  110
            DV+A++ +H
Sbjct  213  DVDALIAKH  221

>PYIR_19000
Length=739

 Score = 31.2 bits (69),  Expect = 1.5, Method: Composition-based stats.
 Identities = 16/41 (39%), Positives = 26/41 (63%), Gaps = 2/41 (5%)

Query  28   LDKIRHDFRSRGVISTAEELDKLVMKAQSKISYLK--IVTP  66
            L+ I HD + R   STA +L KL+ ++ + I+YL+   +TP
Sbjct  147  LETISHDGKYRHFYSTALDLPKLIFQSTTLITYLRYGFLTP  187

>HYAP_08499
Length=108

 Score = 30.0 bits (66),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 34/55 (62%), Gaps = 0/55 (0%)

Query  9   YKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEELDKLVMKAQSKISYLKI  63
           Y++++KLAQ  P+ ++ + +  I+ +FR+   +S A+++ K +   Q+ I  L +
Sbjct  11  YRRILKLAQRYPSIKRQSIICDIKSEFRANRNLSDAQKVRKELAVVQAGIKELSM  65

>HYAP_08500
Length=172

 Score = 30.4 bits (67),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 34/55 (62%), Gaps = 0/55 (0%)

Query  9    YKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEELDKLVMKAQSKISYLKI  63
            Y++++KLAQ  P+ ++ + +  I+ +FR+   +S A+++ K +   Q+ I  L +
Sbjct  75   YRRILKLAQRYPSIKRQSIICDIKSEFRANRNLSDAQKVRKELAVVQAGIKELSM  129

>PYIR_16217
Length=437

 Score = 30.4 bits (67),  Expect = 2.3, Method: Composition-based stats.
 Identities = 28/76 (37%), Positives = 35/76 (46%), Gaps = 12/76 (16%)

Query  3    KSVRTAYKKLIKL---AQSLPADQKPTALDKIR--------HDFRSRGVISTAEELDKLV  51
            K VRTAY KL +L   A SL     P  L  I          +F++    ST E+  K  
Sbjct  288  KDVRTAYFKLSQLILGANSLVQSAIPDLLTPIPGSAEADSLAEFKAH-YFSTLEKNSKFT  346

Query  52   MKAQSKISYLKIVTPK  67
              A SKI  LK+V P+
Sbjct  347  TNALSKIPGLKVVVPQ  362

>PHYSO_518018
Length=2716

 Score = 30.4 bits (67),  Expect = 2.6, Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 32/63 (51%), Gaps = 7/63 (11%)

Query  29    DKIRHDFRSRGVISTAEELDKLVMKA------QSKISYLKIV-TPKRTPQSGPQRFIYKD  81
             +K+     S GV STA+  D    K       + ++ YL+I  +P + PQS P +  ++ 
Sbjct  1108  EKMLQKLESEGVCSTADSGDTNRKKTFRIEHLEERLPYLEIYPSPMKDPQSDPAKVGFRT  1167

Query  82    GKR  84
             G+R
Sbjct  1168  GRR  1170

>PITG_20041
Length=721

 Score = 30.0 bits (66),  Expect = 4.3, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 0/29 (0%)

Query  77   FIYKDGKRLDSQSLDDGGNRTIKTTDVNA  105
            F    G R+  Q++DD G  T+ TTDVNA
Sbjct  618  FFQHAGFRVVEQTMDDDGAITLATTDVNA  646

>PYIW_22787
Length=438

 Score = 29.3 bits (64),  Expect = 5.9, Method: Composition-based stats.
 Identities = 27/76 (36%), Positives = 35/76 (46%), Gaps = 12/76 (16%)

Query  3    KSVRTAYKKLIKL---AQSLPADQKPTALDKIR--------HDFRSRGVISTAEELDKLV  51
            K VRTAY KL +L   A SL     P  L  +          +F++    ST E+  K  
Sbjct  286  KDVRTAYFKLSQLILGANSLVQSATPDLLTPVPGSAEADSLAEFKAH-YFSTLEKNFKFT  344

Query  52   MKAQSKISYLKIVTPK  67
              A SKI  LK+V P+
Sbjct  345  TDALSKIPGLKVVVPQ  360

>PHYRA_78515
Length=754

 Score = 29.3 bits (64),  Expect = 6.2, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 17/29 (59%), Gaps = 0/29 (0%)

Query  77   FIYKDGKRLDSQSLDDGGNRTIKTTDVNA  105
            F    G R+  Q +DD G  T+ TTDVNA
Sbjct  591  FFQHAGFRVVEQKMDDNGAITLATTDVNA  619

>PHYKE_9561
Length=528

 Score = 29.3 bits (64),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 18/55 (33%), Positives = 27/55 (49%), Gaps = 2/55 (4%)

Query  28   LDKIRHDFRSRGVISTAEELDKLVMKAQSKISYLKIVTPKRTPQSGPQRFIYKDG  82
            LD I H   SRG +ST  E    + KAQ+ +++L+      T Q  P   + +D 
Sbjct  164  LDVILHS--SRGCVSTERERATTIKKAQNILAFLEKSHRFNTVQETPDHLVQRDA  216

>SDRG_15503
Length=692

 Score = 29.3 bits (64),  Expect = 6.6, Method: Composition-based stats.
 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 0/30 (0%)

Query  67   KRTPQSGPQRFIYKDGKRLDSQSLDDGGNR  96
            KRT    P+RF Y++  R+D+ S++D   R
Sbjct  628  KRTRTVPPRRFFYEEALRVDNASINDITQR  657

>PPTG_09128
Length=646

 Score = 29.3 bits (64),  Expect = 7.5, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 17/29 (59%), Gaps = 0/29 (0%)

Query  77   FIYKDGKRLDSQSLDDGGNRTIKTTDVNA  105
            F    G R+  Q +DD G  T+ TTDVNA
Sbjct  481  FFQHAGFRVVEQKMDDEGAITLATTDVNA  509

>PHYCA_575139
Length=633

 Score = 28.9 bits (63),  Expect = 8.6, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 17/29 (59%), Gaps = 0/29 (0%)

Query  77   FIYKDGKRLDSQSLDDGGNRTIKTTDVNA  105
            F    G R+  Q +DD G  T+ TTDVNA
Sbjct  468  FFQHAGFRVVEQKMDDEGAITLATTDVNA  496

>PYIW_26923
Length=197

 Score = 28.5 bits (62),  Expect = 9.2, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 35/76 (46%), Gaps = 12/76 (16%)

Query  3    KSVRTAYKKLIKL---AQSLPADQKPTALDKI--------RHDFRSRGVISTAEELDKLV  51
            K VRTAY KL +L   A SL     P  L  +          +F++    ST E+  K  
Sbjct  48   KDVRTAYFKLSQLILGANSLVQSATPDLLTPVPGSAEADSLAEFKAH-YFSTLEKNFKFT  106

Query  52   MKAQSKISYLKIVTPK  67
              A SKI  LK+V P+
Sbjct  107  TDALSKIPGLKVVVPQ  122

>PYIR_13111
Length=278

 Score = 28.5 bits (62),  Expect = 9.3, Method: Compositional matrix adjust.
 Identities = 19/85 (22%), Positives = 40/85 (47%), Gaps = 5/85 (6%)

Query  4    SVRTAYKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEELDKLVMKAQSKISYLKI  63
            S    Y  +  + Q +P D++P+  D   + F        AEE D+L  + ++ +  +++
Sbjct  65   SADCEYGVMSVIQQEIPMDERPSGDDDPDYTFALELQAQEAEEYDRLRRQEEASMERIRV  124

Query  64   V---TPKRTP--QSGPQRFIYKDGK  83
            +    PKR    Q+  ++F + D +
Sbjct  125  IHQENPKREEIRQTLLKKFYHSDSR  149

>PYIW_23200
Length=749

 Score = 28.9 bits (63),  Expect = 10.0, Method: Compositional matrix adjust.
 Identities = 31/120 (26%), Positives = 48/120 (40%), Gaps = 40/120 (33%)

Query  10   KKLIKLAQSLPADQKPTALDK-----IRHDFRSRGVISTAEELDKLVMKAQSKISYLKIV  64
            K L+K+ +SLP D  P  +D+     +RHDF                      I+YL   
Sbjct  297  KVLVKIVESLPEDIAPLMVDQGDIHFVRHDF---------------------AITYLYRY  335

Query  65   TPK-RTPQSGPQRFIYKDGKRLDSQSLDDGGNRTIKTTDVNAMMERHVKLIRRQHFMDRK  123
             PK ++ Q      ++ +G+      LD  G  T    ++N  M   V ++  QH  D K
Sbjct  336  DPKTKSVQ------VFSEGR------LDPAGRSTSWIANMNLTMFAPV-IVHLQHIADAK  382

Lambda      K        H        a         alpha
   0.318    0.132    0.360    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3408016320

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40