Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
H257_0615281501507932e-109
H257_191041475292141507072e-95
H257_076411414641871506582e-88
H310_128321475292581505662e-73
H257_152351452591781195097e-66
H310_090711496731121124612e-59
H310_025611483322561403821e-45
H310_128941507262571443552e-41
H310_152911516142341443523e-41
H310_131061507792131373477e-41
H310_083391495022301413453e-40
H257_152221279882541433455e-40
SDRG_1367884151233521e-39
H310_152921516152301343402e-39
H310_117551279882591413403e-39
H310_069331492172591413378e-39
SPRG_0885484121233408e-38
H310_05293148919143993132e-36
H257_0943468102571443142e-35
H310_046841487961081023014e-35
H310_078491493931921393067e-35
H310_1330668102311432975e-33
H310_141461510531091032875e-33
H310_102571500113091312963e-32
SPRG_113201279882741352935e-32
SPRG_059291250402651352918e-32
SDRG_174061264412641412901e-31
SDRG_173901384462641412901e-31
SPRG_085731264412651412892e-31
H310_093731497191091032746e-31
H310_041201486681381382643e-29
H310_147381512712551422709e-29
H310_097651498671151062554e-28
SPRG_060301250931961212554e-27
H257_166701460131361432444e-26
H310_14154151059178842404e-25
PHYCA_504729440671831362232e-22
H310_14898151339140892183e-22
PHYCA_559326453551821362171e-21
H310_127141506653771412252e-21
PHYCA_112118416261341222113e-21
H310_04318148723179892101e-20
H310_15369151671209942112e-20
PHYCA_120807423971341222001e-19
H310_116081503392211322042e-19
PPTG_0793282891042073e-19
PHYCA_49721384681031031953e-19
PHYCA_13159382541422037e-19
PITG_0001081841131962e-18
PPTG_14663229201461091914e-18
H310_1518115152993651858e-18
H257_1397849451721231909e-18
PHYCA_7065639241113951861e-17
H257_1948814786256661783e-17
H310_13843150953118621801e-16
SPRG_00310122252254891853e-16
H257_183791469851551271793e-16
H310_13824150948169891794e-16
H310_144141511411691311778e-16
SPRG_18045132786215941781e-15
PYAP_15403984871141001721e-15
H257_025191393472681371782e-15
H257_092541422261411271681e-14
H310_04124148672811011603e-14
PHYSO_38364868103191201706e-14
SDRG_15163151732921361698e-14
PHALS_0885768103521191691e-13
H310_10581151732411271642e-13
H257_06253151732371461606e-13
PPTG_1426468103351201628e-13
PITG_0817268103201201611e-12
SDRG_1729413838568601491e-12
H310_135691387692051391543e-12
PHYKE_158868103331371566e-12
PHYCA_104165408242311301537e-12
PPTG_11368217821301231487e-12
PHYRA_7865668103471201559e-12
PHYCA_51041568103371201549e-12
PYAP_246091013864051011532e-11
SDRG_12398126788264951512e-11
SPRG_09172126788265951512e-11
SPRG_14160151733191341512e-11
H257_09054142124151971453e-11
PHYRA_7808875282611101484e-11
H257_181521504192091321466e-11
PITG_090727528261991451e-10
H257_138891445001381171392e-10
H257_185511470942211281432e-10
H257_098521424941651161412e-10
PPTG_0333875282601101442e-10
H257_140131445542171341432e-10
CCA1434668103251561442e-10
PITG_0582549454101121443e-10
SPRG_18521133223291921433e-10
H257_078711415652011311413e-10
SPRG_05316124701325931433e-10
PHYCA_5038334947313921433e-10
SDRG_06597124701317921433e-10
PHYSO_36201775282731101414e-10
HYAP_1401068103031091424e-10
PHYCA_53024375282691101415e-10
H310_08728149598129361346e-10
PHYCA_14089370601991411371e-09
PPTG_02416186271251231302e-09
H257_151501452021451371313e-09
PHYRA_86617731402411281344e-09
PHYSO_54807249473621001345e-09
PHYCA_9638540009135981278e-09
H310_04215126788257901301e-08
PHYCA_132727435852611041302e-08
PHYSO_470381564381451451262e-08
H257_134341443302361311292e-08
H257_19436147818199871282e-08
PYIW_256581651681481191262e-08
PHYRA_7488479262411281292e-08
PYVX_1371968103171171302e-08
H257_077551415151811301262e-08
H257_180231467631281211233e-08
PHYCA_11835042180156981244e-08
H257_190191474622291361264e-08
H257_141501446051191241214e-08
PYU1_G004359940552371031256e-08
PYIW_25568165102126631207e-08
PHYCA_6275139088116931207e-08
PYVX_2388594073261171259e-08
H257_047781402451471021219e-08
H257_03208139630105981181e-07
PPTG_002724947436971241e-07
SDRG_154991378572781251232e-07
SDRG_172661383602781251212e-07
PPTG_15787233481261231163e-07
H257_096051423982351271203e-07
PHYSO_29581948124193941193e-07
H257_039451399402301201203e-07
PHYCA_1247124370202791194e-07
H257_172351463261861191184e-07
PITG_058274947364961204e-07
H257_056481406691721351166e-07
PHYSO_5162554945412931189e-07
H257_086691419152121341169e-07
PHYSO_31748849709411931179e-07
H257_009561387692021341151e-06
PHYSO_5364564370212441151e-06
H257_049481403342471101161e-06
PPTG_14366228272831431161e-06
PPTG_0906321014273791161e-06
PHYKE_40014947496971161e-06
HYAP_0063049454321051162e-06
H257_19201147615102831092e-06
PHYSO_38959779261881001132e-06
PITG_051314370200801132e-06
PPTG_1114421711251811142e-06
H310_03921148645104461092e-06
H257_131701441411981291123e-06
PHYRA_758814945391901143e-06
PPTG_249417754380701133e-06
PHYRA_8685673300391901133e-06
H257_01994139112222861114e-06
H257_174021307471491231095e-06
PHYRA_7588449709432901126e-06
H257_02095139158198691097e-06
PPTG_0027049709249931107e-06
H310_13823150947169601089e-06
PPTG_002664945437931101e-05
PYU1_G010696962152971201091e-05
H310_0847614954446411001e-05
PHYSO_254181462881541451052e-05
PHYSO_453976559621381431052e-05
SDRG_08699136439168411062e-05
PHYSO_376280539901381391042e-05
PPTG_1128321750260781072e-05
PPTG_0460119419260781072e-05
H257_1927814767688661012e-05
PPTG_2167826348104961013e-05
PYIW_15058163014131591033e-05
PHYRA_758774947406951063e-05
PHYCA_38983379952171281053e-05
PHYCA_14293370921601391034e-05
PITG_19098151732951281054e-05
H310_034631485495235974e-05
PHYCA_98971402752951281054e-05
PHYCA_4828151732951281054e-05
PPTG_0635119972225921044e-05
PPTG_248541513291811044e-05
PPTG_0379119179108461005e-05
PHYCA_12923043121141801016e-05
PHYSO_373613538831301001006e-05
PHYSO_340307526684791271046e-05
PHYSO_380505541561381431006e-05
PHYKE_61627528201571026e-05
H310_149541513621491261016e-05
H257_08032126788251901029e-05
H257_06895141114202611011e-04
H257_15302129139344871021e-04
PITG_12686103202231281001e-04
PHYSO_32576350528157116982e-04
PHYSO_33624052060159125982e-04
PPTG_058431976016966972e-04
CCI474956810285123992e-04
H310_03462143096243137983e-04
H257_1854314708932373983e-04
PPTG_1977924882319118983e-04
PYIW_25874165316201125973e-04
H257_07182141247209111973e-04
H257_11101143096260134983e-04
H310_15161144330236128974e-04
H257_16845146121209111964e-04
H257_18804147281219115965e-04
PYIW_15637163716272128965e-04
SDRG_0465312770024363956e-04
H257_14889145060157102947e-04
PHYCA_12568642785290135959e-04
H310_03385148533223136949e-04
H310_15319141984227126949e-04
PHYSO_37873154080138143920.001
PYIW_26363165685144110920.001
H257_1043614277152787940.001
H310_038511486289776870.002
H257_0883914198615851900.002
H257_12325143695191139900.003
H310_12821150692179109900.003
H257_00377138602223126900.003
PPTG_0850020825285127900.004
H257_1815114684313060870.004
PPTG_066332005729281890.005
H257_1475914495919894880.005
PPTG_169642373910479850.005
H310_1058015010319927880.006
PHYRA_787617075118483870.006
PITG_08385696820435880.006
PHYSO_33009751135203133880.006
PPTG_0411819262274115880.006
H257_1070714290821345880.006
PHYSO_32234750096202143870.007
H257_1865414717316280860.007
H257_0179213902916280860.007
H310_04226144050236131870.007
H310_14075138602217126860.009
H310_15160151514200101860.010
SPRG_048337926219119840.019
H257_07657141475212131830.026
PHYSO_43500155628138143810.028
PPTG_204182105219100820.038
PHALS_064091269322794820.040
H257_08837141984225126820.042
PHYSO_3099264948516068800.044
PHYRA_9367812693217102800.058
PITG_095907926195117800.064
PPTG_182961269324896800.067
PPTG_037971918321078800.070
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= H257_06152

Length=150
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

H257_06152                                                            310        2e-109
H257_19104                                                            276        2e-95 
H257_07641                                                            258        2e-88 
H310_12832                                                            222        2e-73 
H257_15235                                                            200        7e-66 
H310_09071                                                            182        2e-59 
H310_02561                                                            151        1e-45 
H310_12894                                                            141        2e-41 
H310_15291                                                            140        3e-41 
H310_13106                                                            138        7e-41 
H310_08339                                                            137        3e-40 
H257_15222                                                            137        5e-40 
SDRG_13678                                                            140        1e-39 
H310_15292                                                            135        2e-39 
H310_11755                                                            135        3e-39 
H310_06933                                                            134        8e-39 
SPRG_08854                                                            135        8e-38 
H310_05293                                                            125        2e-36 
H257_09434                                                            125        2e-35 
H310_04684                                                            120        4e-35 
H310_07849                                                            122        7e-35 
H310_13306                                                            119        5e-33 
H310_14146                                                            115        5e-33 
H310_10257                                                            118        3e-32 
SPRG_11320                                                            117        5e-32 
SPRG_05929                                                            116        8e-32 
SDRG_17406                                                            116        1e-31 
SDRG_17390                                                            116        1e-31 
SPRG_08573                                                            115        2e-31 
H310_09373                                                            110        6e-31 
H310_04120                                                            106        3e-29 
H310_14738                                                            108        9e-29 
H310_09765                                                            102        4e-28 
SPRG_06030                                                            102        4e-27 
H257_16670                                                            98.6       4e-26 
H310_14154                                                            97.1       4e-25 
PHYCA_504729                                                          90.5       2e-22 
H310_14898                                                            88.6       3e-22 
PHYCA_559326                                                          88.2       1e-21 
H310_12714                                                            91.3       2e-21 
PHYCA_112118                                                          85.9       3e-21 
H310_04318                                                            85.5       1e-20 
H310_15369                                                            85.9       2e-20 
PHYCA_120807                                                          81.6       1e-19 
H310_11608                                                            83.2       2e-19 
PPTG_07932                                                            84.3       3e-19 
PHYCA_49721                                                           79.7       3e-19 
PHYCA_131593                                                          82.8       7e-19 
PITG_00010                                                            80.1       2e-18 
PPTG_14663                                                            78.2       4e-18 
H310_15181                                                            75.9       8e-18 
H257_13978                                                            77.8       9e-18 
PHYCA_70656                                                           76.3       1e-17 
H257_19488                                                            73.2       3e-17 
H310_13843                                                            73.9       1e-16 
SPRG_00310                                                            75.9       3e-16 
H257_18379                                                            73.6       3e-16 
H310_13824                                                            73.6       4e-16 
H310_14414                                                            72.8       8e-16 
SPRG_18045                                                            73.2       1e-15 
PYAP_15403                                                            70.9       1e-15 
H257_02519                                                            73.2       2e-15 
H257_09254                                                            69.3       1e-14 
H310_04124                                                            66.2       3e-14 
PHYSO_383648                                                          70.1       6e-14 
SDRG_15163                                                            69.7       8e-14 
PHALS_08857                                                           69.7       1e-13 
H310_10581                                                            67.8       2e-13 
H257_06253                                                            66.2       6e-13 
PPTG_14264                                                            67.0       8e-13 
PITG_08172                                                            66.6       1e-12 
SDRG_17294                                                            62.0       1e-12 
H310_13569                                                            63.9       3e-12 
PHYKE_1588                                                            64.7       6e-12 
PHYCA_104165                                                          63.5       7e-12 
PPTG_11368                                                            61.6       7e-12 
PHYRA_78656                                                           64.3       9e-12 
PHYCA_510415                                                          63.9       9e-12 
PYAP_24609                                                            63.5       2e-11 
SDRG_12398                                                            62.8       2e-11 
SPRG_09172                                                            62.8       2e-11 
SPRG_14160                                                            62.8       2e-11 
H257_09054                                                            60.5       3e-11 
PHYRA_78088                                                           61.6       4e-11 
H257_18152                                                            60.8       6e-11 
PITG_09072                                                            60.5       1e-10 
H257_13889                                                            58.2       2e-10 
H257_18551                                                            59.7       2e-10 
H257_09852                                                            58.9       2e-10 
PPTG_03338                                                            60.1       2e-10 
H257_14013                                                            59.7       2e-10 
CCA14346                                                              60.1       2e-10 
PITG_05825                                                            60.1       3e-10 
SPRG_18521                                                            59.7       3e-10 
H257_07871                                                            58.9       3e-10 
SPRG_05316                                                            59.7       3e-10 
PHYCA_503833                                                          59.7       3e-10 
SDRG_06597                                                            59.7       3e-10 
PHYSO_362017                                                          58.9       4e-10 
HYAP_14010                                                            59.3       4e-10 
PHYCA_530243                                                          58.9       5e-10 
H310_08728                                                            56.2       6e-10 
PHYCA_14089                                                           57.4       1e-09 
PPTG_02416                                                            54.7       2e-09 
H257_15150                                                            55.1       3e-09 
PHYRA_86617                                                           56.2       4e-09 
PHYSO_548072                                                          56.2       5e-09 
PHYCA_96385                                                           53.5       8e-09 
H310_04215                                                            54.7       1e-08 
PHYCA_132727                                                          54.7       2e-08 
PHYSO_470381                                                          53.1       2e-08 
H257_13434                                                            54.3       2e-08 
H257_19436                                                            53.9       2e-08 
PYIW_25658                                                            53.1       2e-08 
PHYRA_74884                                                           54.3       2e-08 
PYVX_13719                                                            54.7       2e-08 
H257_07755                                                            53.1       2e-08 
H257_18023                                                            52.0       3e-08 
PHYCA_118350                                                          52.4       4e-08 
H257_19019                                                            53.1       4e-08 
H257_14150                                                            51.2       4e-08 
PYU1_G004359                                                          52.8       6e-08 
PYIW_25568                                                            50.8       7e-08 
PHYCA_62751                                                           50.8       7e-08 
PYVX_23885                                                            52.8       9e-08 
H257_04778                                                            51.2       9e-08 
H257_03208                                                            50.1       1e-07 
PPTG_00272                                                            52.4       1e-07 
SDRG_15499                                                            52.0       2e-07 
SDRG_17266                                                            51.2       2e-07 
PPTG_15787                                                            49.3       3e-07 
H257_09605                                                            50.8       3e-07 
PHYSO_295819                                                          50.4       3e-07 
H257_03945                                                            50.8       3e-07 
PHYCA_124712                                                          50.4       4e-07 
H257_17235                                                            50.1       4e-07 
PITG_05827                                                            50.8       4e-07 
H257_05648                                                            49.3       6e-07 
PHYSO_516255                                                          50.1       9e-07 
H257_08669                                                            49.3       9e-07 
PHYSO_317488                                                          49.7       9e-07 
H257_00956                                                            48.9       1e-06 
PHYSO_536456                                                          48.9       1e-06 
H257_04948                                                            49.3       1e-06 
PPTG_14366                                                            49.3       1e-06 
PPTG_09063                                                            49.3       1e-06 
PHYKE_4001                                                            49.3       1e-06 
HYAP_00630                                                            49.3       2e-06 
H257_19201                                                            46.6       2e-06 
PHYSO_389597                                                          48.1       2e-06 
PITG_05131                                                            48.1       2e-06 
PPTG_11144                                                            48.5       2e-06 
H310_03921                                                            46.6       2e-06 
H257_13170                                                            47.8       3e-06 
PHYRA_75881                                                           48.5       3e-06 
PPTG_24941                                                            48.1       3e-06 
PHYRA_86856                                                           48.1       3e-06 
H257_01994                                                            47.4       4e-06 
H257_17402                                                            46.6       5e-06 
PHYRA_75884                                                           47.8       6e-06 
H257_02095                                                            46.6       7e-06 
PPTG_00270                                                            47.0       7e-06 
H310_13823                                                            46.2       9e-06 
PPTG_00266                                                            47.0       1e-05 
PYU1_G010696                                                          46.6       1e-05 
H310_08476                                                            43.1       1e-05 
PHYSO_254181                                                          45.1       2e-05 
PHYSO_453976                                                          45.1       2e-05 
SDRG_08699                                                            45.4       2e-05 
PHYSO_376280                                                          44.7       2e-05 
PPTG_11283                                                            45.8       2e-05 
PPTG_04601                                                            45.8       2e-05 
H257_19278                                                            43.5       2e-05 
PPTG_21678                                                            43.5       3e-05 
PYIW_15058                                                            44.3       3e-05 
PHYRA_75877                                                           45.4       3e-05 
PHYCA_38983                                                           45.1       3e-05 
PHYCA_14293                                                           44.3       4e-05 
PITG_19098                                                            45.1       4e-05 
H310_03463                                                            42.0       4e-05 
PHYCA_98971                                                           45.1       4e-05 
PHYCA_4828                                                            45.1       4e-05 
PPTG_06351                                                            44.7       4e-05 
PPTG_24854                                                            44.7       4e-05 
PPTG_03791                                                            43.1       5e-05 
PHYCA_129230                                                          43.5       6e-05 
PHYSO_373613                                                          43.1       6e-05 
PHYSO_340307                                                          44.7       6e-05 
PHYSO_380505                                                          43.1       6e-05 
PHYKE_6162                                                            43.9       6e-05 
H310_14954                                                            43.5       6e-05 
H257_08032                                                            43.9       9e-05 
H257_06895                                                            43.5       1e-04 
H257_15302                                                            43.9       1e-04 
PITG_12686                                                            43.1       1e-04 
PHYSO_325763                                                          42.4       2e-04 
PHYSO_336240                                                          42.4       2e-04 
PPTG_05843                                                            42.0       2e-04 
CCI47495                                                              42.7       2e-04 
H310_03462                                                            42.4       3e-04 
H257_18543                                                            42.4       3e-04 
PPTG_19779                                                            42.4       3e-04 
PYIW_25874                                                            42.0       3e-04 
H257_07182                                                            42.0       3e-04 
H257_11101                                                            42.4       3e-04 
H310_15161                                                            42.0       4e-04 
H257_16845                                                            41.6       4e-04 
H257_18804                                                            41.6       5e-04 
PYIW_15637                                                            41.6       5e-04 
SDRG_04653                                                            41.2       6e-04 
H257_14889                                                            40.8       7e-04 
PHYCA_125686                                                          41.2       9e-04 
H310_03385                                                            40.8       9e-04 
H310_15319                                                            40.8       9e-04 
PHYSO_378731                                                          40.0       0.001 
PYIW_26363                                                            40.0       0.001 
H257_10436                                                            40.8       0.001 
H310_03851                                                            38.1       0.002 
H257_08839                                                            39.3       0.002 
H257_12325                                                            39.3       0.003 
H310_12821                                                            39.3       0.003 
H257_00377                                                            39.3       0.003 
PPTG_08500                                                            39.3       0.004 
H257_18151                                                            38.1       0.004 
PPTG_06633                                                            38.9       0.005 
H257_14759                                                            38.5       0.005 
PPTG_16964                                                            37.4       0.005 
H310_10580                                                            38.5       0.006 
PHYRA_78761                                                           38.1       0.006 
PITG_08385                                                            38.5       0.006 
PHYSO_330097                                                          38.5       0.006 
PPTG_04118                                                            38.5       0.006 
H257_10707                                                            38.5       0.006 
PHYSO_322347                                                          38.1       0.007 
H257_18654                                                            37.7       0.007 
H257_01792                                                            37.7       0.007 
H310_04226                                                            38.1       0.007 
H310_14075                                                            37.7       0.009 
H310_15160                                                            37.7       0.010 
SPRG_04833                                                            37.0       0.019 
H257_07657                                                            36.6       0.026 
PHYSO_435001                                                          35.8       0.028 
PPTG_20418                                                            36.2       0.038 
PHALS_06409                                                           36.2       0.040 
H257_08837                                                            36.2       0.042 
PHYSO_309926                                                          35.4       0.044 
PHYRA_93678                                                           35.4       0.058 
PITG_09590                                                            35.4       0.064 
PPTG_18296                                                            35.4       0.067 
PPTG_03797                                                            35.4       0.070 
PYAP_22661                                                            35.4       0.078 
HYAP_06778                                                            35.0       0.085 
SPRG_10836                                                            33.5       0.087 
H257_06101                                                            35.0       0.11  
H310_00744                                                            34.3       0.13  
H257_05356                                                            34.3       0.15  
H257_04751                                                            33.5       0.15  
H257_15530                                                            34.3       0.16  
PYAR_24700                                                            33.9       0.16  
PPTG_15516                                                            34.7       0.17  
PYAP_22042                                                            34.7       0.17  
PYVX_19651                                                            33.9       0.25  
PYIW_22501                                                            33.5       0.29  
PPTG_10963                                                            33.9       0.30  
PYIW_24031                                                            33.5       0.30  
H310_11951                                                            32.0       0.32  
PHYSO_259775                                                          33.1       0.36  
PHYCA_14305                                                           32.7       0.38  
HYAP_08445                                                            33.5       0.39  
HYAP_08446                                                            33.5       0.39  
PYVX_17808                                                            33.1       0.39  
PITG_15738                                                            33.1       0.39  
PYAP_23972                                                            33.5       0.42  
H310_11465                                                            32.7       0.47  
PPTG_19441                                                            33.1       0.49  
H257_11942                                                            32.7       0.52  
PPTG_06289                                                            32.7       0.53  
PYVX_14788                                                            33.1       0.54  
PPTG_06723                                                            32.3       0.61  
PHYSO_474101                                                          32.3       0.65  
PHYSO_389268                                                          31.2       0.88  
H310_15068                                                            31.2       0.89  
HYAP_03679                                                            32.0       0.94  
PHYCA_100220                                                          32.0       0.98  
PHYSO_306677                                                          32.0       1.2   
H257_13416                                                            31.6       1.5   
H257_16195                                                            31.2       1.6   
H257_04666                                                            31.2       1.7   
PITG_02413                                                            31.2       1.7   
H310_11875                                                            31.2       1.7   
PPTG_07779                                                            30.4       2.1   
H257_14753                                                            30.0       2.6   
H257_13212                                                            30.4       2.8   
PHYRA_84895                                                           30.4       3.0   
H310_15396                                                            30.0       3.4   
PYU1_G002532                                                          30.8       3.6   
H310_14557                                                            30.4       3.9   
PHYSO_502947                                                          30.4       4.3   
PHYKE_7729                                                            30.4       4.3   
PHYCA_509662                                                          30.4       4.5   
PHYRA_74086                                                           30.4       4.6   
CCI48126                                                              30.0       5.2   
H257_13222                                                            29.6       5.5   
H257_00966                                                            28.5       5.6   
H257_08495                                                            28.9       6.1   
PYU1_G000844                                                          29.6       6.8   
PPTG_16083                                                            29.6       7.1   
H257_10999                                                            29.6       7.2   
SDRG_12223                                                            29.3       7.2   
SDRG_14585                                                            29.3       7.2   
HYAP_12064                                                            28.9       7.4   
H310_03819                                                            29.6       7.5   
SPRG_02266                                                            29.6       7.8   
PHYSO_247821                                                          29.3       8.6   
H257_16655                                                            27.7       9.1   
CCA22071                                                              29.3       9.1   
PHYRA_87048                                                           29.6       9.2   

>H257_06152
Length=150

 Score = 310 bits (793),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 150/150 (100%), Positives = 150/150 (100%), Gaps = 0/150 (0%)

Query  1    MEEDTESEVQASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRL  60
            MEEDTESEVQASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRL
Sbjct  1    MEEDTESEVQASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRL  60

Query  61   CGDGITVNATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQ  120
            CGDGITVNATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQ
Sbjct  61   CGDGITVNATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQ  120

Query  121  TDKEEKAKQNERRETNGEKIRDAAMSTMKR  150
            TDKEEKAKQNERRETNGEKIRDAAMSTMKR
Sbjct  121  TDKEEKAKQNERRETNGEKIRDAAMSTMKR  150

>H257_19104
Length=214

 Score = 276 bits (707),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 136/150 (91%), Positives = 141/150 (94%), Gaps = 0/150 (0%)

Query  1    MEEDTESEVQASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRL  60
            MEEDTESEVQASQR KT FRFKGCTDVELLKE+IHV+PYEAPHGEV K WTEVTEHLQRL
Sbjct  1    MEEDTESEVQASQRRKTAFRFKGCTDVELLKEVIHVQPYEAPHGEVRKRWTEVTEHLQRL  60

Query  61   CGDGITVNATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQ  120
             GDGITVNATRKR DDL+TAFHA+TMAAL ASGTDEEYEEREQLLQDIH LVDAA I+KQ
Sbjct  61   YGDGITVNATRKRSDDLITAFHANTMAALCASGTDEEYEEREQLLQDIHGLVDAAFIQKQ  120

Query  121  TDKEEKAKQNERRETNGEKIRDAAMSTMKR  150
            TDKEEKAKQNERRETNGEKIRDAAMSTMKR
Sbjct  121  TDKEEKAKQNERRETNGEKIRDAAMSTMKR  150

>H257_07641
Length=187

 Score = 258 bits (658),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 133/150 (89%), Gaps = 9/150 (6%)

Query  1    MEEDTESEVQASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRL  60
            MEEDTESEVQASQR KT FRFKGCTDVELLKE+IHVRPYE PHGEV K WTEVTEHLQRL
Sbjct  1    MEEDTESEVQASQRCKTAFRFKGCTDVELLKEVIHVRPYEGPHGEVRKRWTEVTEHLQRL  60

Query  61   CGDGITVNATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQ  120
             GDGITVNATRKRFDDLMTAFHA+TMAALRASGT+++YEEREQLLQDIHDL         
Sbjct  61   YGDGITVNATRKRFDDLMTAFHANTMAALRASGTEQDYEEREQLLQDIHDL---------  111

Query  121  TDKEEKAKQNERRETNGEKIRDAAMSTMKR  150
            TDKEEKAK NERRETNGEKIRDAAMS MKR
Sbjct  112  TDKEEKAKHNERRETNGEKIRDAAMSIMKR  141

>H310_12832
Length=258

 Score = 222 bits (566),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 131/150 (87%), Gaps = 0/150 (0%)

Query  1    MEEDTESEVQASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRL  60
            MEED E + Q + R  T FRFKGCTDVELLKE+ HVRP+EAP+GEV K WTEV+EHLQR+
Sbjct  1    MEEDAEVDAQFALRRNTAFRFKGCTDVELLKEVNHVRPFEAPYGEVRKRWTEVSEHLQRI  60

Query  61   CGDGITVNATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQ  120
             G GITVNATRKRFDDLMTAF  +TMAALRASGT+EEYEEREQLLQD HDLVD AS++KQ
Sbjct  61   YGTGITVNATRKRFDDLMTAFQEETMAALRASGTEEEYEEREQLLQDNHDLVDTASVKKQ  120

Query  121  TDKEEKAKQNERRETNGEKIRDAAMSTMKR  150
              K+EKA+QNERRE++GE+IRDAAM+T+KR
Sbjct  121  ACKDEKARQNERRESDGERIRDAAMTTIKR  150

>H257_15235
Length=178

 Score = 200 bits (509),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 103/119 (87%), Gaps = 9/119 (8%)

Query  32   EIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKRFDDLMTAFHADTMAALRA  91
            E+IHVRPYEAPHGEV K WT+VTEHLQRL G GITVNATRKRFDDLMTAFHAD+MAALR 
Sbjct  9    EVIHVRPYEAPHGEVRKRWTKVTEHLQRLHGVGITVNATRKRFDDLMTAFHADSMAALRV  68

Query  92   SGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETNGEKIRDAAMSTMKR  150
            SGTDEEYEER QLLQDIHDL         TDKEEKAKQNER ETNGEKIRDAAMSTMKR
Sbjct  69   SGTDEEYEERAQLLQDIHDL---------TDKEEKAKQNERHETNGEKIRDAAMSTMKR  118

>H310_09071
Length=112

 Score = 182 bits (461),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 102/112 (91%), Gaps = 0/112 (0%)

Query  1    MEEDTESEVQASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRL  60
            ME+DTE+ VQ++QR KT FRFKGCTDV+LLKE+ HVRP+EAP GEV K WTEVTEHLQR+
Sbjct  1    MEDDTETAVQSNQRRKTAFRFKGCTDVDLLKEVKHVRPFEAPRGEVRKRWTEVTEHLQRI  60

Query  61   CGDGITVNATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLV  112
             GDGITVN TRKRFDDLMTAFH DTMAALRASGT+EEYEEREQLLQDIHDLV
Sbjct  61   IGDGITVNVTRKRFDDLMTAFHEDTMAALRASGTEEEYEEREQLLQDIHDLV  112

>H310_02561
Length=256

 Score = 151 bits (382),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 103/140 (74%), Gaps = 4/140 (3%)

Query  11   ASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNAT  70
            A++R KT FR+    D++LLKE++ V PY+AP+G+    W E+ +H+++L GD +T  + 
Sbjct  7    ANKRKKTAFRYSVSADIDLLKEVVMVAPYDAPYGQTSARWEEICDHMRQLHGDSLTTASC  66

Query  71   RKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQN  130
            RKRFDDL++AF   T+ ALRASGT+EEY ER+QL+QDI D++D A +RK+  K+ +    
Sbjct  67   RKRFDDLLSAFKKSTLKALRASGTEEEYVERDQLMQDISDMMDVALLRKKAAKQVQ----  122

Query  131  ERRETNGEKIRDAAMSTMKR  150
            ERRE++G  IR+AA+ +MKR
Sbjct  123  ERRESDGHLIREAALMSMKR  142

>H310_12894
Length=257

 Score = 141 bits (355),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 104/144 (72%), Gaps = 1/144 (1%)

Query  7    SEVQASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGIT  66
            SEV+ S+R KT +RF    D++LLKE + V P++AP+G+    W E+ EH+++L G  +T
Sbjct  2    SEVEGSKR-KTAYRFTTQVDIDLLKEAMFVCPHDAPYGQASARWEEIAEHMRQLHGPDLT  60

Query  67   VNATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEK  126
                RKR DDL+ AF  DT+ +LRASGT+EEY ER+QLLQD+ D+++ A   K+  K+EK
Sbjct  61   TAGCRKRLDDLIAAFKKDTVKSLRASGTEEEYNERDQLLQDLADMMENAVRAKKALKDEK  120

Query  127  AKQNERRETNGEKIRDAAMSTMKR  150
             K+ ++RE++G ++R+AA+ T+KR
Sbjct  121  IKKQDKRESDGHRVREAALVTLKR  144

>H310_15291
Length=234

 Score = 140 bits (352),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 98/144 (68%), Gaps = 1/144 (1%)

Query  7    SEVQASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGIT  66
            SEV   +R KT +RF    D++LLKE++ VRP++AP+G+    W EV EH++ + G  +T
Sbjct  2    SEVDGVKR-KTAYRFTTQVDIDLLKEVMAVRPHDAPYGQTLARWEEVVEHMREMRGPDLT  60

Query  67   VNATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEK  126
                RKR DDLM AF  DT+ +LRA+GT+EEY EREQL+QD+ D++D A   K T KEEK
Sbjct  61   TAGCRKRLDDLMAAFKKDTVKSLRATGTEEEYNEREQLIQDLSDMMDTAYKTKTTLKEEK  120

Query  127  AKQNERRETNGEKIRDAAMSTMKR  150
             K+ + RE  G  +R+ A+ TMKR
Sbjct  121  NKKIDIREREGLMLRETALMTMKR  144

>H310_13106
Length=213

 Score = 138 bits (347),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 96/137 (70%), Gaps = 0/137 (0%)

Query  14   RHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKR  73
            + KT +RF    D++LLKE++ V P+EAP+G++   W EV EH++ + G  +     RK 
Sbjct  8    KRKTAYRFTTQVDIDLLKEVMAVCPHEAPYGQILARWEEVVEHIREMHGPDLITAGCRKS  67

Query  74   FDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERR  133
             DDLM AF  DT+ +LRA+GT+EEY EREQL+QD+ D++D+A   K+  KEEK+K+ ++R
Sbjct  68   LDDLMAAFKKDTVKSLRATGTEEEYNEREQLIQDLSDMMDSAYKTKKALKEEKSKKIDKR  127

Query  134  ETNGEKIRDAAMSTMKR  150
            E  G  +R+AA+ TMKR
Sbjct  128  EKEGLMLREAALMTMKR  144

>H310_08339
Length=230

 Score = 137 bits (345),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 99/141 (70%), Gaps = 4/141 (3%)

Query  10   QASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNA  69
            +A++R KT FRF    D++LLKE++ V P++A +G+    W EV EH+++L G+ +T   
Sbjct  6    EATRRKKTAFRFSVSADIDLLKEVVMVVPFDAAYGQTSARWDEVCEHMRQLHGNAMTSVC  65

Query  70   TRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQ  129
             RKRFDDL+ AF   ++ ALRASGT+EEY ER+QL+QDI D++D A +RK+  K  +   
Sbjct  66   CRKRFDDLLPAFKKSSLKALRASGTEEEYLERDQLMQDISDMMDIALLRKKAAKLVQ---  122

Query  130  NERRETNGEKIRDAAMSTMKR  150
             ERRE++   IR+AA++ MKR
Sbjct  123  -ERRESDSHLIREAALTGMKR  142

>H257_15222
Length=254

 Score = 137 bits (345),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 98/143 (69%), Gaps = 0/143 (0%)

Query  8    EVQASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITV  67
            +VQA  + K    F    DV+L+KE++ + P++AP+G+    W EV EH++ +  D ++ 
Sbjct  6    DVQAEGKKKPAHGFTTPQDVDLIKEVMSICPHDAPYGQTSARWAEVGEHMRTIHVDSLSA  65

Query  68   NATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKA  127
               RKR DDL+ AF    +A+LRASGTDEEY+EREQLLQD+ D++D  S +K+  KE+K 
Sbjct  66   TGCRKRCDDLLVAFQKAMLASLRASGTDEEYDEREQLLQDLSDMIDMISNKKKATKEDKC  125

Query  128  KQNERRETNGEKIRDAAMSTMKR  150
            K+ ++RE++G  +R AA++ MKR
Sbjct  126  KKMDKRESDGHTVRSAALTGMKR  148

>SDRG_13678
Length=415

 Score = 140 bits (352),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 90/123 (73%), Gaps = 0/123 (0%)

Query  13   QRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRK  72
            Q+ KT FRF+  +D++LL+E+++++P+ APHG+    WT+V  H+ R+ G GIT N  RK
Sbjct  52   QKRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRK  111

Query  73   RFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNER  132
            RFDDLM+AF  D+++ LRASG++EEY+ER  LLQDIHD +  ++ RK+  KEE    +ER
Sbjct  112  RFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKREVKEESVVPDER  171

Query  133  RET  135
             ++
Sbjct  172  PDS  174

>H310_15292
Length=230

 Score = 135 bits (340),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 94/134 (70%), Gaps = 0/134 (0%)

Query  12   SQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATR  71
            S + K  F FK  +D +LLK +IH++P++AP+      W EV  ++    GD +T  + R
Sbjct  4    SSKRKVAFLFKPASDFDLLKVVIHIQPFDAPYEADKTRWEEVAANMCITHGDTLTAVSCR  63

Query  72   KRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNE  131
            KRFDDL+ AF  D + +LRASGT+EEY EREQL+QDI DL++ +  RK++ KEEK  + E
Sbjct  64   KRFDDLIVAFKDDKLNSLRASGTEEEYNEREQLMQDIVDLMNTSQDRKRSVKEEKTAKFE  123

Query  132  RRETNGEKIRDAAM  145
            +RE++GE++RDAAM
Sbjct  124  KRESDGERLRDAAM  137

>H310_11755
Length=259

 Score = 135 bits (340),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 100/141 (71%), Gaps = 0/141 (0%)

Query  10   QASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNA  69
            Q   + K  +RF    D++LLKE++   P++AP+G+    W EV EH++ L G  ++   
Sbjct  4    QEGTKRKAAYRFSIPVDIDLLKEVMFACPHDAPYGQTSSRWQEVGEHMRALHGPELSAGG  63

Query  70   TRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQ  129
             RKR DDLM AF  +T+ ++RASGT+EEY EREQLLQD+ D++++A+ ++++ KEEK K+
Sbjct  64   CRKRHDDLMAAFKKETVKSMRASGTEEEYLEREQLLQDLSDMIESANDKRKSIKEEKDKK  123

Query  130  NERRETNGEKIRDAAMSTMKR  150
             +RRE++G  IR+AA++ +KR
Sbjct  124  ADRRESDGHLIREAALAGLKR  144

>H310_06933
Length=259

 Score = 134 bits (337),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 100/141 (71%), Gaps = 0/141 (0%)

Query  10   QASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNA  69
            Q   + K  +RF    D+++LKE++   P++AP+G+    W EV EH++ L G  ++   
Sbjct  4    QEGTKRKAAYRFSIPVDIDMLKEVMFACPHDAPYGQTSSRWQEVGEHMRALLGPELSAGG  63

Query  70   TRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQ  129
             RKR DDLM AF  +T+ ++RASGT+EEY EREQLLQD+ D++++A+ ++++ +EEK K+
Sbjct  64   CRKRHDDLMAAFKKETVKSMRASGTEEEYLEREQLLQDLSDMIESANDKRKSIQEEKDKK  123

Query  130  NERRETNGEKIRDAAMSTMKR  150
             +RRE++G  IR+AA++ +KR
Sbjct  124  ADRRESDGHLIREAALAGLKR  144

>SPRG_08854
Length=412

 Score = 135 bits (340),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 89/123 (72%), Gaps = 0/123 (0%)

Query  13   QRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRK  72
            Q+ KT FRF+  +D++LL+E+++++P+ APHG+    WT+V   + ++ G GIT N  RK
Sbjct  46   QKRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATQVAQIHGSGITPNNVRK  105

Query  73   RFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNER  132
            RFDDLM+AF  D+++ LRASG++EEY+ER  LLQDIHD +  ++ RK+  KEE    +ER
Sbjct  106  RFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKREVKEESVVPDER  165

Query  133  RET  135
             ++
Sbjct  166  PDS  168

>H310_05293
Length=143

 Score = 125 bits (313),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 74/99 (75%), Gaps = 0/99 (0%)

Query  12   SQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATR  71
            S + K  FRFK  +DV+LLKE+IH++PY+AP+G V   W EV  ++    GDG+T  + R
Sbjct  4    SAKRKAAFRFKSASDVDLLKEVIHIQPYDAPYGAVKSRWDEVAANMCMTYGDGLTSVSCR  63

Query  72   KRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHD  110
            KRFDDL+ AF  +T+++LRASGT+EEY EREQLLQDI D
Sbjct  64   KRFDDLLDAFKRNTISSLRASGTEEEYNEREQLLQDIVD  102

>H257_09434
Length=257

 Score = 125 bits (314),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 95/144 (66%), Gaps = 2/144 (1%)

Query  7    SEVQASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGIT  66
            S+ Q S + K   RF    DV+LLKE++ + P++AP+G+    W EV + ++ + GD ++
Sbjct  2    SDEQGSAKRKPAHRFTIPQDVDLLKEVLTICPHDAPYGQTSGRWAEVGDRMRTIHGDSLS  61

Query  67   VNATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEK  126
                RKR DDL+ AFH D++A+LRASGTDE++ EREQLLQD+  L+DA S +K+  KE+K
Sbjct  62   ATGCRKRCDDLLAAFHKDSLASLRASGTDEQHHEREQLLQDLKALIDAISDKKRASKEDK  121

Query  127  AKQNERRETNGEKIRDAAMSTMKR  150
              + ++RE     +R  A+  +KR
Sbjct  122  GSREDKREARDPAVR--AVVDLKR  143

>H310_04684
Length=108

 Score = 120 bits (301),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 76/102 (75%), Gaps = 0/102 (0%)

Query  11   ASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNAT  70
            A++R KT FR+    D++LLKE++ V PY+A +G+    W E+ +H+++L GD +T  + 
Sbjct  7    ANKRKKTAFRYSVSADIDLLKEVVMVAPYDARYGQTSARWEEICDHMRQLHGDSLTTASC  66

Query  71   RKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLV  112
            RKRFDDL++AF   T+ ALRASGT+EEY ER+QL+QDI D+V
Sbjct  67   RKRFDDLLSAFKKSTLKALRASGTEEEYVERDQLMQDISDMV  108

>H310_07849
Length=192

 Score = 122 bits (306),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 97/139 (70%), Gaps = 0/139 (0%)

Query  12   SQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATR  71
            S + K   RF    DV+L+KE+I V P++AP+G++   W EV +++Q +    +T +  +
Sbjct  3    SAKKKPAHRFTLQQDVDLIKEVISVSPHDAPYGQLSTRWAEVGQNMQAIYASNLTASGCQ  62

Query  72   KRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNE  131
            KR D+L+ AFH D +A+LRASGT+E Y EREQLLQD+ D++D+ + +K+T KEEK K+ +
Sbjct  63   KRCDELLVAFHKDNIASLRASGTEENYNEREQLLQDLSDMIDSIADKKRTFKEEKGKKED  122

Query  132  RRETNGEKIRDAAMSTMKR  150
            +RET+G  IR+A M  M R
Sbjct  123  KRETDGHMIREATMVAMSR  141

>H310_13306
Length=231

 Score = 119 bits (297),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 94/143 (66%), Gaps = 4/143 (3%)

Query  8    EVQASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITV  67
            E+  + + K  +RF    DV+LL E++ V P++A +G+    W E+ ++++ + G+ IT 
Sbjct  3    ELSDTTKRKPAYRFTNTADVDLLNEVVLVAPFDAGYGQTTARWDEIGDNMRSIHGEAITA  62

Query  68   NATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKA  127
               R+RFDDL+ AF   T+ ALR+SGT+EEY ER+QLLQDI DL+DA      T K+   
Sbjct  63   ICCRRRFDDLLAAFKKATLKALRSSGTEEEYNERDQLLQDIVDLIDA----AATKKKALK  118

Query  128  KQNERRETNGEKIRDAAMSTMKR  150
            +  ++RET+G  IR+AA+ ++KR
Sbjct  119  QVQDKRETDGHLIREAALVSLKR  141

>H310_14146
Length=109

 Score = 115 bits (287),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 73/103 (71%), Gaps = 0/103 (0%)

Query  10   QASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNA  69
            +A +R KT FRF    D++LLKE++ + P+EA +G+   GW  + EH++   GD +T  +
Sbjct  6    EAIRRKKTAFRFSVSADIDLLKEVVMIAPFEAAYGQTGAGWEGICEHMRVSHGDTLTTAS  65

Query  70   TRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLV  112
             RKRFDDL +AF   T+ ALRASGT+EEY+ER+QLLQ I D+V
Sbjct  66   CRKRFDDLYSAFKKATLKALRASGTEEEYQERDQLLQGISDMV  108

>H310_10257
Length=309

 Score = 118 bits (296),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 86/131 (66%), Gaps = 22/131 (17%)

Query  24   CTDVELLKEIIHVRPYEA----PHGEVHKGWTEVTEHLQRLCGDGITVNATRKRFDDLMT  79
             T V++L +   V+  EA       E+ +   E+ E   R+ GDGITVNATRKRFDDLMT
Sbjct  101  STLVDMLAKANEVKADEAQAQHKSNELAQQKLELEEKRYRIVGDGITVNATRKRFDDLMT  160

Query  80   AFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETNGEK  139
            AFH  TMAALRASGT+EEYEEREQLLQDIHDL                  NERRETNGE 
Sbjct  161  AFHEITMAALRASGTEEEYEEREQLLQDIHDL------------------NERRETNGEM  202

Query  140  IRDAAMSTMKR  150
            IRDAAMSTMKR
Sbjct  203  IRDAAMSTMKR  213

 Score = 107 bits (267),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 61/65 (94%), Gaps = 0/65 (0%)

Query  86   MAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETNGEKIRDAAM  145
            MA+LRASGTDEEYEEREQLLQDIHD+VDAA+ RKQ+ K+EKAK  ERRE+NGE+IRDAAM
Sbjct  1    MASLRASGTDEEYEEREQLLQDIHDMVDAANPRKQSSKDEKAKNLERRESNGEQIRDAAM  60

Query  146  STMKR  150
            +TMK+
Sbjct  61   TTMKK  65

>SPRG_11320
Length=274

 Score = 117 bits (293),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 92/135 (68%), Gaps = 0/135 (0%)

Query  16   KTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKRFD  75
            K  FRF   +DV+LLKE+I+V PY+AP G+    W EVTEH++ + G+ +T    RKRFD
Sbjct  10   KKTFRFSVASDVDLLKEVINVAPYDAPFGQTIARWEEVTEHMRGIHGEHVTFTGCRKRFD  69

Query  76   DLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRET  135
            DLM AF  D + A+RASGT  E  ER+ LL+DI DL+DA + +K+  KE+K K+ +  E 
Sbjct  70   DLMAAFKKDALKAMRASGTAAEVCERDLLLEDISDLMDAVADKKKAAKEDKGKKVDTSEN  129

Query  136  NGEKIRDAAMSTMKR  150
            +G +IR AA+  +KR
Sbjct  130  DGHRIRAAALQGLKR  144

>SPRG_05929
Length=265

 Score = 116 bits (291),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 93/135 (69%), Gaps = 0/135 (0%)

Query  16   KTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKRFD  75
            K  +RF   TD++LL+E+I+V P++AP+G+    W EVT +++ L G+ +TV   RKRFD
Sbjct  10   KPTYRFTVHTDIDLLEEVINVAPHDAPYGQTTARWEEVTNYMRTLHGEHLTVAGCRKRFD  69

Query  76   DLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRET  135
            DLM AF  D +  LRASGT+EE  +R  LL+++ DL++AA  RK+  K +K K+ ++RE+
Sbjct  70   DLMAAFKTDNVNGLRASGTEEEMSQRYVLLEEMSDLLEAAVDRKKASKNDKDKKPDKRES  129

Query  136  NGEKIRDAAMSTMKR  150
            +G + R AA   +KR
Sbjct  130  DGLRSRAAAQQGLKR  144

>SDRG_17406
Length=264

 Score = 116 bits (290),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 96/141 (68%), Gaps = 0/141 (0%)

Query  10   QASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNA  69
            + ++  K  +RF   TD++LL+E+I+V P++AP+G+    W +VT +++ L G+ +TV  
Sbjct  4    EPTKSKKPTYRFSVHTDIDLLEEVINVAPHDAPYGQTTARWEDVTSYMRTLHGEHLTVAG  63

Query  70   TRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQ  129
             RKRFDDLM AF  DT+  LRASGT+EE  +R  LL+++ DL++AA+ RK+  K +K K+
Sbjct  64   CRKRFDDLMAAFKTDTVKGLRASGTEEEMSQRYVLLEEMSDLLEAAADRKKASKTDKDKK  123

Query  130  NERRETNGEKIRDAAMSTMKR  150
             ++RE +  + R AA   +KR
Sbjct  124  TDKREPDAHRSRAAAQQGLKR  144

>SDRG_17390
Length=264

 Score = 116 bits (290),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 96/141 (68%), Gaps = 0/141 (0%)

Query  10   QASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNA  69
            + ++  K  +RF   TD++LL+E+I+V P++AP+G+    W +VT +++ L G+ +TV  
Sbjct  4    EPTKSKKPTYRFSVHTDIDLLEEVINVAPHDAPYGQTTARWEDVTSYMRTLHGEHLTVAG  63

Query  70   TRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQ  129
             RKRFDDLM AF  DT+  LRASGT+EE  +R  LL+++ DL++AA+ RK+  K +K K+
Sbjct  64   CRKRFDDLMAAFKTDTVKGLRASGTEEEMSQRYVLLEEMSDLLEAAADRKKASKTDKDKK  123

Query  130  NERRETNGEKIRDAAMSTMKR  150
             ++RE +  + R AA   +KR
Sbjct  124  TDKREPDAHRSRAAAQQGLKR  144

>SPRG_08573
Length=265

 Score = 115 bits (289),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 96/141 (68%), Gaps = 0/141 (0%)

Query  10   QASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNA  69
            + ++  K  +RF   TD++LL+E+I+V P++AP+G+    W EVT +++ L G+ +TV  
Sbjct  4    EPTKSKKPTYRFTVHTDIDLLEEVINVAPHDAPYGQTTARWEEVTNYMRALHGEHLTVAG  63

Query  70   TRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQ  129
             RKRFDDLM AF  D++  LRASGT+EE  +R  LL+++ DL++AA+ RK+  K +K K+
Sbjct  64   CRKRFDDLMAAFKTDSVNGLRASGTEEEMSQRFVLLEEMSDLLEAAADRKKASKIDKDKK  123

Query  130  NERRETNGEKIRDAAMSTMKR  150
             ++RE +G + R AA    KR
Sbjct  124  PDKREPDGHRSRAAAQQGNKR  144

>H310_09373
Length=109

 Score = 110 bits (274),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 71/103 (69%), Gaps = 0/103 (0%)

Query  10   QASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNA  69
            +A +R KT FRF    D++LLKE++ + P+EA  G+    W E  EH +   GD +T  +
Sbjct  6    EAIRRKKTAFRFSVVADIDLLKEVVIIAPFEAASGQTGARWEEFCEHKRVSHGDTLTTAS  65

Query  70   TRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLV  112
             RKR DDL++AF   T+ ALRASGT+EEY+ER+QLLQDI D+V
Sbjct  66   CRKRVDDLLSAFKKATLKALRASGTEEEYQERDQLLQDISDMV  108

>H310_04120
Length=138

 Score = 106 bits (264),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 89/138 (64%), Gaps = 1/138 (1%)

Query  7    SEVQASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGIT  66
            SEV   +R +T +RF    D++ LKE++ V P++AP+G+    W +  EH++ + G  +T
Sbjct  2    SEVDGGKR-RTAYRFITQVDIDFLKEVMAVCPHDAPYGQTLARWEDFVEHMREMHGPDLT  60

Query  67   VNATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEK  126
                RKR DDLM A+  +T+ +LRASGT+EEY EREQL+QD  D++D     K+T KEEK
Sbjct  61   TAGCRKRLDDLMAAYKKNTVQSLRASGTEEEYNEREQLIQDQSDMMDTTYKTKKTLKEEK  120

Query  127  AKQNERRETNGEKIRDAA  144
             K  ++RE     +R+AA
Sbjct  121  YKMIDKREKEDLMLREAA  138

>H310_14738
Length=255

 Score = 108 bits (270),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 90/142 (63%), Gaps = 0/142 (0%)

Query  9    VQASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVN  68
            ++ S + K   RF    D++LLKE+I VRP++AP+G+    W EV +H++ + G   T  
Sbjct  3    LEESSKLKPAHRFTVQEDIDLLKEVILVRPHDAPYGQTAGRWEEVGDHMRAIHGMTTTTV  62

Query  69   ATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAK  128
              RKR DDLM AF  DT+ +LRASGT+++  E+EQLLQD+  + +A + RK+   EE+  
Sbjct  63   DCRKRHDDLMVAFKQDTIKSLRASGTEKQNSEQEQLLQDLLGMTNAETDRKRALMEEEEA  122

Query  129  QNERRETNGEKIRDAAMSTMKR  150
              ++R  +   +R+A M T+KR
Sbjct  123  IGDKRVADEHAVREATMRTLKR  144

>H310_09765
Length=115

 Score = 102 bits (255),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 73/106 (69%), Gaps = 0/106 (0%)

Query  7    SEVQASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGIT  66
            SE+  + + K  +RF    DV+LLKE++ V P++A +G+    W E+ ++++ + G+ +T
Sbjct  2    SELSDTTKRKPAYRFTIAADVDLLKEVVLVAPFDAGYGQTTARWDEIGDNMRSIHGEAVT  61

Query  67   VNATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLV  112
                R+RFD+L+ AF   T+ ALR+SGT+EEY +R+QLLQDI DLV
Sbjct  62   AICCRRRFDELLAAFKKATLKALRSSGTEEEYNDRDQLLQDIVDLV  107

>SPRG_06030
Length=196

 Score = 102 bits (255),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 85/121 (70%), Gaps = 6/121 (5%)

Query  25   TDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKRFDDLMTAFHAD  84
            +DV+LLKE   V P++ PHG+  K W EV EH++ + GD +++   R+RFDDL+TAF  D
Sbjct  37   SDVDLLKEAKLVSPHDCPHGQTAKRWEEVAEHMRAIHGDLVSIVGCRRRFDDLLTAFKND  96

Query  85   TMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETNGEKIRDAA  144
            T+ ALRASGT+E+ ++R++LL DI DL+D  + +K+  KE+K       E++G ++R AA
Sbjct  97   TVNALRASGTEEDVKKRDELLHDIADLMDVRAKKKKGAKEDKV------ESDGHRMRAAA  150

Query  145  M  145
            +
Sbjct  151  L  151

>H257_16670
Length=136

 Score = 98.6 bits (244),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 81/143 (57%), Gaps = 30/143 (21%)

Query  8    EVQASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITV  67
            +VQA  + K   RF    DV+LLKE++ + P++AP+G+    W E               
Sbjct  6    DVQAEGKKKPAHRFTTPQDVDLLKEVMSICPHDAPYGQTSARWAEKA-------------  52

Query  68   NATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKA  127
                             T+A+LRASGTDEEY+EREQLLQD+ D++D  S +K+  KE+K 
Sbjct  53   -----------------TLASLRASGTDEEYDEREQLLQDLSDMIDMISNKKKATKEDKC  95

Query  128  KQNERRETNGEKIRDAAMSTMKR  150
            K+ ++RE++   +R AA++ MKR
Sbjct  96   KKMDKRESDDHTVRVAALTGMKR  118

>H310_14154
Length=178

 Score = 97.1 bits (240),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 64/84 (76%), Gaps = 0/84 (0%)

Query  62   GDGITVNATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQT  121
            GD +T  + RKRFDD + AF  D + +LRASGT+EEY EREQL+QDI DL++ +  RK++
Sbjct  6    GDTLTAVSCRKRFDDFIVAFKEDKLNSLRASGTEEEYNEREQLMQDIVDLMNTSQDRKRS  65

Query  122  DKEEKAKQNERRETNGEKIRDAAM  145
             KEEK  + E+RE+ GE++RDAAM
Sbjct  66   VKEEKTAKFEKRESGGERLRDAAM  89

>PHYCA_504729
Length=183

 Score = 90.5 bits (223),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 75/136 (55%), Gaps = 7/136 (5%)

Query  14   RHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQ----RLCGDGITVNA  69
            + K  FRF   +D+ LLKE++  RP+ A HGE    WT V   L+        DG    A
Sbjct  22   KRKKAFRFVPSSDIMLLKEVLKHRPWAASHGETLAAWTSVATGLKAALTSCTADG---KA  78

Query  70   TRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQ  129
             R+RF+ L+  F  D + +LRASG+ E+YEEREQLL D   L +  +  K    E++ ++
Sbjct  79   CRRRFNTLLEVFRRDELESLRASGSAEDYEEREQLLTDCMTLYNEHAQAKADKTEKEKRE  138

Query  130  NERRETNGEKIRDAAM  145
             ERRE+   ++   AM
Sbjct  139  AERRESASAEVVQRAM  154

>H310_14898
Length=140

 Score = 88.6 bits (218),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 65/89 (73%), Gaps = 0/89 (0%)

Query  62   GDGITVNATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQT  121
            G+ I+    RKR DDL +AF  D++A+LRAS TDE+Y ER+QLLQD+ D+++A   +++ 
Sbjct  6    GESISAKGCRKRCDDLHSAFQQDSVASLRASRTDEQYAERDQLLQDLADMIEAEQCKRRA  65

Query  122  DKEEKAKQNERRETNGEKIRDAAMSTMKR  150
            +K++K+K+ +RRE +G  I DAA   +KR
Sbjct  66   NKDDKSKKEDRREMDGHAICDAAAEGLKR  94

>PHYCA_559326
Length=182

 Score = 88.2 bits (217),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 73/136 (54%), Gaps = 7/136 (5%)

Query  14   RHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQ----RLCGDGITVNA  69
            + K  F F   +D+ L KE++  RP+ A HGE    WT     L+        DG   NA
Sbjct  22   KRKKAFNFGPSSDIMLFKEVLKRRPWAASHGETLAAWTSFATRLKAALTSCTADG---NA  78

Query  70   TRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQ  129
             R+RF+ L+  F  D + +LRASG+ E+YEEREQLL D   L +  +  K    E++ ++
Sbjct  79   CRRRFNTLLGVFCRDELESLRASGSAEDYEEREQLLTDCMTLYNEHAQAKADKTEKEKRE  138

Query  130  NERRETNGEKIRDAAM  145
            +ERRE    ++   AM
Sbjct  139  SERRELASVEVVQIAM  154

>H310_12714
Length=377

 Score = 91.3 bits (225),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 83/141 (59%), Gaps = 17/141 (12%)

Query  10   QASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNA  69
            +A +R KT FRF    D +LLKE++ + P+EA +G+      E+ EH+++          
Sbjct  6    EAIRRKKTAFRFSVSADSDLLKEVVMIAPFEAAYGQTGARGEEICEHMRK----------  55

Query  70   TRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQ  129
            T +RF   +   H+     LR SGT+EEY+ER QLLQDI D++D A ++K+T        
Sbjct  56   TIRRFAFSVQESHSK---GLRTSGTEEEYQERNQLLQDISDMMDLAQLKKKT----AISV  108

Query  130  NERRETNGEKIRDAAMSTMKR  150
             ++R+++G+ IR+A +  MKR
Sbjct  109  QDKRKSDGQLIREATLMAMKR  129

>PHYCA_112118
Length=134

 Score = 85.9 bits (211),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 66/122 (54%), Gaps = 13/122 (11%)

Query  1    MEEDTESEVQASQRH------KTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVT  54
            ++EDT    +AS R       K  FRF   +D+ LLKE +  RP+ A HGE    W+ V 
Sbjct  8    LQEDTPEPTEASNRSDAQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGEAQVSWSSVA  67

Query  55   ----EHLQRLCGDGITVNATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHD  110
                  L    GDG    A R+RF+ L+  F  D + +LRASG+ E++EEREQLL D   
Sbjct  68   IGLKTTLPSCTGDG---KACRRRFNALLDVFRRDELESLRASGSAEDFEEREQLLTDCMA  124

Query  111  LV  112
            LV
Sbjct  125  LV  126

>H310_04318
Length=179

 Score = 85.5 bits (210),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 63/89 (71%), Gaps = 4/89 (4%)

Query  62   GDGITVNATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQT  121
            G+ IT    R+RFDDL+ AF   T+ ALR+SGT+EEY +R+QLLQ I DL+DAA+ +K T
Sbjct  6    GEAITAICCRRRFDDLLAAFKQATLKALRSSGTEEEYNKRDQLLQGIVDLIDAAATKKNT  65

Query  122  DKEEKAKQNERRETNGEKIRDAAMSTMKR  150
             ++      ++RET+G  I +AA+ +MKR
Sbjct  66   LEQ----VQDKRETDGHLIHEAAIVSMKR  90

>H310_15369
Length=209

 Score = 85.9 bits (211),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 70/94 (74%), Gaps = 4/94 (4%)

Query  57   LQRLCGDGITVNATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAAS  116
            ++ + GD IT ++ RKRFDDL++AF   T+ ALRASGT+EEY ER+QLLQDI D++DAA+
Sbjct  1    MRSIHGDTITASSCRKRFDDLLSAFKKATLKALRASGTEEEYNERDQLLQDIVDMIDAAA  60

Query  117  IRKQTDKEEKAKQNERRETNGEKIRDAAMSTMKR  150
             +K+  K+      ++RE++G  IR+AA+  +KR
Sbjct  61   AKKKASKQ----VVDKRESDGHMIREAALIGLKR  90

>PHYCA_120807
Length=134

 Score = 81.6 bits (200),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 64/122 (52%), Gaps = 13/122 (11%)

Query  1    MEEDTESEVQASQRH------KTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVT  54
            ++EDT    + S R       K  FRF   +D+ LLKE +  RP+ A HGE    W+ V 
Sbjct  8    LQEDTPEPTEVSNRSDAQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETEVSWSSVA  67

Query  55   ----EHLQRLCGDGITVNATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHD  110
                  L     DG    A R+RF+ L+  F  D + +LRASG+ E++EEREQLL D   
Sbjct  68   IGLKTALPSCTADG---KACRRRFNALLDVFRRDELESLRASGSAEDFEEREQLLTDCMA  124

Query  111  LV  112
            LV
Sbjct  125  LV  126

>H310_11608
Length=221

 Score = 83.2 bits (204),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 72/132 (55%), Gaps = 35/132 (27%)

Query  14   RHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKR  73
            + K  FRFK  +D++LLKE             V + +   T+                  
Sbjct  6    KRKAAFRFKSASDIDLLKERF-----------VPQAFRRSTD------------------  36

Query  74   FDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERR  133
                  AF  +T+++LRASGT+EEY EREQ LQDI DL+D +  RK+  KEEK  + E+R
Sbjct  37   ------AFKRNTISSLRASGTEEEYSEREQFLQDIVDLIDQSHSRKRMLKEEKLAKVEKR  90

Query  134  ETNGEKIRDAAM  145
            E++GE++RDAAM
Sbjct  91   ESDGERLRDAAM  102

>PPTG_07932
Length=289

 Score = 84.3 bits (207),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 58/104 (56%), Gaps = 7/104 (7%)

Query  14   RHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVT----EHLQRLCGDGITVNA  69
            + K  FRF   +D+ LLKE +  RP+ A HGE    W+ V       L     DG    A
Sbjct  59   KRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADG---KA  115

Query  70   TRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVD  113
             R+RF+ L+  F  D + +LRASGT E++EEREQLL D   LVD
Sbjct  116  CRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVD  159

>PHYCA_49721
Length=103

 Score = 79.7 bits (195),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 57/103 (55%), Gaps = 7/103 (7%)

Query  13   QRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVT----EHLQRLCGDGITVN  68
            Q+ K  FRF   +DV LLKE++   P+ A HGE    W +V     E L     DG    
Sbjct  4    QKRKKAFRFLQSSDVVLLKEVVKHTPWSAGHGETQVAWEKVASGIKEALPACIADG---K  60

Query  69   ATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDL  111
            A R+RF  L  AF  + M +LRA GT EEY EREQLL D+ +L
Sbjct  61   ACRRRFGALYDAFRREEMESLRALGTSEEYTEREQLLTDLTEL  103

>PHYCA_131593
Length=254

 Score = 82.8 bits (203),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 76/142 (54%), Gaps = 15/142 (11%)

Query  12   SQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQ---RLC-GDGITV  67
            +++ K  FRF   +DV LLKE+I   P+ A H +    W  V   ++    LC  DG   
Sbjct  35   TKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADG---  91

Query  68   NATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKA  127
             A R+RF  LM  F  + + +LRASGT E YEEREQLL D  +L D      +T+KE+  
Sbjct  92   KACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFELAD------KTEKEK--  143

Query  128  KQNERRETNGEKIRDAAMSTMK  149
            +  ERRE     I  +AM  M+
Sbjct  144  RDAERREATSADIVRSAMQGMR  165

>PITG_00010
Length=184

 Score = 80.1 bits (196),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 64/113 (57%), Gaps = 7/113 (6%)

Query  10   QASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQ---RLC-GDGI  65
             A ++ K  FRF   +DV LLKE+I   P+ A HG+    W +V   ++    LC  DG 
Sbjct  43   SAQKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADG-  101

Query  66   TVNATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIR  118
               A R+RF  LM  F  + + +LRASGT E+YEEREQLL D  +L   + +R
Sbjct  102  --KACRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFELQTISQLR  152

>PPTG_14663
Length=146

 Score = 78.2 bits (191),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 58/109 (53%), Gaps = 2/109 (2%)

Query  16   KTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQR-LCGDGITVNATRKRF  74
            K  FRF   +DV LLKE+    P+ A HGE +  WT V   L+  +        A R+RF
Sbjct  31   KKAFRFLPSSDVLLLKEVTAHTPWAAAHGETNTAWTTVANELKNAISASTADDKACRRRF  90

Query  75   DDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDA-ASIRKQTD  122
              L+  F  + M +LR SGT EEY EREQLL D  +L  A    RKQ D
Sbjct  91   TALLDTFRREEMKSLRVSGTAEEYREREQLLTDCLELEKANKKKRKQRD  139

>H310_15181
Length=93

 Score = 75.9 bits (185),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 55/65 (85%), Gaps = 0/65 (0%)

Query  86   MAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETNGEKIRDAAM  145
            MA+LRAS TDEEY ER+QLLQ++ D++D+ +++K+  KEEK+K  ++RE++G+ +R+AAM
Sbjct  1    MASLRASETDEEYNERDQLLQELSDMIDSIALKKRAFKEEKSKNEDKRESDGQMLRNAAM  60

Query  146  STMKR  150
            ++M R
Sbjct  61   ASMIR  65

>H257_13978
Length=172

 Score = 77.8 bits (190),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 71/123 (58%), Gaps = 8/123 (7%)

Query  31   KEIIHVRPYEAPHGEVHKGWTEVTEHLQ-----RLCGDGITVNATRKRFDDLMTAFHADT  85
            K I  V+P+EAP G+V   W ++ + L+     RL  DG    A + RF++L+ A   D+
Sbjct  21   KGINSVKPWEAPSGQVMNTWADLAKDLRDNRRFRLTKDGA---ACKSRFENLIKAHCGDS  77

Query  86   MAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETNGEKIRDAAM  145
            +AA+R SGTDEE+ E +QLL+DI   V+   + K+  +   AK+    E +G  +R  AM
Sbjct  78   LAAMRRSGTDEEFGECDQLLEDISSQVEDHRVLKEVGRAVDAKKKNGIEKSGVIMRQLAM  137

Query  146  STM  148
             T+
Sbjct  138  ETL  140

>PHYCA_70656
Length=113

 Score = 76.3 bits (186),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 54/95 (57%), Gaps = 7/95 (7%)

Query  13   QRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQ----RLCGDGITVN  68
             + K  FRF   +D+ LLKE++  RP+ A HGE    WT V   L+        DG    
Sbjct  22   SKRKKAFRFVPSSDIMLLKEVLKHRPWAASHGETLAAWTSVATGLKAALTSCTADG---K  78

Query  69   ATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQ  103
            A R+RF+ L+  F  D + +LRASG+ E+YEEREQ
Sbjct  79   ACRRRFNTLLEVFRRDELESLRASGSAEDYEEREQ  113

>H257_19488
Length=56

 Score = 73.2 bits (178),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 44/66 (67%), Gaps = 11/66 (17%)

Query  4   DTESEVQASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGD  63
           D ESE     + KT FRF+GCT VELLKE+IHVRP+EAPHGEV         +LQR+ G 
Sbjct  1   DKESE--YVMKRKTAFRFQGCTVVELLKEVIHVRPFEAPHGEV---------NLQRIYGQ  49

Query  64  GITVNA  69
            ITVN 
Sbjct  50  AITVNG  55

>H310_13843
Length=118

 Score = 73.9 bits (180),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 51/62 (82%), Gaps = 0/62 (0%)

Query  84   DTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETNGEKIRDA  143
            +T+++LRASGT+EEY E EQLLQDI DL+D +  RK+  KEEK  + E+RE++GE++RDA
Sbjct  13   NTISSLRASGTEEEYSEHEQLLQDIVDLIDQSHSRKRMLKEEKLAKVEKRESDGERLRDA  72

Query  144  AM  145
            AM
Sbjct  73   AM  74

>SPRG_00310
Length=254

 Score = 75.9 bits (185),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 63/89 (71%), Gaps = 0/89 (0%)

Query  62   GDGITVNATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQT  121
            G+ +T    RKRFDDLM AF  D + A+RASGT+EE  ER+ LLQDI DL +A + +K+ 
Sbjct  6    GEHVTFTGCRKRFDDLMAAFEKDAVKAMRASGTEEEVSERDMLLQDISDLTEAVADKKKA  65

Query  122  DKEEKAKQNERRETNGEKIRDAAMSTMKR  150
             KE+K K+ ++RE +G +IR AA+  +KR
Sbjct  66   AKEDKVKKVDKRENDGHRIRAAALQGLKR  94

>H257_18379
Length=155

 Score = 73.6 bits (179),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 68/127 (54%), Gaps = 1/127 (1%)

Query  15   HKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKRF  74
            ++ + ++ G  D+ LL+E++ V+PY+  HG + + W EV   L      GI   + R  +
Sbjct  5    NQAQLKWTGDLDLALLREVLRVKPYDGEHGTLIQRWKEVAASLSLYSNQGIPHRSARDHY  64

Query  75   DDLMTAFHA-DTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERR  133
            + L+ AF A D       +G+DE+  E+ QLLQD+ D  DAA   K   K +  K+ E  
Sbjct  65   EGLVQAFKATDKSQRQWGTGSDEDVPEQVQLLQDLVDRRDAADTLKTAVKSKDKKRKESL  124

Query  134  ETNGEKI  140
            E+ G ++
Sbjct  125  ESTGSQL  131

>H310_13824
Length=169

 Score = 73.6 bits (179),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 60/89 (67%), Gaps = 4/89 (4%)

Query  62   GDGITVNATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQT  121
            G  +     R+RFDDL+ AF   T+ AL +SGT+EEY E +QLLQDI DL+DAA+     
Sbjct  2    GKQLLAICCRRRFDDLLAAFKKATLKALHSSGTEEEYNELDQLLQDIVDLIDAAA---TK  58

Query  122  DKEEKAKQNERRETNGEKIRDAAMSTMKR  150
             K  K  Q+E RET+G+ IRDAA+ ++KR
Sbjct  59   KKTLKKVQDE-RETDGQLIRDAALVSLKR  86

>H310_14414
Length=169

 Score = 72.8 bits (177),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 69/131 (53%), Gaps = 10/131 (8%)

Query  26   DVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVN------ATRKRFDDLMT  79
            D++LL +I    P EA HG+  + W+ + + L    G  +T        A + RFD LM+
Sbjct  30   DIKLLLQIAFASPCEADHGKQLQAWSAIADAL----GQSVTFGLKKKGPAMKARFDVLMS  85

Query  80   AFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETNGEK  139
             F     A+LR SGT EEY+EREQLLQDI   +D     +   K+   ++ E  E +G  
Sbjct  86   RFVRGESASLRKSGTAEEYKEREQLLQDIKTRMDDFKASETIRKDACRRKLEGSENSGTL  145

Query  140  IRDAAMSTMKR  150
            +R  A+  ++R
Sbjct  146  LRKMALGELER  156

>SPRG_18045
Length=215

 Score = 73.2 bits (178),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 63/94 (67%), Gaps = 0/94 (0%)

Query  57   LQRLCGDGITVNATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAAS  116
            ++ L G+ +TV   RKRFDDLM AF  D +  LRASGT+EE  ER  LL+++ DL++AA+
Sbjct  1    MRTLHGEHLTVAGCRKRFDDLMAAFKTDNVNGLRASGTEEEMRERYVLLEEMSDLLEAAA  60

Query  117  IRKQTDKEEKAKQNERRETNGEKIRDAAMSTMKR  150
             RK+  K +K K+ ++RE +G + R AA    KR
Sbjct  61   DRKKASKNDKDKKADKREPDGHRSRAAAQQGNKR  94

>PYAP_15403
Length=114

 Score = 70.9 bits (172),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 56/100 (56%), Gaps = 6/100 (6%)

Query  19   FRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQ------RLCGDGITVNATRK  72
            FRFK   DV LL+EI  ++P+ A HGE    W  + +         R  G  I   A ++
Sbjct  15   FRFKPSHDVLLLREIARLKPWAALHGETMSSWEAIGQAFNTQLAVVRPNGPEIDARACQR  74

Query  73   RFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLV  112
            R+  L+ +F +  +A+LR+SG+ EE  ERE+L+ ++H  V
Sbjct  75   RYKALIDSFLSGDLASLRSSGSAEEINEREELIAEVHQAV  114

>H257_02519
Length=268

 Score = 73.2 bits (178),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 71/137 (52%), Gaps = 12/137 (9%)

Query  20   RFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGIT--VNATRKRFDDL  77
            +F  C D+ LL+++   RP+E  +G V   W EV   L R+ G  +     A + RF+ L
Sbjct  17   KFARCHDIMLLQQVSLSRPWEGEYGTVMTIWAEVATELNRMPGFSMVKKPGALKTRFEYL  76

Query  78   MTAFHADTMAALRASGTDEEYEEREQLLQDIH----DLVDAASIRKQTDKEEKAKQNERR  133
            +        A+LR SGT EEY ER+QLL DI     D  +  ++RK       A + ++ 
Sbjct  77   LAKHEKGESASLRKSGTTEEYSERDQLLTDIKLRVDDFAENEAVRKN------AAKRKQL  130

Query  134  ETNGEKIRDAAMSTMKR  150
            E + +K  DA ++ +KR
Sbjct  131  EMSAKKTEDAEITPIKR  147

>H257_09254
Length=141

 Score = 69.3 bits (168),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 66/127 (52%), Gaps = 1/127 (1%)

Query  15   HKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKRF  74
            ++ + ++    D+ LL+E++ V PY+  HG + + W EV   L      GI   + R  +
Sbjct  5    NQAQLKWTDDLDLALLREVLRVEPYDCEHGTLIQRWKEVAASLSLYSNQGIPHRSARDHY  64

Query  75   DDLMTAFHA-DTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERR  133
            + L+ AF A D       +G+DE+  E+ QLLQD+ D  DAA   K   K +  K+ E  
Sbjct  65   EGLIQAFKATDKSQRQWGTGSDEDVPEKVQLLQDLVDRRDAADTLKTAVKSKDKKRKESL  124

Query  134  ETNGEKI  140
            E+ G ++
Sbjct  125  ESTGSQL  131

>H310_04124
Length=81

 Score = 66.2 bits (160),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 48/101 (48%), Gaps = 40/101 (40%)

Query  12   SQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATR  71
            S + K  FRFK  +DV+LLKE                                       
Sbjct  4    SSKRKVAFRFKSASDVDLLKE---------------------------------------  24

Query  72   KRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLV  112
             RFDDL+ AF  D + +LRASGT+EEY EREQL+QDI DL+
Sbjct  25   -RFDDLIVAFKEDKLNSLRASGTEEEYNEREQLMQDIVDLM  64

>PHYSO_383648
Length=319

 Score = 70.1 bits (170),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 59/120 (49%), Gaps = 10/120 (8%)

Query  19   FRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLC----------GDGITVN  68
            FRFK   DV L++E+I   P+ A +G     W  V   +Q             G  +   
Sbjct  14   FRFKPAFDVVLVREVIRCFPWAAGYGRTRSAWMSVATRVQSTLESMKGVAFTRGSALDHA  73

Query  69   ATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAK  128
              ++R D L+ AF  + MA LR SGT EE++ R +LL  +  +VD  ++ K   +E++ +
Sbjct  74   IVKRRVDMLLEAFRKNEMAGLRGSGTPEEFDMRNKLLAILARVVDEQTLNKGAMREKRVQ  133

>SDRG_15163
Length=292

 Score = 69.7 bits (169),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 46/136 (34%), Positives = 67/136 (49%), Gaps = 11/136 (8%)

Query  20   RFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVN---ATRKRFDD  76
            +F    D+ +L+ +  + P+ A HG V   W  + E L      G+      A + RF+ 
Sbjct  31   KFACKHDIVMLRSVGLLEPWAAAHGAVMSTWEAIAESLADASDFGLKNKKGPALKTRFES  90

Query  77   LMTAFHADTMAALRASGTDEEYEEREQLLQDIH----DLVDAASIRKQTDKEEKAKQNER  132
            +M  F      +LR SGT EEYEEREQLL DI     D    A++RK  +K    K+ E 
Sbjct  91   IMNKFKKSEFQSLRKSGTVEEYEEREQLLTDIKARMDDYTANATVRKDAEK----KKQEG  146

Query  133  RETNGEKIRDAAMSTM  148
             E +G  +R  AM+ +
Sbjct  147  IEGSGVLMRRLAMAPL  162

>PHALS_08857
Length=352

 Score = 69.7 bits (169),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 61/119 (51%), Gaps = 10/119 (8%)

Query  19   FRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATR-------  71
            FRFK   DV L++E+IH  P+ A +G     W  V   +Q    +   V  TR       
Sbjct  58   FRFKPAFDVVLVREVIHDFPWSAGYGRTRSAWMAVATRVQSTLEEMKGVTFTRGSALDHA  117

Query  72   ---KRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKA  127
               +R D L+ AF  + ++ALR SGT EE++ R +LL  +  +VD  ++ K   +E++ 
Sbjct  118  IVKRRIDMLLEAFRKNELSALRGSGTPEEFDMRNKLLGILARVVDEQTLNKGAMREKRV  176

>H310_10581
Length=241

 Score = 67.8 bits (164),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 69/127 (54%), Gaps = 2/127 (2%)

Query  26   DVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGI--TVNATRKRFDDLMTAFHA  83
            D++LL +I     +EA HG+  + W+ + + L +    G+  T  A + RFD LM+ F  
Sbjct  30   DIKLLLQITFASRWEADHGKQLQAWSAIADALGQSATFGLKKTGPAIKTRFDVLMSRFVR  89

Query  84   DTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETNGEKIRDA  143
               A+LR SGT EEYEE EQL+QDI   +D     +   K+   ++ E  E +G  +R  
Sbjct  90   GESASLRKSGTAEEYEEGEQLMQDIKTRMDDFKASETIRKDVCRRKLEGIENSGTLLRKM  149

Query  144  AMSTMKR  150
            A+  ++R
Sbjct  150  ALGELER  156

>H257_06253
Length=237

 Score = 66.2 bits (160),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 46/146 (32%), Positives = 72/146 (49%), Gaps = 10/146 (7%)

Query  9    VQASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGIT--  66
            VQ         +F    D++LLK++   +P+EA +G+V   W EV   + R+ G  I   
Sbjct  12   VQVDDAQSRPGKFDCFHDIQLLKQVNLSKPWEAGYGKVMAAWVEVCREVIRIPGFKINKK  71

Query  67   VNATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIH----DLVDAASIRKQTD  122
                + RFD L+       MA++R SGT E+Y ER+ LL DI     D  + A+ RK + 
Sbjct  72   PEGLKTRFDLLIKTHCEGEMASMRKSGTSEDYTERDLLLTDIKARMDDFDETAAARKDSV  131

Query  123  KEEKAKQNERRETNGEKIRDAAMSTM  148
            K    ++ +  E +G  +R  AM  +
Sbjct  132  K----RKIDSIENSGTLMRRMAMGNL  153

>PPTG_14264
Length=335

 Score = 67.0 bits (162),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 60/120 (50%), Gaps = 10/120 (8%)

Query  19   FRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLC----------GDGITVN  68
            FRFK   DV L++E+I   P+ A +G     W  V   +Q             G  +   
Sbjct  37   FRFKPAFDVVLVREVIRDFPWAAGYGRTRSAWMAVASRVQAALESMKGVVFTRGSALDHA  96

Query  69   ATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAK  128
              ++R D L+ AF  + ++ALR SGT EE++ R +LL  +  +VD  ++ K   +E++ +
Sbjct  97   IVKRRVDMLLEAFRKNELSALRGSGTPEEFDMRNKLLAILARVVDEQTLNKGAMREKRVQ  156

>PITG_08172
Length=320

 Score = 66.6 bits (161),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 60/120 (50%), Gaps = 10/120 (8%)

Query  19   FRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLC----------GDGITVN  68
            FRFK   DV L++E+I   P+ A +G     W  V   +Q             G  +   
Sbjct  21   FRFKPAFDVVLVREVIRDFPWAAGYGRTRSAWMAVASRVQTALESLKGVVFTRGSALDHA  80

Query  69   ATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAK  128
              ++R D L+ AF  + ++ALR SGT EE++ R +LL  +  +VD  ++ K   +E++ +
Sbjct  81   IVKRRIDMLLEAFRKNELSALRGSGTPEEFDMRNKLLAILARVVDEQTLNKGAMREKRVQ  140

>SDRG_17294
Length=68

 Score = 62.0 bits (149),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 39/60 (65%), Gaps = 0/60 (0%)

Query  10  QASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNA  69
           +A Q  K  FRF   +DV+LLKE++ V PY+  +G+V K W EV EH++ + GD +TV  
Sbjct  4   EAPQSTKKAFRFTVASDVDLLKEVMFVSPYDCQYGQVAKRWEEVAEHMRVIYGDLVTVTG  63

>H310_13569
Length=205

 Score = 63.9 bits (154),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 68/139 (49%), Gaps = 9/139 (6%)

Query  16   KTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEV------TEHLQRLCGDGITVNA  69
            K + RF    DV L +E+    P++A  G V   W EV       E   R+  DG     
Sbjct  4    KDKLRFTDAEDVLLPREVNAKLPFKAKRGTVIIVWNEVADAVNSNEEFNRVGIDG---KR  60

Query  70   TRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQ  129
               RF  LM   H+   A+ RASG +EEY+E+ QLL ++H   +    + +   +E A++
Sbjct  61   ALNRFTLLMDNNHSSNEASSRASGIEEEYDEKTQLLDELHSEFEDWKTQDKVRLDEAARE  120

Query  130  NERRETNGEKIRDAAMSTM  148
             ER E  G  IR+ A+ ++
Sbjct  121  AERIENMGLAIREQALQSL  139

>PHYKE_1588
Length=333

 Score = 64.7 bits (156),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 70/137 (51%), Gaps = 11/137 (8%)

Query  3    EDTESEVQASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCG  62
            +DTE + +   + +  FRFK   DV L++E+I   P+ A +G     W  V + +Q    
Sbjct  16   QDTEEDYEGGSKRRL-FRFKPRFDVVLVREVICSFPWAAGYGRTRSAWMNVAQRVQAELE  74

Query  63   DGITVNATR----------KRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLV  112
            D  +++ ++          +R D L+ AF  + M+ LR SGT E+++ R +LL  +  +V
Sbjct  75   DMGSLSFSKGAALDHAIVKRRVDMLLDAFRKNEMSGLRGSGTPEDFDMRNKLLAILLRVV  134

Query  113  DAASIRKQTDKEEKAKQ  129
            D  +  K   +E++  Q
Sbjct  135  DEQTTNKGAMREKRVLQ  151

>PHYCA_104165
Length=231

 Score = 63.5 bits (153),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 68/130 (52%), Gaps = 6/130 (5%)

Query  21   FKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCG--DGITVN---ATRKRFD  75
            F    D+ LL+ +  V+P+EA  G  + G  +  E +   C   DG       A R RFD
Sbjct  28   FTAADDIVLLRSVNLVKPWEAAMGTTN-GIMKAFEVVAAKCRAVDGFPKKDGPALRTRFD  86

Query  76   DLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRET  135
             L+  F     A+LR+SG+ EEY+ER++LLQDI   +D      + +K  K  + E  E+
Sbjct  87   RLVRTFREAQRASLRSSGSTEEYKERDELLQDIVCRIDNWKELTEDEKLRKRAKTEGIES  146

Query  136  NGEKIRDAAM  145
            +GE +R  AM
Sbjct  147  SGELMRRLAM  156

>PPTG_11368
Length=130

 Score = 61.6 bits (148),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 58/123 (47%), Gaps = 14/123 (11%)

Query  1    MEEDTESEVQASQ-RHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQR  59
            + E   S  +  Q RH    +F    DV LL+ +   RP+ AP G +  G  +V E +  
Sbjct  11   INESVPSSAEKKQLRHAIRKKFAAVDDVVLLRAVNAFRPWRAPVG-IFNGIMKVFEDIAF  69

Query  60   LCG---------DGITVNATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHD  110
             CG          G+   A R RF  LM  F  D   ++R SGT E+YEER++L  DI  
Sbjct  70   QCGADPDFGVDKPGV---ALRTRFGTLMKEFKRDQCRSMRKSGTVEQYEERDRLSVDITT  126

Query  111  LVD  113
             VD
Sbjct  127  QVD  129

>PHYRA_78656
Length=347

 Score = 64.3 bits (155),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 60/120 (50%), Gaps = 10/120 (8%)

Query  19   FRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQ----RLCGDGITVNA-----  69
            FRFK   DV L++E+I   P+ A +G     W  V   +Q     L G   T  +     
Sbjct  51   FRFKPAFDVVLVREVIRCFPWAAGYGRTRSAWMSVALRVQTALESLKGVAFTRGSALDHA  110

Query  70   -TRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAK  128
              ++R D L+ AF    M+ LR SG+ EE++ R +LL  +  +VD  ++ K   +E++ +
Sbjct  111  IVKRRVDMLLDAFRKSEMSGLRGSGSPEEFDLRNKLLAILARVVDEHTLNKGAMREKRVQ  170

>PHYCA_510415
Length=337

 Score = 63.9 bits (154),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 58/120 (48%), Gaps = 10/120 (8%)

Query  19   FRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLC----------GDGITVN  68
            FRFK   DV L +E+I   P+ A +G     W  V   +Q             G  +   
Sbjct  37   FRFKPAFDVVLAREVIRNFPWAAGYGRTRSAWMAVANRVQSTLESMKGVTFTKGSSLDHA  96

Query  69   ATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAK  128
              ++R D L+ A+  + M+ LR SGT EE++ R +LL  +  +VD  ++ K   +E++ +
Sbjct  97   IVKRRVDMLLEAYRKNEMSGLRGSGTPEEFDMRNKLLAILARVVDEQTLNKGALREKRVQ  156

>PYAP_24609
Length=405

 Score = 63.5 bits (153),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 57/101 (56%), Gaps = 0/101 (0%)

Query  12   SQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATR  71
            +Q  K ++ F    D+ LLKE++++RP+ A HG+  + +  VTE+L       +     +
Sbjct  119  AQTSKKKYHFTVKADLALLKEMLNIRPFLAEHGKKGEKYETVTENLNEHLETNLACRTVK  178

Query  72   KRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLV  112
            +RF+ L+  F     ++ R SG  E+Y+E EQLL DI  L+
Sbjct  179  ERFNLLVDKFEKAEASSRRKSGAAEDYDEYEQLLTDISILI  219

>SDRG_12398
Length=264

 Score = 62.8 bits (151),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 54/95 (57%), Gaps = 2/95 (2%)

Query  21   FKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVN--ATRKRFDDLM  78
            F    DV L + +   +P+ AP GE+   W E+ + L R  G G+  +  A + RF+ ++
Sbjct  41   FNAWDDVLLCRAVNARKPWTAPSGEIMLYWAEIADTLMRTRGFGVKKDGPACKTRFEKIL  100

Query  79   TAFHADTMAALRASGTDEEYEEREQLLQDIHDLVD  113
                      LR +GTD+EY+ERE+LL+++++ +D
Sbjct  101  RMTIGGEKEMLRKTGTDDEYDERERLLRNMYEQID  135

>SPRG_09172
Length=265

 Score = 62.8 bits (151),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 54/95 (57%), Gaps = 2/95 (2%)

Query  21   FKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVN--ATRKRFDDLM  78
            F    DV L + +   +P+ AP GE+   W E+ + L R  G G+  +  A + RF+ ++
Sbjct  42   FNAWDDVLLCRAVNARKPWTAPSGEIMLYWAEIADTLMRTRGFGVKKDGPACKTRFEKIL  101

Query  79   TAFHADTMAALRASGTDEEYEEREQLLQDIHDLVD  113
                      LR +GTD+EY+ERE+LL+++++ +D
Sbjct  102  RMTIGGEKEMLRKTGTDDEYDERERLLRNMYEQID  136

>SPRG_14160
Length=319

 Score = 62.8 bits (151),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 68/134 (51%), Gaps = 11/134 (8%)

Query  1    MEEDTESEVQASQRHKTEFRFKGCT-DVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQR  59
            ++  TE E  A+  + ++F    C  D+ +L+ +  + P+ A HG V   W  + E L  
Sbjct  7    IKPPTEIEEVATGSNASKF---ACKHDIAMLRTVNLLEPWAAAHGAVMSTWDAIAESLAD  63

Query  60   LCGDGITVN---ATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVD---  113
                G+      A + RF+ +M  F      +LR SGT EEYEEREQLL DI   +D   
Sbjct  64   ASDFGLKNKKGPALKTRFEIIMNRFKKSEFQSLRKSGTVEEYEEREQLLTDIKARMDDHT  123

Query  114  -AASIRKQTDKEEK  126
               ++RK  +K+++
Sbjct  124  ANGTVRKDAEKKKQ  137

>H257_09054
Length=151

 Score = 60.5 bits (145),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 53/97 (55%), Gaps = 9/97 (9%)

Query  23   GCTD-VELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQ-----RLCGDGITVNATRKRFDD  76
            GC+D + LL  +   +P+ A  G + K WT++   L+     ++  DG      + RFD 
Sbjct  35   GCSDNITLLIAVNDAKPWTASSGSLMKTWTDIASDLKANRRFKVDKDG---QGCKTRFDK  91

Query  77   LMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVD  113
            L  A+   T+ A+R SGTDEE+ E +Q L+DI   V+
Sbjct  92   LTKAYMERTLTAMRGSGTDEEFGECKQPLEDILSQVN  128

>PHYRA_78088
Length=261

 Score = 61.6 bits (148),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 56/110 (51%), Gaps = 7/110 (6%)

Query  19   FRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLC----GDGITVNATRKRF  74
            FRF   TD+ LL+E+I  +P+   HG++ K W  V    +R+      DG    A ++R+
Sbjct  37   FRFTTVTDIALLREVIDHKPWACSHGDMAKTWDVVATAFKRIVPWSTNDG---RACKRRY  93

Query  75   DDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKE  124
              L  A+    +  LR SGT +   +RE+LL     L + A  R++  KE
Sbjct  94   LALAEAYGTQKLHKLRGSGTPQMNAQREKLLAQCKALTEEAHYRRKALKE  143

>H257_18152
Length=209

 Score = 60.8 bits (146),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 62/132 (47%), Gaps = 3/132 (2%)

Query  20   RFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHL---QRLCGDGITVNATRKRFDD  76
            RF    DV +L+E+    P+ A  G V  GW  V E +   +     G      + RF  
Sbjct  8    RFSEYEDVLILREVNARLPFMAKRGLVMVGWAAVAEAVASQEEFSRPGFDAKRAQNRFTL  67

Query  77   LMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETN  136
            L+         ++RASG  E+Y E+ QLL ++  + D    R +   E+  ++ ER ET 
Sbjct  68   LLEGHRVRDDESMRASGVAEDYNEKSQLLDELSSVYDDWKKRDKLRLEDVMREAERVETM  127

Query  137  GEKIRDAAMSTM  148
            G  IR+ AM ++
Sbjct  128  GATIREEAMQSL  139

>PITG_09072
Length=261

 Score = 60.5 bits (145),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 51/99 (52%), Gaps = 7/99 (7%)

Query  19   FRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLC----GDGITVNATRKRF  74
            FRF   TD+ LL+E+I  +P+   HG++ K W  V    +R+      DG    A ++R+
Sbjct  35   FRFTTVTDIALLREVIDHKPWACSHGDMAKTWEVVATAFKRIVPWSTNDG---RACKRRY  91

Query  75   DDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVD  113
              LM A+ ++ +  LR +GT     ER +LL     + D
Sbjct  92   LALMEAYGSEKLQKLRGAGTPAMNAERAKLLMQCQIMTD  130

>H257_13889
Length=138

 Score = 58.2 bits (139),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 60/117 (51%), Gaps = 3/117 (3%)

Query  26   DVEL--LKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKRFDDLMTAFHA  83
            D+EL  L+E I V P+ A HGE+   WT V   +       +T  A R+    L+  F A
Sbjct  18   DIELAILREAIRVEPFAADHGELLARWTLVAAAVAE-QEPRVTPRAAREHVYMLLKKFKA  76

Query  84   DTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETNGEKI  140
            D  A   +SGT EE  E+ QLLQDI   +D  +  +   K ++  + +  ET GEK+
Sbjct  77   DDQAQRLSSGTAEEVTEKVQLLQDIAMRMDEVASSRTMKKTKETAKRDLLETTGEKL  133

>H257_18551
Length=221

 Score = 59.7 bits (143),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 66/128 (52%), Gaps = 4/128 (3%)

Query  26   DVEL--LKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKRFDDLMTAFHA  83
            D+EL  L+E I V P+ A HGE+   WT V   +       +T  A R+    L+  F A
Sbjct  18   DIELAILREAIRVEPFAADHGELLARWTLVAAAVAE-QEPRVTPRAAREHVHMLLKKFKA  76

Query  84   DTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETNGEKI-RD  142
            D  A   +SGT EE  E+ QLLQDI   +D  +  +   K ++  + +  ET GEK+ R+
Sbjct  77   DDQAQRLSSGTAEEVTEKVQLLQDIAMRMDEVASSRTMKKTKETAKRDLLETTGEKLCRE  136

Query  143  AAMSTMKR  150
            A +   KR
Sbjct  137  AEVRVAKR  144

>H257_09852
Length=165

 Score = 58.9 bits (141),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 62/116 (53%), Gaps = 1/116 (1%)

Query  26   DVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKRFDDLMTAFHA-D  84
            D  LL+E++ V PY+  +G +   W  +   L       I  ++ R+R+D ++  F A D
Sbjct  16   DTALLREVVRVEPYDGEYGTLILRWKAIAGSLSTYFEADIPYHSARERYDGMVDQFKAKD  75

Query  85   TMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETNGEKI  140
                L  +G+DEE  E+ QLLQD+ DL D A   K+  K++  K+ E  E+ G ++
Sbjct  76   KAQRLWRTGSDEEVTEQVQLLQDLIDLRDTAESTKKAKKDKDQKRRESLESTGSQL  131

>PPTG_03338
Length=260

 Score = 60.1 bits (144),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/110 (31%), Positives = 57/110 (52%), Gaps = 7/110 (6%)

Query  19   FRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLC----GDGITVNATRKRF  74
            FRF   TD+ LL+E+I  +P+ + HG++ K W  V    +R+      DG    A ++R+
Sbjct  34   FRFTTVTDIALLREVIDHKPWASSHGDMAKTWEVVAAAFKRIVPWSTNDG---RACKRRY  90

Query  75   DDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKE  124
              L+ A+ ++ +  LR +GT     ER +LL     + D    R++  KE
Sbjct  91   LALIEAYGSEKLQKLRGAGTPAMNAERAKLLAQCQLMTDEDHRRRKAAKE  140

>H257_14013
Length=217

 Score = 59.7 bits (143),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 65/134 (49%), Gaps = 7/134 (5%)

Query  20   RFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLC---GDGITVNATR--KRF  74
            RF    DV LL+E+    P+ A  G V   W EV   L  L     D    +A R   RF
Sbjct  8    RFTEEEDVMLLREVNARMPFRARRGAVMDAWAEVAAAL--LSHEDFDRSVFDAKRAHNRF  65

Query  75   DDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRE  134
              L+     D   ++RASG DEEY E+ QLL ++    D     K+   EE  ++ +R E
Sbjct  66   TLLLEGHRGDNRESMRASGVDEEYSEKMQLLDELLSTYDDNKAEKRGRLEEAQREADRIE  125

Query  135  TNGEKIRDAAMSTM  148
            + G+ +R+ A+ ++
Sbjct  126  SLGKTVREEALQSL  139

>CCA14346
Length=325

 Score = 60.1 bits (144),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 68/156 (44%), Gaps = 30/156 (19%)

Query  5    TESEVQASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGW--------------  50
            T S+     R K  FRFK   D+ LL  I    P+ A HG V + W              
Sbjct  10   TFSDSTNDYRKKKAFRFKPKHDIVLLNTIKQFMPWAAVHGYVREVWASAADAFSLSMREK  69

Query  51   -TEVTEHL-----------QRLCGDGIT--VN--ATRKRFDDLMTAFHADTMAALRASGT  94
             T + E+              L G G T  VN  A ++RFD L+ A     + +LRASG+
Sbjct  70   FTNLDEYFGEEGNNEISPANGLIGSGSTFHVNHIACKRRFDTLIDAHRRGDLESLRASGS  129

Query  95   DEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQN  130
            +EE  EREQLL DI  L+      ++ ++  K   N
Sbjct  130  EEECCEREQLLMDIDRLISTHDEWRKNNRTRKNSSN  165

>PITG_05825
Length=410

 Score = 60.1 bits (144),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 60/112 (54%), Gaps = 13/112 (12%)

Query  21   FKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGI--TVNATRKRFDDLM  78
            F    D+ LL  ++ ++P+  P+  V  GW +VT++L+R     +  T  A + R   L+
Sbjct  198  FVSSDDILLLTHVLAIKPWTFPY--VMDGWQQVTQNLRREESFRLDKTAGACQARLSLLL  255

Query  79   TAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQN  130
            + F AD   ALR SGTD+E++ +  LL         A + KQT++ +K K N
Sbjct  256  SHFKADNTMALRKSGTDDEFDTKCALL---------AEVTKQTEEYDKGKSN  298

>SPRG_18521
Length=291

 Score = 59.7 bits (143),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 47/92 (51%), Gaps = 3/92 (3%)

Query  20   RFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQR---LCGDGITVNATRKRFDD  76
            +F    DV +L+ ++   P+EA HG V   W  V E + +       G T  A + RF+ 
Sbjct  34   KFACSDDVAMLRHVLRWCPWEAAHGSVMATWDRVAEDVAQSPDFKLKGKTGAALKSRFET  93

Query  77   LMTAFHADTMAALRASGTDEEYEEREQLLQDI  108
            L+  F A+ M  LR  GT  E+ ERE LL DI
Sbjct  94   LLVKFCANDMQRLRKLGTPAEFAEREVLLTDI  125

>H257_07871
Length=201

 Score = 58.9 bits (141),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 65/131 (50%), Gaps = 12/131 (9%)

Query  20   RFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGIT--VNATRKRFDDL  77
            +F  C D+ LLK++   RP+E  +G+V   W E+   L R+ G  +     + + RF+ L
Sbjct  17   KFACCHDITLLKQVSLSRPWEGEYGKVMTIWAEIAAELNRMPGFSMVKKPGSLKTRFEYL  76

Query  78   MTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETNG  137
            +        A+LR SGT EE++ R      + D  +  ++RK   K    ++ E  E +G
Sbjct  77   LAKHEKGESASLRKSGTTEEHQLR------VDDFAENEAVRKDAAK----RKLECVENSG  126

Query  138  EKIRDAAMSTM  148
              +R  AM+ +
Sbjct  127  LIMRQLAMAEL  137

>SPRG_05316
Length=325

 Score = 59.7 bits (143),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 47/93 (51%), Gaps = 3/93 (3%)

Query  20   RFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQR---LCGDGITVNATRKRFDD  76
            +F    DV +L+ ++   P+EA HG V   W  V E + +       G T  A + RF+ 
Sbjct  34   KFACSDDVAMLRHVLRWCPWEAAHGSVMATWDRVAEDVAQSPDFKLKGKTGAALKSRFET  93

Query  77   LMTAFHADTMAALRASGTDEEYEEREQLLQDIH  109
            L+  F A+ M  LR  GT  E+ ERE LL DI 
Sbjct  94   LLVKFCANDMQRLRKLGTPAEFAEREVLLTDIR  126

>PHYCA_503833
Length=313

 Score = 59.7 bits (143),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 51/92 (55%), Gaps = 4/92 (4%)

Query  20   RFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGI--TVNATRKRFDDL  77
            +F    D+ LL +++  +P+  P  ++  GW EV E L+      +  T  A + R   L
Sbjct  131  QFVSADDILLLTQVLITKPWAYP--QLMDGWQEVCEQLREHNDFNLEKTAGACQARMLLL  188

Query  78   MTAFHADTMAALRASGTDEEYEEREQLLQDIH  109
            +  FHA  +AALR SGT EEYE + +LL ++H
Sbjct  189  LDHFHAGNVAALRKSGTSEEYERKRELLIEVH  220

>SDRG_06597
Length=317

 Score = 59.7 bits (143),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 47/92 (51%), Gaps = 3/92 (3%)

Query  20   RFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQR---LCGDGITVNATRKRFDD  76
            +F    DV +L+ ++   P+EA HG V   W  V E + +       G T  A + RF+ 
Sbjct  34   KFACSDDVAMLRHVLRWCPWEAAHGSVMATWERVAEDVAQSPDFKLKGKTGAALKSRFET  93

Query  77   LMTAFHADTMAALRASGTDEEYEEREQLLQDI  108
            L+  F A+ M  LR  GT  E+ ERE LL DI
Sbjct  94   LLVKFCANDMQRLRKLGTPAEFAEREVLLTDI  125

>PHYSO_362017
Length=273

 Score = 58.9 bits (141),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/110 (32%), Positives = 55/110 (50%), Gaps = 7/110 (6%)

Query  19   FRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLC----GDGITVNATRKRF  74
            FRF   TD+ LL+E+I+ +P+ + HG++ K W  V    +R       DG    A ++R+
Sbjct  50   FRFTTVTDIALLREVINHKPWASSHGDMAKTWDVVAAAFKRTVPWSTNDG---RACKRRY  106

Query  75   DDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKE  124
              L  A+    +  LR SGT     +RE LL   H + +    R++  KE
Sbjct  107  LALAEAYGTAKLQKLRGSGTPVMNAQRESLLAQCHAMTEEDLRRRRAAKE  156

>HYAP_14010
Length=303

 Score = 59.3 bits (142),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 52/109 (48%), Gaps = 10/109 (9%)

Query  19   FRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLC----------GDGITVN  68
            FRFK   DV L +E+I   P+ A +G     W  V   +Q             G  +   
Sbjct  54   FRFKPAFDVVLAREVIRCFPWAAGYGRTRSAWMNVAARVQSTLESLKGVAFTRGSALDHA  113

Query  69   ATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASI  117
              ++R D L+ AF    M++LR +GT EE++ R +LL  +  +V  +++
Sbjct  114  IVKRRVDMLLEAFRKHEMSSLRGTGTPEEFDMRNKLLAILTRVVGRSAL  162

>PHYCA_530243
Length=269

 Score = 58.9 bits (141),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 55/110 (50%), Gaps = 7/110 (6%)

Query  19   FRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLC----GDGITVNATRKRF  74
            FRF   TD  LL+E++  +P+   HG++ K W  V    +RL      DG    A ++R+
Sbjct  45   FRFTTVTDTLLLREVLDHKPWSCSHGDMAKTWDVVAVGFKRLVPWSTNDG---RACKRRY  101

Query  75   DDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKE  124
              L  A+  + +  LR SGT  +  +RE+LL     L D    R++  KE
Sbjct  102  LALAEAYGTEKLQKLRGSGTPAQNAQRERLLSQCQLLTDEDHRRRKAAKE  151

>H310_08728
Length=129

 Score = 56.2 bits (134),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 0/36 (0%)

Query  1   MEEDTESEVQASQRHKTEFRFKGCTDVELLKEIIHV  36
           ME+DTE +VQ++ R KT   FKGCTDVELLKE+IHV
Sbjct  1   MEDDTEVDVQSAYRRKTALGFKGCTDVELLKEVIHV  36

 Score = 47.4 bits (111),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)

Query  117  IRKQTDKEEKAKQNERRETNGEKIRDAAMSTMKR  150
            I+KQ  K++KAKQ ERRE+NGEKI +AAM+TMKR
Sbjct  37   IKKQAFKDDKAKQIERRESNGEKICEAAMATMKR  70

>PHYCA_14089
Length=199

 Score = 57.4 bits (137),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 72/141 (51%), Gaps = 7/141 (5%)

Query  10   QASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNA  69
            + +++ KT+ RF    D  LLKE++   P+E   G    G T     +       +    
Sbjct  5    RPTKKRKTQVRFDEDDDDALLKEVLAANPFEVERG----GKTAAWAAVASALALDVDARR  60

Query  70   TRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLV-DAASIRKQTDKEEKAK  128
             R+R   L+T F A    +  ASG DEE+ ER+ LL D+ +L  DA ++ ++  + ++AK
Sbjct  61   CRERCSLLLTDFKAKMARSEAASGIDEEHTERDDLLADVLELFEDAETVEEEKKQAKEAK  120

Query  129  QNERRETNGEKIRDAAMSTMK  149
            Q  R +   + +RD AM+ MK
Sbjct  121  Q--RDDERADAMRDEAMTGMK  139

>PPTG_02416
Length=125

 Score = 54.7 bits (130),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 56/123 (46%), Gaps = 12/123 (10%)

Query  19   FRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKRFDDLM  78
            FRF    D ELL+E+I ++P+ A  G   + W++V   L    G  + V   R R   L 
Sbjct  3    FRFSNDQDKELLRELIRLKPFAAVRGTTLRVWSDVAASLSSAFGVEVNVKQIRDRLTLLK  62

Query  79   TAFHADTMAALRASGTDEE---------YEEREQLLQDIHDLVDAASIRKQTDKEEKAKQ  129
             +F      + R SG +E          Y+ERE L+++   L D     K   K+ + K 
Sbjct  63   QSFKDSEATSARGSGIEESVDAVNVQSHYDEREGLVREYVALEDHF---KSEKKQSRPKN  119

Query  130  NER  132
            N+R
Sbjct  120  NKR  122

>H257_15150
Length=145

 Score = 55.1 bits (131),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 63/137 (46%), Gaps = 3/137 (2%)

Query  17   TEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCG---DGITVNATRKR  73
            T+ RF    D+ LL+EI    P+ A  G+V   W+ V E +Q   G    G      + R
Sbjct  5    TKSRFTEDEDILLLREINGRLPFMAKRGQVMVRWSAVAEAVQSQDGFDRPGFDGKRAQNR  64

Query  74   FDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERR  133
            F  L+           RASGTDE Y E+ QLL D+    D     ++   EE  ++ +R 
Sbjct  65   FTLLLEGHRHKDEEGKRASGTDEGYGEKFQLLDDLLSAFDDWKNEEKVRLEEVQQEADRV  124

Query  134  ETNGEKIRDAAMSTMKR  150
            +     IRD AM ++ +
Sbjct  125  DAMAATIRDEAMKSLGK  141

>PHYRA_86617
Length=241

 Score = 56.2 bits (134),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 69/128 (54%), Gaps = 13/128 (10%)

Query  26   DVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGIT------VNATRKRFDDLMT  79
            DV LL++++  RP++ P G+V + W  +   L  +   G T       NA + R + L+ 
Sbjct  28   DVALLRQVLLDRPFDKPRGKVMQRWDSLAATL--VASPGFTHSKFSGKNA-QSRMNQLVQ  84

Query  80   AFHADTM--AALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETNG  137
            A H +TM  AAL  SG  EE  ER+QLL ++  L+D A++ K+  K+E+  + ER E   
Sbjct  85   A-HRETMKKAAL-LSGVSEEITERDQLLNELVVLLDDATLVKECKKKEEQMKRERDEEAS  142

Query  138  EKIRDAAM  145
               R  AM
Sbjct  143  LVARSVAM  150

>PHYSO_548072
Length=362

 Score = 56.2 bits (134),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 52/100 (52%), Gaps = 11/100 (11%)

Query  15   HKTEFR-FKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDG-----ITVN  68
            H+++ R F    D+ LL +++  +P+  PH  V  GW EV +   RL G        T  
Sbjct  138  HRSQRRQFVSADDILLLTQVLETKPWAYPH--VMDGWQEVCD---RLRGHSEFHLDKTAG  192

Query  69   ATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDI  108
            A + R   L+    A  +AALR SGT EEYE + +LL D+
Sbjct  193  ACQARVALLLDHLKAGNIAALRKSGTSEEYERKRELLTDV  232

>PHYCA_96385
Length=135

 Score = 53.5 bits (127),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 52/98 (53%), Gaps = 6/98 (6%)

Query  21   FKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLC--GDGITVN---ATRKRFD  75
            F    D+ L + +  V+P+EA  G  + G  +  E +   C   DG       A R RFD
Sbjct  28   FTAADDIVLQRCVNLVKPWEAAMGTTN-GIMKAFEVVAAKCRAVDGFPKKDGPALRTRFD  86

Query  76   DLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVD  113
             L+  F     A+LR+SG+ EEY+ER++LLQDI   +D
Sbjct  87   RLVRTFREAQRASLRSSGSTEEYKERDELLQDIICRID  124

>H310_04215
Length=257

 Score = 54.7 bits (130),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 45/90 (50%), Gaps = 2/90 (2%)

Query  26   DVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVN--ATRKRFDDLMTAFHA  83
            D+ L   +  ++P+EAP GE+   W  + E L    G  +  +  A + RF+ ++     
Sbjct  29   DILLCLAVKEIKPWEAPSGEIMMSWAHIAEKLLHTRGFALRKDGPACKTRFEKILKMITG  88

Query  84   DTMAALRASGTDEEYEEREQLLQDIHDLVD  113
                 LR SG DEE+ ERE+L+  I   +D
Sbjct  89   GESDVLRKSGNDEEFAERERLVWSICQQID  118

>PHYCA_132727
Length=261

 Score = 54.7 bits (130),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/104 (31%), Positives = 50/104 (48%), Gaps = 9/104 (9%)

Query  19   FRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKRFDDLM  78
            FRF    D ELL+E+I ++P+ A  G   + W++V   L       + V   R R   L 
Sbjct  3    FRFSNDQDKELLRELIRLKPFAAIRGTTLRVWSDVAASLSSAFSVEVNVKQIRDRLTLLK  62

Query  79   TAFHADTMAALRASGTDEE---------YEEREQLLQDIHDLVD  113
              F    +A+ R SG +E+         Y+ERE+L+++   L D
Sbjct  63   QIFKDSEVASARGSGVEEKADAVNIQSHYDEREELVREYVALED  106

>PHYSO_470381
Length=145

 Score = 53.1 bits (126),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/145 (27%), Positives = 71/145 (49%), Gaps = 9/145 (6%)

Query  8    EVQASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITV  67
            E   ++R KT  RF    D +L++E     PY   +G+  + W +V   L+      + V
Sbjct  3    EAPPTKRRKTMVRFTDELDFQLIQEAQARNPYGEDYGKKTQAWADVAAALE------VDV  56

Query  68   NA--TRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEE  125
            +    R+R + L+ A+ A   A+ + SG  EEY  +++ L ++ ++ +  ++ K   K+ 
Sbjct  57   DGRRCRERCNQLVDAYEAKQKASEKRSGPCEEYTPKDECLAELLEMREIEALLKNDKKQP  116

Query  126  KAKQNERRETNGEKIRDAAMSTMKR  150
            K  Q +  E     +RDAA+  M R
Sbjct  117  KDHQQQEDE-QASAMRDAALQGMSR  140

>H257_13434
Length=236

 Score = 54.3 bits (129),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/131 (31%), Positives = 64/131 (49%), Gaps = 6/131 (5%)

Query  26   DVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATR--KRFDDLMTAFHA  83
            D+ LLK++    P+ A  G++ K W  + E L      G  V+  +   RF  L+     
Sbjct  15   DLTLLKQVAADTPFAAEKGQLRKAWQGLAETLMPCENFGRVVDGKKVQNRFLALVDEHRK  74

Query  84   DTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNE----RRETNGEK  139
                + R SG+D+E +E+  LL DI  L+D     +Q  + +K  Q++    + E  G  
Sbjct  75   FDATSARLSGSDQEEKEKHMLLDDIITLLDDVKAEQQKTEAQKRSQDQDDKDKVEQGGLI  134

Query  140  IRDAAMSTMKR  150
            +R+ AM TMKR
Sbjct  135  VREMAMKTMKR  145

>H257_19436
Length=199

 Score = 53.9 bits (128),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 47/87 (54%), Gaps = 2/87 (2%)

Query  29   LLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGIT--VNATRKRFDDLMTAFHADTM  86
            LLK++   +P+EA + +V   W EV   + R+ G  I       + RFD L+       +
Sbjct  1    LLKQVNLSKPWEAGYDKVMAAWVEVCREVNRIPGYKINKKPEGLKTRFDLLIKTHCEGEV  60

Query  87   AALRASGTDEEYEEREQLLQDIHDLVD  113
            A++R SGT E+Y E++ LL DI   +D
Sbjct  61   ASMRKSGTSEDYTEKDLLLTDIKARMD  87

>PYIW_25658
Length=148

 Score = 53.1 bits (126),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 61/119 (51%), Gaps = 12/119 (10%)

Query  37   RPYEAPHGEVHKGWTEVTEHL---QRLCGDGITVNATRKRFDDLMTAFHADTMAALRASG  93
            +P+E+    + K W  +   L   Q    +   + A + RF+  M  F +  +A+LR SG
Sbjct  3    KPWESSRNSIMKNWETIASTLRDNQSFIANKGGL-AIKTRFEKTMKLFVSQDLASLRKSG  61

Query  94   TDEEYEEREQLLQDIH----DLVDAASIRKQTDKEEKAKQNERRETNGEKIRDAAMSTM  148
            T E+Y+ RE LL+DI     + V+ A ++++ +KE++A      E +G   R  AM  M
Sbjct  62   TQEKYQRRELLLKDIRQRTTEFVELADVQREREKEKQAGI----EASGLVARRLAMQAM  116

>PHYRA_74884
Length=241

 Score = 54.3 bits (129),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 68/128 (53%), Gaps = 13/128 (10%)

Query  26   DVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGIT------VNATRKRFDDLMT  79
            DV LL++++  RP++ P G+V + W  +   L  +   G T       NA + R + L+ 
Sbjct  28   DVALLRQVLLDRPFDKPRGKVMQRWDSLAATL--VASPGFTHSKFSGKNA-QSRMNQLVQ  84

Query  80   AFHADTM--AALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETNG  137
              H +TM  AAL  SG  EE  ER+QLL ++  L+D A++ K+  K+E+  + ER E   
Sbjct  85   T-HRETMKKAAL-LSGVSEEITERDQLLNELVVLLDDATLVKECKKKEEQMKRERDEEAS  142

Query  138  EKIRDAAM  145
               R  AM
Sbjct  143  LVARPVAM  150

>PYVX_13719
Length=317

 Score = 54.7 bits (130),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 56/117 (48%), Gaps = 9/117 (8%)

Query  6    ESEVQASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQ-RLCGDG  64
            +SE   S   ++ FRF+   D+ LL+E+I   P+ A +G     WT V   +Q  L   G
Sbjct  16   KSEGGESAAKRSMFRFRPRYDIALLREVIKRFPWGAGYGHTRAAWTAVAADVQTELEAQG  75

Query  65   ITV--------NATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVD  113
            +             ++R D L+  F    M +LR +G+  E E+R++L   +  L+D
Sbjct  76   VAFEQGSSLDHTLAKRRADVLLETFRQGDMESLRGTGSPSEVEKRDKLAAILARLMD  132

>H257_07755
Length=181

 Score = 53.1 bits (126),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 68/130 (52%), Gaps = 13/130 (10%)

Query  26   DVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDG----ITVNATRKRFDDLMTAF  81
            +V LL+E+  ++P+ A + E+ + W        +L   G    I   + R+  D ++  F
Sbjct  21   EVALLREVTRIKPFAADNSELLQRW--------KLVASGQVPKINYRSAREHVDVMLKDF  72

Query  82   HADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETNGEKI-  140
              D  A  R+SGT+E   ER QLLQD+   +D  +  K+  + +++++ E  ET  +K+ 
Sbjct  73   KKDDDAQKRSSGTEEYVTERVQLLQDLVMRMDEVATSKKRKQNKESEKRELLETTSDKLC  132

Query  141  RDAAMSTMKR  150
            R+A +   KR
Sbjct  133  REAEILVAKR  142

>H257_18023
Length=128

 Score = 52.0 bits (123),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 53/121 (44%), Gaps = 3/121 (2%)

Query  20   RFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHL---QRLCGDGITVNATRKRFDD  76
            RF    DV LL+E+    P+    G V   W EV   L   +     G        RF  
Sbjct  8    RFTEEEDVMLLREVNARMPFRVRRGAVMDAWAEVAAALLSHEDFDRPGFDAKRAHNRFTL  67

Query  77   LMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETN  136
            L+     D   ++RASG DEEY E+ QLL ++    D     ++   EE  ++ +R E+ 
Sbjct  68   LLEGHRGDNRESMRASGVDEEYSEKMQLLDELLSAYDDNKAAERGRLEEAQREADRIESL  127

Query  137  G  137
            G
Sbjct  128  G  128

>PHYCA_118350
Length=156

 Score = 52.4 bits (124),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 52/98 (53%), Gaps = 6/98 (6%)

Query  21   FKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLC--GDGITVN---ATRKRFD  75
            F    D+ LL+ +  V+P+EA  G  + G  +  E +   C   DG       A R RFD
Sbjct  28   FTAADDIVLLRCVNLVKPWEAAMGTTN-GIMKAFEVVAAKCRAVDGFPKKDDPALRTRFD  86

Query  76   DLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVD  113
             L+  F     A+LR+SG+ +EY+E ++LLQDI   +D
Sbjct  87   RLVRTFREAQRASLRSSGSTQEYKEHDELLQDIVCRID  124

>H257_19019
Length=229

 Score = 53.1 bits (126),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/136 (28%), Positives = 70/136 (51%), Gaps = 2/136 (1%)

Query  16   KTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKRFD  75
            KT   +    +VELL+E+  + P+ A HG++ + W  V   L       I     R+  D
Sbjct  17   KTYITWTEDLEVELLREVSRIEPFAADHGDLLQRWKLVASGLS-AHEPKINYRGAREHVD  75

Query  76   DLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRET  135
             ++  F  +      +SGTDE+  E+ QLLQD+   +D  +  K+  + +++++ +  E+
Sbjct  76   AMLKQFKQEDKVQQLSSGTDEDVTEKVQLLQDLIMRMDEVASSKKRKRVKESEKKKVLES  135

Query  136  NGEKI-RDAAMSTMKR  150
             G+K+ R+A +   KR
Sbjct  136  TGDKLCREAEIRVAKR  151

>H257_14150
Length=119

 Score = 51.2 bits (121),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 55/124 (44%), Gaps = 11/124 (9%)

Query  15   HKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKRF  74
            ++ + ++    D+ LL+E++ V PY+  H             L      GI   + R  +
Sbjct  5    NQAQLKWTDDLDLALLREVVRVEPYDGEH----------AASLSLYSNQGIPRRSARDHY  54

Query  75   DDLMTAFHA-DTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERR  133
            D L+  F A D       +G+DE+  E+ QLLQD+ D  DA    K   K +  K  E  
Sbjct  55   DGLVQGFKATDKSQRQWGTGSDEDVPEKVQLLQDLVDQRDATDTLKTAVKSKDKKGKESL  114

Query  134  ETNG  137
            E+ G
Sbjct  115  ESTG  118

>PYU1_G004359
Length=237

 Score = 52.8 bits (125),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 51/103 (50%), Gaps = 10/103 (10%)

Query  13   QRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNA--T  70
            ++ K +FRF    D  LL E + V P+ APHG V   W +V +++      G+ V+A   
Sbjct  20   KQRKVQFRFSHADDARLLTETVAVNPFAAPHGRVAARWAQVADNM------GVDVDARRC  73

Query  71   RKRFDDLMTAFHADTMAALRA--SGTDEEYEEREQLLQDIHDL  111
            R+R   L++ F        RA  S  + E +  +QLL D+  L
Sbjct  74   RERVILLLSQFRERGADDSRATDSANEGEADSMQQLLADVATL  116

>PYIW_25568
Length=126

 Score = 50.8 bits (120),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 40/63 (63%), Gaps = 4/63 (6%)

Query  69   ATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIH----DLVDAASIRKQTDKE  124
            A + RF+ +M  F +  +A+LR SGT EEY+ERE LL DI     D V+ A  ++  +KE
Sbjct  44   ALKTRFEKIMKLFMSQDLASLRKSGTQEEYQERELLLGDIRQRTTDFVELADFQRAREKE  103

Query  125  EKA  127
            ++A
Sbjct  104  KQA  106

>PHYCA_62751
Length=116

 Score = 50.8 bits (120),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 47/93 (51%), Gaps = 4/93 (4%)

Query  20   RFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCG----DGITVNATRKRFD  75
            +F    DV LL+++    P++A  G V   W  +  +L+ L      D IT  + + RF+
Sbjct  8    KFTKTDDVALLRQVQAELPFKAAKGGVMASWDALANNLKTLKDFSKEDTITGKSAQARFN  67

Query  76   DLMTAFHADTMAALRASGTDEEYEEREQLLQDI  108
             L+ +       + RASG D+ Y E+ QLL D+
Sbjct  68   TLVASHRKFDKKSERASGIDQRYAEKRQLLDDL  100

>PYVX_23885
Length=326

 Score = 52.8 bits (125),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 59/117 (50%), Gaps = 5/117 (4%)

Query  38   PYEAPHGEVHKGWTEVTEHLQRLCGDGI--TVNAT--RKRFDDLMTAFHADTMAALRASG  93
            P+ A HG + K W EV + L   C   +  T+  T  + RF+ L+    A  M +   SG
Sbjct  76   PFTAKHGSLGKAWDEVAKKLNE-CSKFMMRTIKGTTAKARFETLIENHRAWEMTSKAKSG  134

Query  94   TDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETNGEKIRDAAMSTMKR  150
            T EE  E   L+ ++ +LVD  S  K++  EE       +  +GE +R AA+S +KR
Sbjct  135  TQEEESEYIVLMTELVNLVDDHSDAKKSQVEENNDDERAKTASGEVVRSAAVSRLKR  191

>H257_04778
Length=147

 Score = 51.2 bits (121),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 52/102 (51%), Gaps = 1/102 (1%)

Query  13   QRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRK  72
            Q+ + +  +    D  LL+E++ + PYE  HG+V   WT+    +       I+  A + 
Sbjct  3    QKDRNQVMWTEDMDEALLREVVRLGPYEVGHGKVTATWTKAALAMHEF-DPNISARACQT  61

Query  73   RFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDA  114
              D L+  F  D   ++RASG +E+ ++  +L QDI D  DA
Sbjct  62   GCDTLLHEFSQDNQRSVRASGVEEDDDDIVKLKQDILDRRDA  103

>H257_03208
Length=105

 Score = 50.1 bits (118),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 54/98 (55%), Gaps = 14/98 (14%)

Query  50   WTEVTEHLQ-----RLCGDGITVNATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQL  104
            W ++ + L+     RL  DG    A + RF+ L+ A   D++AA+R SGT EE+ ER+QL
Sbjct  4    WADLAKGLRDNRRFRLTKDG---PACKSRFEKLIKAHSGDSLAAMRRSGTGEEFGERDQL  60

Query  105  LQDIHDLVDAASIRKQ----TDKEEKAKQNERRETNGE  138
            L+DI   ++   + K+      + EK K N  RE  G+
Sbjct  61   LEDISSQMEDHRVLKEAGCLCGRSEKEKWN--REVGGD  96

>PPTG_00272
Length=436

 Score = 52.4 bits (124),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/97 (30%), Positives = 51/97 (53%), Gaps = 4/97 (4%)

Query  20   RFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGI--TVNATRKRFDDL  77
            +F    D+ LL +++  +P+  P  ++  GW EV + L++     +  T  A + R   L
Sbjct  219  QFVSADDILLLSQVLETKPWAYP--QLMDGWQEVCDQLRQHSDFNLDKTAGACQARVVLL  276

Query  78   MTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDA  114
            +    A  +AALR SGT +EYE + +LL ++   + A
Sbjct  277  LDHLRAGNVAALRKSGTSQEYERKRELLTEVQAKITA  313

>SDRG_15499
Length=278

 Score = 52.0 bits (123),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 57/125 (46%), Gaps = 4/125 (3%)

Query  26   DVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDG---ITVNATRKRFDDLMTAFH  82
            DV LL++I   RP+   HG +   W +V   L   C +    +     + RF  L+ A  
Sbjct  37   DVMLLRQISADRPFAQHHGRLRMAWAKVANTLMS-CEEFTREVDAKKIQNRFSALLEAHK  95

Query  83   ADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETNGEKIRD  142
            A    +   SG DE+  E+  LL D+      A  +     EEK  +N   ET G+ +RD
Sbjct  96   AFNKGSAAKSGVDEDETEKIMLLDDLTQQYAEAKAKAAELIEEKKAKNNESETAGQLVRD  155

Query  143  AAMST  147
             AM+T
Sbjct  156  RAMTT  160

>SDRG_17266
Length=278

 Score = 51.2 bits (121),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 57/125 (46%), Gaps = 4/125 (3%)

Query  26   DVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDG---ITVNATRKRFDDLMTAFH  82
            DV LL++I   RP+   HG +   W +V   L   C +    +     + RF  L+ A  
Sbjct  37   DVMLLRQISADRPFAQHHGRLRMAWAKVANTLMS-CEEFTREVDAKKIQNRFSALLEAHK  95

Query  83   ADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETNGEKIRD  142
            A    +   SG DE+  E+  LL D+      A  +     EEK  +N   ET G+ +RD
Sbjct  96   AFNKGSAAKSGVDEDETEKIMLLDDLTQQYAEAKAKAAELIEEKKAKNNESETVGQLVRD  155

Query  143  AAMST  147
             AM+T
Sbjct  156  RAMTT  160

>PPTG_15787
Length=126

 Score = 49.3 bits (116),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/123 (28%), Positives = 55/123 (45%), Gaps = 11/123 (9%)

Query  19   FRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKRFDDLM  78
            FRF    D ELL+E+IH++P+ A  G   + W+++   L    G  + V     R   L 
Sbjct  3    FRFTNDWDKELLRELIHLKPFAAVRGTTLRVWSDIAASLSSAFGVEVNVKQVCDRLTLLK  62

Query  79   TAFHADTMAALRASGTDEE---------YEEREQLLQDIHDLVDAASIRKQTDKEEKAKQ  129
                    AA   SG +E          Y+ERE L+++   L D    + +  K+ + K 
Sbjct  63   QMLKDSEAAAALGSGIEESVDAVNVQSHYDEREGLVREFVALED--HFKSEKKKQSRPKS  120

Query  130  NER  132
            ++R
Sbjct  121  SKR  123

>H257_09605
Length=235

 Score = 50.8 bits (120),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 58/127 (46%), Gaps = 26/127 (20%)

Query  23   GCTD-VELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKRFDDLMTAF  81
            GC+D + LL  +   +P+ A  G                          + RFD+L  A+
Sbjct  52   GCSDDITLLIAVNDAKPWTASQG-------------------------CKTRFDNLTKAY  86

Query  82   HADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETNGEKIR  141
               T+AA+  SG+D+E+ E EQLL+DI   V+    +K T     A + +  E +G  +R
Sbjct  87   KEHTLAAMPRSGSDKEFGECEQLLEDILSQVNDFVEKKDTQASLLASKKDGIEESGVMMR  146

Query  142  DAAMSTM  148
              AM +M
Sbjct  147  KLAMESM  153

>PHYSO_295819
Length=193

 Score = 50.4 bits (119),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/94 (30%), Positives = 47/94 (50%), Gaps = 0/94 (0%)

Query  19   FRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKRFDDLM  78
            F F    D+ L KE++ + PY A HG   + + +V ++L       +     + R + L+
Sbjct  87   FFFTQEADLALFKEMLSLEPYAAEHGFKKQRYQQVADNLSEHLKVKLLDRTVKDRLELLL  146

Query  79   TAFHADTMAALRASGTDEEYEEREQLLQDIHDLV  112
              F  D  +  + SG  E+Y E ++LLQDI D +
Sbjct  147  AEFKLDDQSYRKKSGGSEQYTEHKRLLQDISDRI  180

>H257_03945
Length=230

 Score = 50.8 bits (120),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 63/120 (53%), Gaps = 3/120 (3%)

Query  21   FKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKRFDDLMTA  80
            + G  D  LLKE++ + P+E  HG+V   W +    +       ++    + R D ++  
Sbjct  11   WTGEMDEALLKEVVRLGPFEVGHGKVTATWAKAAVAMHEY-DPNLSGRICQARCDTILHD  69

Query  81   FHADTMAALRASGTDEEYEEREQLLQDIHDLV-DAASIRKQTDKEEKAKQNERRETNGEK  139
            F  D  A++RASG  E+ ++  +L QD+ D+  D+ S R +  + E+ +Q+E  E  GEK
Sbjct  70   FARDNQASMRASGVYEDDDDMTKLKQDVLDIREDSKSKRTRKHENEQDRQDE-LELAGEK  128

>PHYCA_124712
Length=202

 Score = 50.4 bits (119),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 44/79 (56%), Gaps = 0/79 (0%)

Query  69   ATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAK  128
            A R RF +L++ F  D   ++R SGT EEY ERE LLQDI   +D  + +    KEE+  
Sbjct  25   AMRTRFTNLVSQFKTDQCQSMRKSGTVEEYAEREVLLQDIVSQMDDWTDKDAQRKEEQTA  84

Query  129  QNERRETNGEKIRDAAMST  147
            +    E +G  +R  AM T
Sbjct  85   KQRGIEESGVLLRRLAMGT  103

>H257_17235
Length=186

 Score = 50.1 bits (118),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 64/119 (54%), Gaps = 9/119 (8%)

Query  26   DVELLKEIIHVRPYEAPHGEVHKGWTEV----TEHLQRLCGDGITVNATRKRFDDLMTAF  81
            +VELL+E+  + P+ A HG++ + W  V    ++H  +L   G      R+  D ++  F
Sbjct  20   EVELLREVSRIEPFAADHGDLLQRWKLVESGLSDHEPKLNYRG-----AREHVDAMLKEF  74

Query  82   HADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETNGEKI  140
              +       SGTDE+  E+ QLLQD+   +D  +  K+  + +++++ E  E+ G+K+
Sbjct  75   KQEDKVQQLLSGTDEDVTEKVQLLQDLVMRMDEVASSKKRKRLKESEKTEVLESTGDKL  133

>PITG_05827
Length=364

 Score = 50.8 bits (120),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 47/96 (49%), Gaps = 4/96 (4%)

Query  21   FKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGI--TVNATRKRFDDLM  78
            F    D+ LL +++  +P+  P  ++  GW EV   L++     +  T  A + R   L+
Sbjct  148  FVSADDILLLSQVLETKPWAYP--QIMDGWQEVCRQLRQHSNFNLDKTAGACQARVVLLL  205

Query  79   TAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDA  114
                A    ALR SGT +EYE + +LL ++   + A
Sbjct  206  DHLRAGNSIALRKSGTSQEYERKRELLAEVQAKISA  241

>H257_05648
Length=172

 Score = 49.3 bits (116),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 60/135 (44%), Gaps = 9/135 (7%)

Query  20   RFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQR---LCGDGITVNATRKRFDD  76
            RF    D+ +L+E+    P+ A  G V   W  V + +         G        RF  
Sbjct  8    RFSDAEDILILREVNARLPFTAKRGSVMLAWNTVADAVSTKHDFARPGFDGKRALNRFTL  67

Query  77   LMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEE-KAKQNE--RR  133
            LM    A+   + RASG DE+++E+ QLL   H+L+      K  DK    A Q E  R 
Sbjct  68   LMEGHRANNDVSARASGIDEDHDEKTQLL---HELLAVYEDSKAQDKARLVAAQQEADRI  124

Query  134  ETNGEKIRDAAMSTM  148
            E  G  IR+ A+ ++
Sbjct  125  ENMGATIREEAIQSL  139

>PHYSO_516255
Length=412

 Score = 50.1 bits (118),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 48/93 (52%), Gaps = 10/93 (11%)

Query  21   FKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDG-----ITVNATRKRFD  75
            F    D+ LL  ++ V+P+  P+     GW +V E L+   GDG      T  A + R +
Sbjct  195  FVSSEDILLLTRVLAVKPWTFPYA--MDGWQQVVEKLR---GDGNFRLEKTAGACQARVN  249

Query  76   DLMTAFHADTMAALRASGTDEEYEEREQLLQDI  108
             L+    A   AALR SGT++E++ +  LL ++
Sbjct  250  LLLGHMKAGNTAALRKSGTEDEFDRKCALLSEV  282

>H257_08669
Length=212

 Score = 49.3 bits (116),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 63/134 (47%), Gaps = 9/134 (7%)

Query  26   DVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATR--KRFDDLMTAFHA  83
            D+ LL ++ + +P+ A  G+V K W    E L         V+A +   RF  L+     
Sbjct  15   DIMLLIQVANDKPFAAEKGQVAKAWQTQAETLMESEQFTRVVDARKLLNRFTILVDEHRR  74

Query  84   DTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQT-------DKEEKAKQNERRETN  136
              +A+ + SG+D+E + +  LL DI  L+D       T       DK   A   ++ E +
Sbjct  75   FAVASAKLSGSDQEEQGKHMLLDDIVCLLDDIKATATTDKSNATADKSNAAADKDKIEQD  134

Query  137  GEKIRDAAMSTMKR  150
            G  IR+ AM TMKR
Sbjct  135  GLIIRELAMQTMKR  148

>PHYSO_317488
Length=411

 Score = 49.7 bits (117),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 48/93 (52%), Gaps = 10/93 (11%)

Query  21   FKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDG-----ITVNATRKRFD  75
            F    D+ LL  ++ V+P+  P+     GW +V E L+   GDG      T  A + R +
Sbjct  201  FVSSEDILLLTRVLAVKPWTFPYA--MDGWQQVVEKLR---GDGNFRLEKTAGACQARVN  255

Query  76   DLMTAFHADTMAALRASGTDEEYEEREQLLQDI  108
             L+    A   AALR SGT++E++ +  LL ++
Sbjct  256  LLLGHMKAGNTAALRKSGTEDEFDRKCALLSEV  288

>H257_00956
Length=202

 Score = 48.9 bits (115),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/134 (25%), Positives = 61/134 (46%), Gaps = 3/134 (2%)

Query  20   RFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQR---LCGDGITVNATRKRFDD  76
            RF    D+ +L+E+    P+ A  G V   W  V + +         G        RF  
Sbjct  8    RFSDTEDILILREVNARLPFNAKRGSVMLAWNAVADAVSTNHDFAWPGFDGKRALNRFTL  67

Query  77   LMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETN  136
            LM    A+   + RASG DE+++E+ QLL ++  + + +  + +       ++ +R E  
Sbjct  68   LMEGHCANNDVSARASGIDEDHDEKTQLLDELLAVYEDSKAQDKARLVAAQEEADRIENM  127

Query  137  GEKIRDAAMSTMKR  150
            G  IR+ A+ ++ +
Sbjct  128  GATIREEALQSLGK  141

>PHYSO_536456
Length=212

 Score = 48.9 bits (115),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)

Query  69   ATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLV  112
            A R RF  LM+ F AD   ++R SGT EEYEERE LLQ+I + +
Sbjct  25   AMRTRFTTLMSQFKADQYQSMRKSGTVEEYEEREVLLQNILNQI  68

>H257_04948
Length=247

 Score = 49.3 bits (116),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 52/110 (47%), Gaps = 2/110 (2%)

Query  1    MEEDTESEVQASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRL  60
            M+    S ++ S +  ++       D+ LL E+   RP+E+        W ++ + L   
Sbjct  1    MDNTKTSSLEGSDKKPSQSFVSASDDIALLNEVSFSRPWESRRSAAGLAWEKIAKKLTTD  60

Query  61   CGDGI--TVNATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDI  108
                   +  A RKR + L+    A+  A+LR SG+ EEY+ R QLL D+
Sbjct  61   TSLSAFKSGPALRKRTEFLLKKHAANEHASLRKSGSTEEYDVRTQLLTDV  110

>PPTG_14366
Length=283

 Score = 49.3 bits (116),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/143 (28%), Positives = 66/143 (46%), Gaps = 22/143 (15%)

Query  20   RFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCG----DGITVNATRKRFD  75
            +F    DV LL+++    P++A  G V   W  +  +L+ L      D I+  + + RF+
Sbjct  125  KFTNADDVALLRQVQADMPFKAAKGGVMASWDSLANNLKTLKNFSKKDTISGKSAQARFN  184

Query  76   DLMTAFHADTMAALRASGTDEEYEEREQLLQDI------HDLVDAASIRKQTDK---EEK  126
             L+ ++      +  AS  D+ Y E+ QLL D+      H+  +A   R+  DK   EE 
Sbjct  185  TLVISYRKFDRKSEGASDIDQRYAEKRQLLDDLVSQFDEHERDEARRTRELKDKLAAEEN  244

Query  127  AKQNERRETNGEKIRDAAMSTMK  149
            A         G+ +RDA +  MK
Sbjct  245  A---------GKVMRDAGLKRMK  258

>PPTG_09063
Length=273

 Score = 49.3 bits (116),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 40/79 (51%), Gaps = 0/79 (0%)

Query  19  FRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKRFDDLM  78
           FRFK   D EL++E+I ++P+ A  G     W EV + +       + V     R + L 
Sbjct  3   FRFKLEHDQELMRELIRLKPFSAKRGTTGHVWEEVAKGVSSAIQVQLNVKQVPDRLNLLK  62

Query  79  TAFHADTMAALRASGTDEE  97
             F AD +++ RA G +E+
Sbjct  63  AKFKADELSSARAIGVEED  81

>PHYKE_4001
Length=496

 Score = 49.3 bits (116),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/97 (30%), Positives = 50/97 (52%), Gaps = 4/97 (4%)

Query  20   RFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRL--CGDGITVNATRKRFDDL  77
            +F    D+ LL E++ ++P+   H     GW +V  +L+ L  C    T  A + R   L
Sbjct  267  QFSSADDIVLLTEVLSMKPWAFAHE--MDGWQQVALNLRELTACRLEKTAGACQSRIMLL  324

Query  78   MTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDA  114
            +    A  +AALR SGT++E+  + +LL ++   + A
Sbjct  325  LEHLRAGNIAALRKSGTEDEFSRKHELLTEVQHKIAA  361

>HYAP_00630
Length=432

 Score = 49.3 bits (116),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 51/105 (49%), Gaps = 4/105 (4%)

Query  3    EDTESEVQASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCG  62
            +  ES    + R  +  +F    D+ LL ++   +P+  PH  +  GW  V   L++   
Sbjct  198  QPNESTGITTGRTASRKQFVSADDILLLTQVKVTKPWAYPH--LMDGWQAVCSELRKHSN  255

Query  63   DGI--TVNATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLL  105
              +  T  A + R   L+    A  +AALR SGT EEYE++ +LL
Sbjct  256  FNLEKTAGACQARVALLLDHLRAGNVAALRKSGTLEEYEQKRELL  300

>H257_19201
Length=102

 Score = 46.6 bits (109),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 44/83 (53%), Gaps = 1/83 (1%)

Query  27   VELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKRFDDLMTAFHA-DT  85
            + LL+E+I V PY+  +G +   W  +  +L       +   + R  F+ ++ AF + D 
Sbjct  17   LTLLREVIRVEPYDGEYGTLTSRWKPIATNLSTCFEAPVPHRSARDHFEAMLEAFKSTDK  76

Query  86   MAALRASGTDEEYEEREQLLQDI  108
               L  +G++EE  E+ QLLQD+
Sbjct  77   AQRLWGTGSEEEVTEQVQLLQDL  99

>PHYSO_389597
Length=188

 Score = 48.1 bits (113),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 46/100 (46%), Gaps = 7/100 (7%)

Query  21   FKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHL------QRLCGDG-ITVNATRKR  73
            F    D+ LL++ +  RP+    G+    W  +   L       R    G ++    + R
Sbjct  6    FSAEEDLALLRQALSNRPFLKERGKTMAAWDALAAQLVSDANFSRSASRGKLSGKTAQAR  65

Query  74   FDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVD  113
            FD L+T       AAL ASG DEE  E++ LL ++  L+D
Sbjct  66   FDKLVTQKRQQNAAALAASGVDEEETEKDVLLDELIALID  105

>PITG_05131
Length=200

 Score = 48.1 bits (113),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 47/80 (59%), Gaps = 1/80 (1%)

Query  69   ATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAK  128
            A R RF +L+  + AD   ++R SGT EEY ERE LLQ+I  L++    ++   KEE+  
Sbjct  25   AMRTRFTNLVNQYKADQCQSMRKSGTTEEYAEREVLLQNIVTLMNDWEDKEAQRKEEQTA  84

Query  129  QNERRETNGEKI-RDAAMST  147
            +    E +GE +  DAA S+
Sbjct  85   KQRGIERSGELLPTDAATSS  104

>PPTG_11144
Length=251

 Score = 48.5 bits (114),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 38/81 (47%), Gaps = 0/81 (0%)

Query  19  FRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKRFDDLM  78
           FRF    D EL+KE I  +P+ A +GE  + W  V EH+     + +     R R   L 
Sbjct  3   FRFTDDYDKELMKEAIAQKPFAAKYGEAARVWASVAEHVSSTIKERVLEKQVRDRVGLLK  62

Query  79  TAFHADTMAALRASGTDEEYE  99
             +HA  + +   SG +E  E
Sbjct  63  KNWHAGELRSSLGSGIEETLE  83

>H310_03921
Length=104

 Score = 46.6 bits (109),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 33/46 (72%), Gaps = 0/46 (0%)

Query  91   ASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETN  136
             SGT+EEY ERE LLQD  DL+D +  RK+  KEEK  + E+RE++
Sbjct  13   PSGTEEEYSEREHLLQDSVDLIDQSHSRKRMLKEEKLAKVEKRESD  58

>H257_13170
Length=198

 Score = 47.8 bits (112),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/129 (28%), Positives = 59/129 (46%), Gaps = 6/129 (5%)

Query  26   DVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATR--KRFDDLMTAFHA  83
            D+ LL+++    P+EA HG +   W  V   L      G  VN  +   RF+ L+     
Sbjct  17   DIVLLRQVSADLPFEASHGTIGSNWESVARTLTSCSTFGRNVNGKKCQNRFNILLDEQKI  76

Query  84   DTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQ--NERRETNGEKIR  141
                A++ASG  E+  E+ QLL D+  L+      +++ K   A    N  ++ N   +R
Sbjct  77   LRQEAMKASGASEDETEKTQLLDDL--LLGMQETEEKSVKASIAASAANRSKDLNSHHLR  134

Query  142  DAAMSTMKR  150
              AM T+ +
Sbjct  135  HEAMKTIGK  143

>PHYRA_75881
Length=391

 Score = 48.5 bits (114),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/90 (29%), Positives = 47/90 (52%), Gaps = 4/90 (4%)

Query  21   FKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGI--TVNATRKRFDDLM  78
            F    D+ LL  ++  +P+EAP+     GW  V E ++      +  T  A + R   L+
Sbjct  219  FVASDDILLLTHVLAAKPWEAPYA--MDGWLHVVEQMRADASFRLEKTAGACQARLHLLL  276

Query  79   TAFHADTMAALRASGTDEEYEEREQLLQDI  108
            +   A  + ALR +GT++E+E +  LL+++
Sbjct  277  SHLKAANLTALRKAGTEDEFERKCALLREV  306

>PPTG_24941
Length=380

 Score = 48.1 bits (113),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 43/70 (61%), Gaps = 1/70 (1%)

Query  80   AFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETNGEK  139
            AF  + + +LRASG  E+YEEREQLL D  +L +  + +++ DK EK +  ERRE     
Sbjct  209  AFTREELESLRASGAAEDYEEREQLLTDCFELTERHA-QQKADKTEKKRDAERREAASAD  267

Query  140  IRDAAMSTMK  149
            I  +AM  M+
Sbjct  268  IVRSAMEGMR  277

>PHYRA_86856
Length=391

 Score = 48.1 bits (113),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/90 (29%), Positives = 47/90 (52%), Gaps = 4/90 (4%)

Query  21   FKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGI--TVNATRKRFDDLM  78
            F    D+ LL  ++  +P+EAP+     GW  V E ++      +  T  A + R   L+
Sbjct  219  FVASDDILLLTHVLAAKPWEAPY--AMDGWLHVVEQMRADASFRLEKTAGACQARLHLLL  276

Query  79   TAFHADTMAALRASGTDEEYEEREQLLQDI  108
            +   A  + ALR +GT++E+E +  LL+++
Sbjct  277  SHLKAANLTALRKAGTEDEFERKCALLREV  306

>H257_01994
Length=222

 Score = 47.4 bits (111),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 43/86 (50%), Gaps = 1/86 (1%)

Query  26   DVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKRFDDLMTAFHA-D  84
            D+ LL+E++ V PY+  +G +   W  +   L       I   + R  F+ ++  F   D
Sbjct  16   DLALLREVLRVEPYDGEYGTLTVRWKTIASKLSSCFECTIPYRSARDHFEVMLEGFKVTD  75

Query  85   TMAALRASGTDEEYEEREQLLQDIHD  110
                +  +G++EE  E+ Q+LQDI D
Sbjct  76   KAQRMFGTGSEEEVTEQVQILQDIVD  101

>H257_17402
Length=149

 Score = 46.6 bits (109),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/123 (28%), Positives = 60/123 (49%), Gaps = 5/123 (4%)

Query  26   DVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATR--KRFDDLMTAFHA  83
            D+ LLK++    P+ A  G++ K W  + E L      G  V+  +   RF  L+     
Sbjct  15   DLTLLKQVTADTPFAAEKGQLRKAWQGLAETLMSCENFGRVVDGKKVQNRFQALVDEHRK  74

Query  84   DTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETNGEKIRDA  143
                + R SG+D+E +E+  LL DI  L+D     +Q  + +K  Q+   + + +K+  A
Sbjct  75   FDATSARLSGSDQEEKEKHMLLDDIITLLDDVKAEQQKTEAQKRSQD---QDDKDKVEQA  131

Query  144  AMS  146
            A++
Sbjct  132  AIT  134

>PHYRA_75884
Length=432

 Score = 47.8 bits (112),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/90 (29%), Positives = 46/90 (51%), Gaps = 4/90 (4%)

Query  21   FKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGI--TVNATRKRFDDLM  78
            F    D+ LL  ++  +P+EAP+     GW  V E ++      +  T  A + R   L+
Sbjct  219  FVASDDILLLTHVLAAKPWEAPYA--MDGWLHVVEQMRADASFRLEKTAGACQARLHLLL  276

Query  79   TAFHADTMAALRASGTDEEYEEREQLLQDI  108
                A  + ALR +GT++E+E +  LL+++
Sbjct  277  GHLKAANLTALRKAGTEDEFERKCALLREV  306

>H257_02095
Length=198

 Score = 46.6 bits (109),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 20/69 (29%), Positives = 36/69 (52%), Gaps = 0/69 (0%)

Query  15  HKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKRF  74
           ++ + ++    D+ LL+E++ V PY+  HG + + W EV   L      GI   + R  +
Sbjct  5   NQAQLKWTDDLDLALLREVLRVEPYDGEHGTLIQRWKEVAASLSLYSNQGIPHRSVRDHY  64

Query  75  DDLMTAFHA  83
           + L+ AF A
Sbjct  65  EGLVEAFKA  73

>PPTG_00270
Length=249

 Score = 47.0 bits (110),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 49/93 (53%), Gaps = 10/93 (11%)

Query  21   FKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQ-----RLCGDGITVNATRKRFD  75
            F    D+ LL +++ ++P+  P+  V  GW +VTE L+     RL     T  A + R +
Sbjct  36   FVSSDDILLLTQVLVIKPWTFPY--VMDGWQQVTEKLRAEESFRL---DKTAGACQARLN  90

Query  76   DLMTAFHADTMAALRASGTDEEYEEREQLLQDI  108
             L+    A    ALR SGT+EE++ +  ++ ++
Sbjct  91   LLLGHLKAGNTTALRKSGTEEEFDRKCAMVAEV  123

>H310_13823
Length=169

 Score = 46.2 bits (108),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 43/60 (72%), Gaps = 4/60 (7%)

Query  91   ASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETNGEKIRDAAMSTMKR  150
            A GT+EEY ER+QLLQ I DL+DAA+    T K+   +  ++RET+G  +R+AA+ ++KR
Sbjct  15   AGGTEEEYIERDQLLQGIVDLIDAAA----TKKKALKQVQDKRETDGHLVREAALVSLKR  70

>PPTG_00266
Length=437

 Score = 47.0 bits (110),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 49/93 (53%), Gaps = 10/93 (11%)

Query  21   FKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQ-----RLCGDGITVNATRKRFD  75
            F    D+ LL +++ ++P+  P+  V  GW +VTE L+     RL     T  A + R +
Sbjct  224  FVSSDDILLLTQVLVIKPWTFPY--VMDGWQQVTEKLRAEESFRL---DKTAGACQARLN  278

Query  76   DLMTAFHADTMAALRASGTDEEYEEREQLLQDI  108
             L+    A    ALR SGT+EE++ +  ++ ++
Sbjct  279  LLLGHLKAGNTTALRKSGTEEEFDRKCAMIAEV  311

>PYU1_G010696
Length=297

 Score = 46.6 bits (109),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/120 (26%), Positives = 54/120 (45%), Gaps = 0/120 (0%)

Query  17   TEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKRFDD  76
             +F F    DV +L+E + +  + AP G+ HK   E  E +       I   +  +RF  
Sbjct  35   PKFYFTPGADVVVLREALVLELFAAPRGQKHKLIDEFGERVCAALNASIIARSAYERFLL  94

Query  77   LMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETN  136
            L+  F  +     + SGT  +Y E ++LL ++ D ++A   +K       AK    R+ +
Sbjct  95   LVRTFEKNDKVHKKNSGTYSQYLETQKLLNEVCDRIEACEAQKPKKPAANAKSQGGRQAD  154

>H310_08476
Length=46

 Score = 43.1 bits (100),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 16/41 (39%), Positives = 31/41 (76%), Gaps = 0/41 (0%)

Query  26  DVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGIT  66
           DV++LK++I + PY AP+G+ ++ WTEV  +++ + G+ I+
Sbjct  5   DVDILKDVISIGPYCAPYGQSNRRWTEVAVNMRPIYGESIS  45

>PHYSO_254181
Length=154

 Score = 45.1 bits (105),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/145 (26%), Positives = 73/145 (50%), Gaps = 9/145 (6%)

Query  8    EVQASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITV  67
            E   ++R KT  RF    D +L++E     PY   +G+  + W +V   L+      + V
Sbjct  14   EAPPTKRRKTMVRFTDELDFQLIQEAQARYPYGEDYGKKTQAWADVAAALE------VDV  67

Query  68   NA--TRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEE  125
            +    R+R + L+ A+ A   A+ + SG  EEY  +++ L ++ ++ +  ++ K   K++
Sbjct  68   DGRRCRERCNQLVDAYEAKQKASEKRSGPCEEYTPKDECLAELLEMREIEALLKND-KKQ  126

Query  126  KAKQNERRETNGEKIRDAAMSTMKR  150
            +  Q ++ +     +RDAA+  M R
Sbjct  127  QKDQQQQEDEQASAMRDAALEGMSR  151

>PHYSO_453976
Length=138

 Score = 45.1 bits (105),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 73/143 (51%), Gaps = 9/143 (6%)

Query  8    EVQASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITV  67
            E   ++R +T  RF    D +L++E     PY   +G+  + W +V   L+      + V
Sbjct  3    EAPPTKRRETIVRFTDELDFQLIQEAQARNPYGEDYGKKTQAWADVAAALE------VDV  56

Query  68   NA--TRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEE  125
            +    R+R D L+ A+ A  MA+ + SG  EEY  +++ + ++ ++ +  ++ K   K++
Sbjct  57   DGRRCRERCDQLVDAYEAKQMASEKRSGPCEEYTPKDECVAELLEMREIEALLKND-KKQ  115

Query  126  KAKQNERRETNGEKIRDAAMSTM  148
            +  Q ++ +     +RDAA+  M
Sbjct  116  QKDQQQQEDEQASAMRDAALEGM  138

>SDRG_08699
Length=168

 Score = 45.4 bits (106),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 27/41 (66%), Gaps = 0/41 (0%)

Query  10  QASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGW  50
           +A Q  +  FRF   +DV+LLKE++ V PY+  +G++ K W
Sbjct  17  EAPQTTRKAFRFTVASDVDLLKEVMFVSPYDCQYGQIAKRW  57

>PHYSO_376280
Length=138

 Score = 44.7 bits (104),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 72/139 (52%), Gaps = 9/139 (6%)

Query  12   SQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNA--  69
            ++R KT  RF    D +L++E   + PY   +G+  + W +V   L+      + V+   
Sbjct  7    TKRRKTMVRFTDERDFQLIQEAQAINPYGEDYGKKTQAWADVAAALE------VDVDGRR  60

Query  70   TRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQ  129
             R+R + L+ A+ A   A+ + SG  EEY  +++ L ++ ++ +  ++ K   K+++  Q
Sbjct  61   CRERCNQLVDAYEAKQKASEKRSGPCEEYTPKDECLAELLEMREIEALLKND-KKQQKDQ  119

Query  130  NERRETNGEKIRDAAMSTM  148
             ++ +     +RDAA+  M
Sbjct  120  QQQEDEQASAMRDAALEGM  138

>PPTG_11283
Length=260

 Score = 45.8 bits (107),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 35/78 (45%), Gaps = 0/78 (0%)

Query  19  FRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKRFDDLM  78
           FRF    D+E+L+E+I  +P+ A  G   + W  V   L       I V   R R + L 
Sbjct  3   FRFTTMEDLEMLRELIRQKPFAAKRGSTLEIWDSVAAALGSALKKEIKVKQIRDRLNLLK  62

Query  79  TAFHADTMAALRASGTDE  96
           T F      +  ASG +E
Sbjct  63  TRFKEKEQLSALASGVEE  80

>PPTG_04601
Length=260

 Score = 45.8 bits (107),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 35/78 (45%), Gaps = 0/78 (0%)

Query  19  FRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKRFDDLM  78
           FRF    D+E+L+E+I  +P+ A  G   + W  V   L       I V   R R + L 
Sbjct  3   FRFTTMEDLEMLRELIRQKPFAAKRGSTLEIWDSVAAALGSALKKEIKVKQIRDRLNLLK  62

Query  79  TAFHADTMAALRASGTDE  96
           T F      +  ASG +E
Sbjct  63  TRFKEKEQLSALASGVEE  80

>H257_19278
Length=88

 Score = 43.5 bits (101),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 39/66 (59%), Gaps = 0/66 (0%)

Query  83   ADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETNGEKIRD  142
             D++AA+R SGTDEE+ ER+QLL+DI   ++   + K      +AK+    E +G  +R 
Sbjct  19   GDSLAAMRRSGTDEEFGERDQLLEDISSQMEDHRVLKDAGCAVEAKKKNGIEKSGVVMRQ  78

Query  143  AAMSTM  148
             AM  +
Sbjct  79   LAMEAL  84

>PPTG_21678
Length=104

 Score = 43.5 bits (101),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 43/96 (45%), Gaps = 13/96 (14%)

Query  1   MEEDTESEVQASQRHKTE------FRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTE--  52
           ++EDT    + S R  T+      FRF   +D+ LLKE +  RP+ A HGE     +   
Sbjct  8   LQEDTPEPTEVSSRSDTQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSLSSFA  67

Query  53  --VTEHLQRLCGDGITVNATRKRFDDLMTAFHADTM  86
             +   L     DG    A R+RF+  +  F  D +
Sbjct  68  IGLKTALPSCTADG---KACRRRFNAPLDVFRRDEL  100

>PYIW_15058
Length=131

 Score = 44.3 bits (103),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 39/59 (66%), Gaps = 4/59 (7%)

Query  73   RFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIH----DLVDAASIRKQTDKEEKA  127
            RF+ ++  F +  +A+LR SGT EEY+ERE LL++I     D  + A +++  +KE++A
Sbjct  2    RFEKIVKLFVSQDLASLRKSGTQEEYQERELLLENIRQRTTDFAELADVQRAREKEKQA  60

>PHYRA_75877
Length=406

 Score = 45.4 bits (106),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/95 (31%), Positives = 48/95 (51%), Gaps = 10/95 (11%)

Query  20   RFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQ-----RLCGDGITVNATRKRF  74
            +F    D+ LL +++  +P+   H  V  GW +V++ L+     RL     T  A + R 
Sbjct  188  QFVSADDILLLTQVLQTKPWAFQH--VMDGWQQVSDQLRAHDEFRLEK---TAGACQARV  242

Query  75   DDLMTAFHADTMAALRASGTDEEYEEREQLLQDIH  109
              L+    A   AALR +GT +EYE + +LL ++ 
Sbjct  243  VLLLDHLRAGNAAALRKAGTSDEYERKRELLVEVQ  277

>PHYCA_38983
Length=217

 Score = 45.1 bits (105),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 64/128 (50%), Gaps = 9/128 (7%)

Query  21   FKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKRFDDLMTA  80
            F    D+ LL+ +  ++P+E+     +    E+   ++   G      A R RFD L+  
Sbjct  37   FTTADDLILLRAVNTIKPWESAKDICN----EMAGFVRDKQGP-----ALRTRFDKLIRQ  87

Query  81   FHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETNGEKI  140
                 + + R+SGT EEY ER++LLQDI   +D    R+ ++K+ +  ++   E +G  +
Sbjct  88   HRDAQVVSRRSSGTTEEYNERDELLQDIVTRMDDWKERQDSEKQLQRAKDNGIEASGVLM  147

Query  141  RDAAMSTM  148
            R  AM  +
Sbjct  148  RRLAMGEL  155

>PHYCA_14293
Length=160

 Score = 44.3 bits (103),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 67/139 (48%), Gaps = 11/139 (8%)

Query  14   RHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKR  73
            + KT+ RF    +  LLK+++   P++   G    G T     +       +     R+ 
Sbjct  2    KRKTQARFDENDNDALLKDVLAANPFDVMRG----GKTAAWAAVASALALDVDARRCREC  57

Query  74   FDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERR  133
               L+T   A    +  ASG DEE+ ER+ LL D+ +L + A    QT +EEK +  E +
Sbjct  58   CSLLLTDVKAKMARSGAASGIDEEHTERDDLLADVLELFEDA----QTVEEEKKQTKEVQ  113

Query  134  ETNGEK---IRDAAMSTMK  149
            + + E+   +RD AM+ MK
Sbjct  114  QRDDERADAMRDEAMTGMK  132

>PITG_19098
Length=295

 Score = 45.1 bits (105),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 63/128 (49%), Gaps = 9/128 (7%)

Query  21   FKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKRFDDLMTA  80
            F    D+ LL+ +  ++P+E+     +    E    ++   G      A R RFD L+  
Sbjct  37   FTTADDLILLRAVNTIKPWESAEDICN----ETAGFVRDKQGP-----ALRTRFDKLIRQ  87

Query  81   FHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETNGEKI  140
                 + + R+SGT EEY ER+ LLQDI   +D    R+ ++K+ +  ++   ET+G  +
Sbjct  88   HRDAQVVSRRSSGTTEEYNERDVLLQDIVTRMDDWKERQDSEKQLQRAKDNGIETSGVLM  147

Query  141  RDAAMSTM  148
            R  AM  +
Sbjct  148  RRLAMGEL  155

>H310_03463
Length=52

 Score = 42.0 bits (97),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 25/35 (71%), Gaps = 0/35 (0%)

Query  66  TVNATRKRFDDLMTAFHADTMAALRASGTDEEYEE  100
            V+  ++RFDDL+ AF  D + +LRAS T+EEY E
Sbjct  18  NVDVLKERFDDLIVAFKEDKLNSLRASSTEEEYNE  52

>PHYCA_98971
Length=295

 Score = 45.1 bits (105),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 62/128 (48%), Gaps = 9/128 (7%)

Query  21   FKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKRFDDLMTA  80
            F    D+ LL+ +  ++P+E+          ++   +     D     A R RFD L+  
Sbjct  37   FTTADDLILLRAVNTIKPWESAK--------DICNEMAGFVRDKQGP-ALRTRFDKLIRQ  87

Query  81   FHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETNGEKI  140
                 + + R+SGT EEY ER++LLQDI   +D    R+ ++K+ +  ++   E +G  +
Sbjct  88   HRDAQVVSRRSSGTTEEYNERDELLQDIVTRMDDWKERQDSEKQLQRAKDNGIEASGVLM  147

Query  141  RDAAMSTM  148
            R  AM  +
Sbjct  148  RRLAMGEL  155

>PHYCA_4828
Length=295

 Score = 45.1 bits (105),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 62/128 (48%), Gaps = 9/128 (7%)

Query  21   FKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKRFDDLMTA  80
            F    D+ LL+ +  ++P+E+          ++   +     D     A R RFD L+  
Sbjct  37   FTTADDLILLRAVNTIKPWESAK--------DICNEMAGFVRDK-QGPALRTRFDKLIRQ  87

Query  81   FHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETNGEKI  140
                 + + R+SGT EEY ER++LLQDI   +D    R+ ++K+ +  ++   E +G  +
Sbjct  88   HRDAQVVSRRSSGTTEEYNERDELLQDIVTRMDDWKERQDSEKQLQRAKDNGIEASGVLM  147

Query  141  RDAAMSTM  148
            R  AM  +
Sbjct  148  RRLAMGEL  155

>PPTG_06351
Length=225

 Score = 44.7 bits (104),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 43/92 (47%), Gaps = 14/92 (15%)

Query  43   HGEVHKGWTEVTEH----LQRLCGDGITVNATRKRFDDLMTAFHADTMAALRASGTDEEY  98
            HG+    W +V       L     DG      R+ F  L  AF  +   +LRASGT EEY
Sbjct  17   HGKTPVAWEKVASGINAALPACTADG---KVCRRPFGALHDAFRREEKESLRASGTSEEY  73

Query  99   EEREQLLQDIHDLVDAASIRKQTDKEEKAKQN  130
             EREQLL D  +L  A       DK EK K++
Sbjct  74   TEREQLLTDRTELEKA-------DKTEKEKRD  98

>PPTG_24854
Length=291

 Score = 44.7 bits (104),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/81 (31%), Positives = 38/81 (47%), Gaps = 0/81 (0%)

Query  19  FRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKRFDDLM  78
           FRF    D EL++E I  +P+ A +GE  + W  V EH+     + +     R R   L 
Sbjct  3   FRFTEDHDKELMREAIAQKPFAAKYGEAARAWASVAEHVSSAIKERVLEKQVRDRVRLLK  62

Query  79  TAFHADTMAALRASGTDEEYE  99
             +HA  + +   SG +E  E
Sbjct  63  KNWHAGELRSSLGSGIEETLE  83

>PPTG_03791
Length=108

 Score = 43.1 bits (100),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 25/46 (54%), Gaps = 0/46 (0%)

Query  13  QRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQ  58
            + K  FRF   +D+ LLKE +  RP+ A HGE    WT V   L+
Sbjct  18  SKRKKAFRFVPSSDIMLLKEALKHRPWAAIHGETLAAWTSVATGLK  63

>PHYCA_129230
Length=141

 Score = 43.5 bits (101),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 0/80 (0%)

Query  69   ATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAK  128
            A R RFD L+       + + R+SGT EEY ER++LLQDI   +D    R+ ++K+ +  
Sbjct  29   ALRTRFDKLIRQHRDAQVVSRRSSGTTEEYNERDELLQDIVTRMDDWKERQDSEKQLQRA  88

Query  129  QNERRETNGEKIRDAAMSTM  148
            ++   E +G  +R  AM  +
Sbjct  89   KDNGIEASGVLMRRLAMGEL  108

>PHYSO_373613
Length=130

 Score = 43.1 bits (100),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 49/100 (49%), Gaps = 8/100 (8%)

Query  14   RHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNA--TR  71
            R KT  RF    D +L++E     PY   +G+  + W +V   L       + V+    R
Sbjct  1    RRKTMVRFTDELDFQLIQEAQARNPYGEDYGKKTQAWADVAAALV------VDVDGRRCR  54

Query  72   KRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDL  111
            +R + L+ A+ A  MA+ + SG  EEY  +++ L  + ++
Sbjct  55   ERCNQLVDAYEAKQMASEKPSGPCEEYAPKKECLAKLLEM  94

>PHYSO_340307
Length=479

 Score = 44.7 bits (104),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/127 (27%), Positives = 56/127 (44%), Gaps = 19/127 (15%)

Query  19   FRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKRFDDLM  78
            F F    ++ L KE++ V PY   HG   + +                      R + L+
Sbjct  225  FFFTQEAELALFKEMLSVEPYATEHGFKKQRYQA-------------------NRLELLL  265

Query  79   TAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETNGE  138
            + F  D  + L+ SG  E+Y E ++LLQDI D +      K+   ++K  +    +T GE
Sbjct  266  SEFMLDDQSYLKKSGVSEQYTEHKRLLQDISDRIRDVEEEKKKKNKKKKDKAAALQTQGE  325

Query  139  KIRDAAM  145
             +RD A+
Sbjct  326  ILRDQAV  332

>PHYSO_380505
Length=138

 Score = 43.1 bits (100),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 37/143 (26%), Positives = 73/143 (51%), Gaps = 9/143 (6%)

Query  8    EVQASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITV  67
            E   ++  KT  RF    D +L++E     PY   +G+  + W +V   L+      + V
Sbjct  3    EAPPTKPRKTMVRFTDELDFQLIQEAQARNPYGEDYGKKTQTWADVAAALE------VDV  56

Query  68   NA--TRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEE  125
            +    R+R++ L+ A+ A   A+ + SG  EEY  +++ L ++ ++ +  ++ K   K++
Sbjct  57   DGRRYRERYNQLVDAYEAKQKASEKRSGPCEEYTPKDECLAELLEMREIEALLKNDKKQQ  116

Query  126  KAKQNERRETNGEKIRDAAMSTM  148
            K +Q ++ E     +RDAA+  M
Sbjct  117  KDQQQQKDE-QASAMRDAALEGM  138

>PHYKE_6162
Length=201

 Score = 43.9 bits (102),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 18/57 (32%), Positives = 30/57 (53%), Gaps = 0/57 (0%)

Query  5   TESEVQASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLC  61
           T   V+  ++ +  FRF+  +D+ LL++++   P+  PHGE    W  V E  Q L 
Sbjct  17  TPWNVRIHEKRRKAFRFQTASDIVLLRQVMARTPWSCPHGETGPAWDAVAEREQLLA  73

>H310_14954
Length=149

 Score = 43.5 bits (101),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 35/126 (28%), Positives = 53/126 (42%), Gaps = 3/126 (2%)

Query  26   DVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQ---RLCGDGITVNATRKRFDDLMTAFH  82
            D+ LL+++    P++  HG+V + W  V   LQ       D I       RF  L+    
Sbjct  15   DIMLLRQVSLEMPFQTRHGQVMERWAAVASALQGSGEFTRDDIDAKRACNRFMLLLDGHR  74

Query  83   ADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETNGEKIRD  142
                 + RASG  EE  E+  LL D+    D   + +    +E  +  +  E  G  IR 
Sbjct  75   RINKESQRASGVSEEVGEKTILLDDLMVAYDDTKVVEAQLADETREAADHAEAMGSFIRA  134

Query  143  AAMSTM  148
             AM +M
Sbjct  135  EAMKSM  140

>H257_08032
Length=251

 Score = 43.9 bits (102),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/90 (27%), Positives = 45/90 (50%), Gaps = 2/90 (2%)

Query  26   DVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVN--ATRKRFDDLMTAFHA  83
            D+ L + +  V+P+ A  GE+   W  + + L    G  +  +  A + RF+ ++     
Sbjct  35   DILLCEAVNEVKPWAARSGEIMMYWANIADKLMHTRGFALRKDGPACKTRFEKIVKMITG  94

Query  84   DTMAALRASGTDEEYEEREQLLQDIHDLVD  113
                 LR SG+++E+ ERE+L+  I   +D
Sbjct  95   GEQDVLRKSGSEDEFAERERLVMGICMQID  124

>H257_06895
Length=202

 Score = 43.5 bits (101),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/61 (33%), Positives = 33/61 (54%), Gaps = 2/61 (3%)

Query  20  RFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGIT--VNATRKRFDDL  77
           +F  C D+ LL+++   RP+E  +G+V   W EV   L R+ G  +     A + RF+ L
Sbjct  17  KFACCHDIMLLQQVSLSRPWEGEYGKVMTIWAEVATELNRMPGFSMVKKPGALKTRFEYL  76

Query  78  M  78
           +
Sbjct  77  L  77

>H257_15302
Length=344

 Score = 43.9 bits (102),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 44/87 (51%), Gaps = 0/87 (0%)

Query  64   GITVNATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDK  123
            G     T+ RF  L+         ++RASG  E+Y E+ QLL ++  + D    R +   
Sbjct  190  GFDAKRTQSRFTLLLEGHRVRDDESMRASGVAEDYSEKSQLLDELSSVYDDWKKRDKLRL  249

Query  124  EEKAKQNERRETNGEKIRDAAMSTMKR  150
            E+  ++ ER ET G  IR+ AM ++ +
Sbjct  250  EDVMREAERVETMGATIREEAMQSLGK  276

>PITG_12686
Length=223

 Score = 43.1 bits (100),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 62/128 (48%), Gaps = 9/128 (7%)

Query  21   FKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKRFDDLMTA  80
            F    D+ LL+ +  ++P+E+     +    E    ++   G      A R RFD L+  
Sbjct  37   FTTADDLILLRAVNTIKPWESAKDICN----ETAGFVRDKQGP-----ALRTRFDKLIRQ  87

Query  81   FHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETNGEKI  140
                 + + R+SGT EEY ER+ LLQDI   +D    R+ ++K+ +  ++   E +G  +
Sbjct  88   HRDAQVVSRRSSGTTEEYNERDVLLQDIVTRMDDWKERQDSEKQLQRAKDNGIEASGVLM  147

Query  141  RDAAMSTM  148
            R  AM  +
Sbjct  148  RRLAMGEL  155

>PHYSO_325763
Length=157

 Score = 42.4 bits (98),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/116 (27%), Positives = 57/116 (49%), Gaps = 10/116 (9%)

Query  8    EVQASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITV  67
            E   ++R KT  RF    D +L++E     PY   +G+  + W +V   L+      + V
Sbjct  14   EAPPTKRRKTMVRFTDELDFQLIQEAQARNPYGKDYGKKTQAWADVAAALE------VDV  67

Query  68   NA--TRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQT  121
            +    R+R + L+ A+ A   A+ + SG  EEY  +++ L +      AA +++Q+
Sbjct  68   DGRRCRERCNQLVDAYEAKQKASEKRSGPCEEYTPKDECLAEFQH--SAAGMQQQS  121

>PHYSO_336240
Length=159

 Score = 42.4 bits (98),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 61/125 (49%), Gaps = 14/125 (11%)

Query  26   DVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKRFDDLMTAFHADT  85
            DV LLK+ +   PY+  HG+V + W ++ + L   C D    +   K+ D          
Sbjct  15   DVMLLKQTLADEPYQQEHGKVMEHWEKLAQTLV-ACAD---FSPAAKKKDG---------  61

Query  86   MAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETNGEKIRDAAM  145
              A R SG  E + E+++LL ++   ++     K+  ++ KA ++   E+ GE IR  A+
Sbjct  62   -TAKRLSGVTETHSEKDELLDELILRLEECKAEKEAKRKMKADKDAPSESAGEAIRRLAV  120

Query  146  STMKR  150
              +KR
Sbjct  121  ERLKR  125

>PPTG_05843
Length=169

 Score = 42.0 bits (97),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 0/66 (0%)

Query  32  EIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKRFDDLMTAFHADTMAALRA  91
           E+I ++P+ A  G     W EV + +       + V   R R + L   F AD +++ RA
Sbjct  3   ELIRLKPFSAKRGTTGHVWEEVAKGVSSAIQVQLNVKQVRDRLNLLKAKFKADELSSARA  62

Query  92  SGTDEE  97
           SG +E+
Sbjct  63  SGVEED  68

>CCI47495
Length=285

 Score = 42.7 bits (99),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 51/123 (41%), Gaps = 30/123 (24%)

Query  38   PYEAPHGEVHKGWTEVTE--------------------------HLQRLCGDGIT--VN-  68
            P+ A HG V + W    +                           +  L G G    VN 
Sbjct  2    PWAAVHGYVREVWASAADAFSLSMREKFTKLDQCFGEDGNKDFASISALSGIGAVFHVNH  61

Query  69   -ATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKA  127
             A ++RFD L+ A     + +LRASG++EE  EREQLL DI  L+      ++ ++  K 
Sbjct  62   IACKRRFDTLLDAHRRRDLDSLRASGSEEECCEREQLLLDIDRLISTHDEWRKNNRTRKT  121

Query  128  KQN  130
              N
Sbjct  122  SSN  124

>H310_03462
Length=243

 Score = 42.4 bits (98),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 68/137 (50%), Gaps = 14/137 (10%)

Query  26   DVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGIT-VNATRK---RFDDLMTAF  81
            DV LL ++   +P+ A  G++ K W  + E L  +  D  T V  +RK   RF  L+   
Sbjct  15   DVALLIQVAADQPFAATKGQLTKSWQLLAETL--MQSDNFTRVVDSRKVQNRFSLLVDEH  72

Query  82   HADTMAALRASGTDEEYEEREQLLQDIHDLVD------AASIRKQTDKEEKAKQNERRET  135
                  + + SG DEE+ E+  LL D+  L++       A  +  TD +  +  +++ + 
Sbjct  73   IKFNSESAKLSGVDEEHREKHILLDDMVTLLEDLKRGPGAKSKPSTDAKPASTASDKDKA  132

Query  136  N-GEK-IRDAAMSTMKR  150
            + GE  IR+ AM TMKR
Sbjct  133  DQGELIIREMAMQTMKR  149

>H257_18543
Length=323

 Score = 42.4 bits (98),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 42/73 (58%), Gaps = 0/73 (0%)

Query  73   RFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNER  132
            RFD L  A+   ++ ++R SGTDEE++E EQLL+DI   V+    +K       A + + 
Sbjct  75   RFDKLAKAYKERSLVSIRRSGTDEEFKECEQLLEDILSQVNDFVEKKDALASFLAAKKDG  134

Query  133  RETNGEKIRDAAM  145
             +++G  +R  A+
Sbjct  135  IKSSGVMMRKLAI  147

>PPTG_19779
Length=319

 Score = 42.4 bits (98),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/118 (25%), Positives = 54/118 (46%), Gaps = 0/118 (0%)

Query  20   RFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKRFDDLMT  79
            RF+ C   +L+  +   + + APHG+  + W  V + L  +     ++ A R +   L+ 
Sbjct  19   RFQLCDLTKLMLIVTRRKSFAAPHGKGDEEWQAVADELNAVDTTSFSLRACRDKVAALIK  78

Query  80   AFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETNG  137
                ++ A+ RASG  EE+     L++    L      +KQ   +E  ++ +R  T G
Sbjct  79   KHKQESAASRRASGVAEEHTMLSDLIEAYWQLKYQFEEKKQAASDEAKRKQKRLATAG  136

>PYIW_25874
Length=201

 Score = 42.0 bits (97),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 61/125 (49%), Gaps = 12/125 (10%)

Query  26   DVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKRFDDLMTAFHADT  85
            ++ LL++I+ VRP++  HG+V    +       +L G        + RF  L+ +  ++ 
Sbjct  22   NLALLRQILSVRPFQNGHGKVMAARS-------KLSGKN-----AQSRFSQLIHSRRSEN  69

Query  86   MAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETNGEKIRDAAM  145
            M  +  SG  E   E +++L ++ +L+D +   +Q  K+   +Q ++ E      R  AM
Sbjct  70   MEVMTLSGVSETVSESDEILDELIELLDDSKEVEQKQKDHGLRQTDQDEQAFMVARRLAM  129

Query  146  STMKR  150
              ++R
Sbjct  130  ERLRR  134

>H257_07182
Length=209

 Score = 42.0 bits (97),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/111 (31%), Positives = 49/111 (44%), Gaps = 3/111 (3%)

Query  41   APHGEVHKGWTEVTEHLQRLCG---DGITVNATRKRFDDLMTAFHADTMAALRASGTDEE  97
            A  G+V   W+ V E +Q   G    G      + RF  L+           RASGTDE 
Sbjct  2    AKRGQVMVRWSAVAEAVQSQDGFDRPGFDGKRAQNRFTLLLEGHRHKDEEGKRASGTDEG  61

Query  98   YEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETNGEKIRDAAMSTM  148
            Y E+ QLL D+    D     ++   EE  ++ +R +     IRD AM ++
Sbjct  62   YGEKFQLLDDLLSAFDDWKNEEKVRLEEVQQEPDRVDAMAATIRDEAMKSL  112

>H257_11101
Length=260

 Score = 42.4 bits (98),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/134 (28%), Positives = 64/134 (48%), Gaps = 9/134 (7%)

Query  26   DVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATR--KRFDDLMTAFHA  83
            D+ LL ++ + +P+ A  G+V K W  + + L         V+A +   RF  L+     
Sbjct  15   DIMLLIQVANDKPFTAEKGQVIKVWQTLAKTLMESEQFTRVVDARKLLNRFTILVDEHRR  74

Query  84   DTMAALRASGTDEEYEEREQLLQD----IHDLVDAASIRKQ---TDKEEKAKQNERRETN  136
              +A+ +  G+D+E +++  L  D    + D+   A+  K     DK   A   ++ E +
Sbjct  75   FDVASAKLFGSDQEEQDKHMLFDDEVCLLDDIKTTATTDKSKAIADKSNAAADKDKIEQD  134

Query  137  GEKIRDAAMSTMKR  150
            G  IR+ AM TMKR
Sbjct  135  GLLIRELAMQTMKR  148

>H310_15161
Length=236

 Score = 42.0 bits (97),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 62/128 (48%), Gaps = 5/128 (4%)

Query  26   DVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATR--KRFDDLMTAFHA  83
            D+ LL ++   RP+ A  G++ K W  + E L      G  V+  +   RF  L      
Sbjct  19   DIALLIQVAADRPFAAEKGQLKKAWQGLAETLVACEHFGRVVDGKKVQNRFLFLAEEHRK  78

Query  84   DTMAALRASGTDEEYEEREQLLQDIHDLV-DAASIRKQTDKEEKAKQNERRETNGEKIRD  142
                + + SG  EE +E+  LL DI +++ D  S  +Q  + +   ++++ E  G  +R+
Sbjct  79   FDAQSAKLSGVAEEEKEKHVLLDDILNVLQDMKS--EQRCRPQGQDESDKVEKGGLYVRE  136

Query  143  AAMSTMKR  150
             AM TMKR
Sbjct  137  MAMKTMKR  144

>H257_16845
Length=209

 Score = 41.6 bits (96),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/111 (31%), Positives = 49/111 (44%), Gaps = 3/111 (3%)

Query  41   APHGEVHKGWTEVTEHLQRLCG---DGITVNATRKRFDDLMTAFHADTMAALRASGTDEE  97
            A  G+V   W+ V E +Q   G    G      + RF  L+           RASGTDE 
Sbjct  2    AKRGQVMVRWSAVAEAVQSQDGFDRPGFDGKRAQNRFTLLLEGHRHKDEEGKRASGTDEG  61

Query  98   YEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETNGEKIRDAAMSTM  148
            Y E+ QLL D+    D     ++   EE  ++ +R +     IRD AM ++
Sbjct  62   YGEKFQLLDDLLSAFDDWKNEEKVRLEEVQQEADRVDAMAATIRDEAMKSL  112

>H257_18804
Length=219

 Score = 41.6 bits (96),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 52/115 (45%), Gaps = 14/115 (12%)

Query  37   RPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKRFDDLMTAFHADTMAALRASGTDE  96
            +P  A  G++ K W  + + L  L  D  T     +RFD           A+ + SG DE
Sbjct  26   KPLAAETGQLTKAWHALADTL--LACDHFTRVVDHRRFDK----------ASAKLSGDDE  73

Query  97   EYEEREQLLQDIHDLVD-AASIRKQTDKEEKAKQNERRETNGEKIRDAAMSTMKR  150
            E  E+  LL DI  L+D    I  Q  +    K+ E+ E     +RD AM TMKR
Sbjct  74   EETEKHILLDDIVALLDDVKEIASQKTRNSVVKK-EQAEQGALIVRDMAMRTMKR  127

>PYIW_15637
Length=272

 Score = 41.6 bits (96),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/128 (26%), Positives = 55/128 (43%), Gaps = 3/128 (2%)

Query  26   DVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRK---RFDDLMTAFH  82
            D+ LL ++    P+ +  G     W EV      L    +     +K   RF  LM    
Sbjct  37   DIMLLCQVSADMPFSSRRGSAIDSWEEVVAKFSTLDAFALPQFDGKKAQNRFFALMEEHR  96

Query  83   ADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETNGEKIRD  142
                A+   SG    Y E+ ++L D+  + D     K ++ E++ K+ +  ET G K R+
Sbjct  97   KYNTASATKSGVSGFYNEKHEVLDDLLAIYDEFEQTKASNAEKERKKRDDDETKGAKARE  156

Query  143  AAMSTMKR  150
            AAM  + +
Sbjct  157  AAMVPLSK  164

>SDRG_04653
Length=243

 Score = 41.2 bits (95),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/63 (32%), Positives = 31/63 (49%), Gaps = 0/63 (0%)

Query  16  KTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKRFD  75
           K  F+F    D+ELL+ ++   PY A HG V + W ++   L    G   +  A + R+ 
Sbjct  13  KKRFKFNYEEDMELLRLVLKHEPYNAVHGSVAEKWEQIRTTLCAYVGKQFSARACKDRYG  72

Query  76  DLM  78
            LM
Sbjct  73  ILM  75

>H257_14889
Length=157

 Score = 40.8 bits (94),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 50/102 (49%), Gaps = 2/102 (2%)

Query  26   DVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKRFDDLMTAFHADT  85
            D  LLKE++ + P+E  H +V   W +    +       ++    + R D ++  F  D 
Sbjct  16   DEALLKEVVRLGPFEVGHDKVTATWAKAAVAMHEY-DPNLSGCICQARCDTILHDFARDI  74

Query  86   MAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKA  127
             A++RASG  E+ ++     QD+ D+ +  S  K+T K E A
Sbjct  75   QASMRASGVYEDDDDMTMFKQDLLDMRE-YSKSKRTRKRENA  115

>PHYCA_125686
Length=290

 Score = 41.2 bits (95),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 35/135 (26%), Positives = 68/135 (50%), Gaps = 5/135 (4%)

Query  20   RFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDG---ITVNATRKRFDD  76
            +F    D+ LL+++   +P+ +  G +   WT +   ++ + G     IT  + + RF+ 
Sbjct  36   KFSKHDDLVLLRQVNADQPFASVRGSLMDAWTSLANKVKVVEGFSKQEITGKSAQARFNV  95

Query  77   LMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETN  136
            L+         +  ASG  E+Y E +QLL +I   VD  + R++  +  + K+    E N
Sbjct  96   LVENHREADKKSAAASGVSEDYTESQQLLDEIVLAVDEHT-REEAQRALELKEKLESEDN  154

Query  137  -GEKIRDAAMSTMKR  150
             G+ +R+ A+S +K+
Sbjct  155  VGKLMREEAVSRLKK  169

>H310_03385
Length=223

 Score = 40.8 bits (94),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 62/136 (46%), Gaps = 14/136 (10%)

Query  21   FKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEV------TEHLQRLCGDGITVNATRKRF  74
            F    DV LL+++    P+ A HG +   WT V      ++   R   DG   +    RF
Sbjct  10   FSKEEDVLLLRQVASEMPFLARHGLIMDKWTAVAHALASSDEFGRPDFDGKKAS---NRF  66

Query  75   DDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAAS--IRKQTDKEEKAKQNER  132
              L+ A         RASG  E+  E++ L+ D+    D A    R+  + ++  +QN  
Sbjct  67   SALIEAHKKKKNEFARASGVAEDMTEKDALMDDLIAAYDDAKEEARRAIESKQALEQN--  124

Query  133  RETNGEKIRDAAMSTM  148
             E+ G  +R+ AM+++
Sbjct  125  -ESMGAFVREEAMTSL  139

>H310_15319
Length=227

 Score = 40.8 bits (94),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 34/126 (27%), Positives = 52/126 (41%), Gaps = 3/126 (2%)

Query  26   DVELLKEIIHVRPYEAPHGEVHKGWTEVTEHL---QRLCGDGITVNATRKRFDDLMTAFH  82
            D+ LL+++ +  P+ A HG +   W  V + L   +              RF  L+ A  
Sbjct  15   DLMLLRQVAYEMPFLARHGLIMDKWASVAQALAADENFSRPDFDAKKANNRFAALLDAHK  74

Query  83   ADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETNGEKIRD  142
                 A +ASG  EE  E+  LL D+    + A   +     E  K  E  E  G  +RD
Sbjct  75   KRNKEAEQASGVSEEVTEKVTLLDDLLAAFEDAKEEEAARAAETKKAMEANEQLGLVVRD  134

Query  143  AAMSTM  148
             AM ++
Sbjct  135  EAMQSL  140

>PHYSO_378731
Length=138

 Score = 40.0 bits (92),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 34/143 (24%), Positives = 70/143 (49%), Gaps = 9/143 (6%)

Query  8    EVQASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITV  67
            E   ++R KT  RF      +L++E     PY   +G+  + W +V    +      + V
Sbjct  3    EAPPTKRRKTMVRFTDELHFQLIQEAQARNPYGEDYGKKSQAWADVAAAFE------VDV  56

Query  68   NA--TRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEE  125
            +    R+R + L+ A+ A   A  + SG  EEY  +++ L ++ ++ +  ++ K   K++
Sbjct  57   DGRRYRERCNQLLDAYEAKQKAGEKRSGPCEEYTPKDECLAELLEMREIEALLKND-KKQ  115

Query  126  KAKQNERRETNGEKIRDAAMSTM  148
            +  Q ++ +     +RDAA++ M
Sbjct  116  QKDQQQQEDEQASAMRDAALAGM  138

>PYIW_26363
Length=144

 Score = 40.0 bits (92),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 46/110 (42%), Gaps = 8/110 (7%)

Query  25   TDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDG---ITVNATRKRFDDLMTAF  81
            T   L +E+    PY A +  V   WT V   L+ +   G   +T  +   RF  L+   
Sbjct  19   TCFSLAREVNAKLPYRAGYNGVMNAWTAVAAALKIIPDLGMASVTAKSCHSRFKALIELH  78

Query  82   HADTMAALRASGTDEEYEERE----QLLQDIHDLV-DAASIRKQTDKEEK  126
                  + RAS   EE  E       LL D  D V D A+ +KQ D+ E+
Sbjct  79   RCSNRESARASDVSEEITELACVLGDLLGDFDDFVEDEAAAKKQNDQSER  128

>H257_10436
Length=527

 Score = 40.8 bits (94),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 42/87 (48%), Gaps = 0/87 (0%)

Query  64   GITVNATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDK  123
            G     T+ RF  L+          +RASG  E+Y E+ QLL ++  + D    R +   
Sbjct  341  GFDAKRTQNRFTLLLEGHRIRDDEYMRASGVAEDYSEKSQLLDELSSVYDDWKKRDKLRL  400

Query  124  EEKAKQNERRETNGEKIRDAAMSTMKR  150
            E+   + ER ET G  IR+ AM ++ +
Sbjct  401  EDVTHEAERVETIGATIREEAMQSLGK  427

>H310_03851
Length=97

 Score = 38.1 bits (87),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 21/76 (28%), Positives = 37/76 (49%), Gaps = 1/76 (1%)

Query  26  DVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKRFDDLMTAFHA-D  84
           D+ LL+E++ V PY+  +G +   W  +   L  L    I   + R  F+ ++  F + D
Sbjct  16  DLALLREVVRVEPYDGEYGTLTVRWKTIASSLSTLFECDIPYRSARDHFESMVERFKSTD  75

Query  85  TMAALRASGTDEEYEE  100
               L  +G++EE  E
Sbjct  76  KAQRLWGTGSEEEVTE  91

>H257_08839
Length=158

 Score = 39.3 bits (90),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 30/51 (59%), Gaps = 1/51 (2%)

Query  69   ATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRK  119
            A + RF+ L+        A+LR SGT EEY ER+QLL  I   VD A +RK
Sbjct  7    ALKARFEYLLAKHEKGESASLRKSGTTEEYSERDQLLTGIKLRVDEA-VRK  56

>H257_12325
Length=191

 Score = 39.3 bits (90),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 36/139 (26%), Positives = 59/139 (42%), Gaps = 29/139 (21%)

Query  26   DVELLKEIIHVRPYEAPHGEVHKGWTEVTEHL-------------QRLCGDGITVNATRK  72
            D+ LL+++     ++A  G V + W  V   L             +RLC           
Sbjct  15   DIMLLRQVSLEMQFQARRGLVMERWNSVAASLRTSEDFSRSDIDAKRLCN----------  64

Query  73   RFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDI---HDLVDAASIRKQTDKEEKAKQ  129
            RF  L+ A+      + RASG DEE+ E+  LL D+   +D V    +R+    EE    
Sbjct  65   RFMLLLDAYRKSDKQSERASGIDEEFTEKSMLLDDLLAAYDDVKNTDLRRT---EESRLA  121

Query  130  NERRETNGEKIRDAAMSTM  148
             E  +  G  +R+ A+ ++
Sbjct  122  AEHVDAMGSLVREEALQSL  140

>H310_12821
Length=179

 Score = 39.3 bits (90),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 51/109 (47%), Gaps = 7/109 (6%)

Query  26   DVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNA--TRKRFDDLMTAFHA  83
            D+ LL ++   RP+ A  G++ K W  + + L      G  V+    + RF  L+     
Sbjct  15   DITLLIQVAADRPFAAEKGQLKKAWQALADTLMACDHFGRVVDGKKVQNRFLALVEEHKI  74

Query  84   DTMAALRASGTDEEYEEREQLLQDIHDLVD----AASIRKQTDKEEKAK  128
                + R SG D E  E+  LL DI +L+D      +IR +  +EEK K
Sbjct  75   FDAESARLSGVDAEEREKHVLLDDIVNLLDDMKSLPAIRSEG-QEEKVK  122

>H257_00377
Length=223

 Score = 39.3 bits (90),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 34/126 (27%), Positives = 53/126 (42%), Gaps = 3/126 (2%)

Query  26   DVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQR---LCGDGITVNATRKRFDDLMTAFH  82
            D+ LL+++    P++A  G V + W  V   L+         I    +  RF  L+ A  
Sbjct  15   DIMLLRQVSLEMPFQARRGLVMERWNSVAASLRTAEDFSRSDIDAKRSCNRFMLLLDAHR  74

Query  83   ADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETNGEKIRD  142
                 + RASG DEE  E+  LL D+    D A        EE     E  +  G  +R+
Sbjct  75   KSDKQSERASGIDEEVTEKSMLLDDLLAAYDDAKNADLRRTEESRLAAEHVDAMGSLVRE  134

Query  143  AAMSTM  148
             A+ ++
Sbjct  135  EALHSL  140

>PPTG_08500
Length=285

 Score = 39.3 bits (90),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 34/127 (27%), Positives = 53/127 (42%), Gaps = 11/127 (9%)

Query  19   FRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKRFDDLM  78
            FRF    D EL++E I  +PY A +GE    W +V + +       +     + R   L 
Sbjct  3    FRFSEDIDKELMREAIKQKPYTAKYGEAAAVWVQVAKCVSAAVKVSLVDKQVQDRVRLLK  62

Query  79   TAFHADTMAALRASGTDEE---------YEEREQLLQDIHDLVDAASIRKQTDKEEKAKQ  129
              + A  + A   SG +E          Y+    L+     L      +KQ++KE+  KQ
Sbjct  63   KNWSAGELRAALGSGIEEARNATNEQSHYDSLPGLVGQYVSLEKDFKAQKQSNKEK--KQ  120

Query  130  NERRETN  136
             E  +TN
Sbjct  121  AEEAQTN  127

>H257_18151
Length=130

 Score = 38.1 bits (87),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 35/60 (58%), Gaps = 0/60 (0%)

Query  89   LRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETNGEKIRDAAMSTM  148
            +RASG  E+Y E+ QLL ++  + D    R +   E+  ++ ER ET G  IR+ AM ++
Sbjct  1    MRASGVAEDYSEKSQLLDELSSVYDDWKKRDKLRLEDVMREAERVETMGATIREEAMQSL  60

>PPTG_06633
Length=292

 Score = 38.9 bits (89),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 35/81 (43%), Gaps = 0/81 (0%)

Query  19  FRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKRFDDLM  78
           FRF    D EL++E I  +P+ A +G+  + W  V E +       +     R R   L 
Sbjct  3   FRFTNENDKELMREAIAQKPFAAKYGDSARVWATVAERMSAAIQIVVLEKQVRDRVRLLK  62

Query  79  TAFHADTMAALRASGTDEEYE  99
             + A  + +   SG +E  E
Sbjct  63  KIWRAGELRSALGSGIEETLE  83

>H257_14759
Length=198

 Score = 38.5 bits (88),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 45/94 (48%), Gaps = 6/94 (6%)

Query  26   DVELLKEIIHVRPYEAPHGEVHKGWTEVTEHL---QRLCGDGITVNATRKRFDDLM-TAF  81
            D+ LL+++   RP+EA  GE  K W  V + L   +            + RF  +M    
Sbjct  15   DIMLLRQVNAERPFEAKKGEFMKVWGLVAKALADHEGFARPQFDAKKAQNRFSAVMDNHV  74

Query  82   HADTMAALRASGTDEEYEEREQLLQD-IHDLVDA  114
            H +  +A+ ASG  E Y+ER  LL + +   VDA
Sbjct  75   HYNRESAM-ASGVAETYDERIALLDELLAAFVDA  107

>PPTG_16964
Length=104

 Score = 37.4 bits (85),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 34/79 (43%), Gaps = 1/79 (1%)

Query  19  FRFKGCTDVELLKEIIHVRPYEA-PHGEVHKGWTEVTEHLQRLCGDGITVNATRKRFDDL  77
           FRF    D+E+L E+I  +P+ A   G   + W  V   L       I V   R RF+ L
Sbjct  3   FRFTTMEDLEMLWELIRQKPFAAKKRGSTLEMWDSVVAALGSALKKEINVKQIRDRFNLL  62

Query  78  MTAFHADTMAALRASGTDE  96
              F      +  ASG +E
Sbjct  63  KARFKEKEQLSALASGVEE  81

>H310_10580
Length=199

 Score = 38.5 bits (88),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 21/27 (78%), Gaps = 0/27 (0%)

Query  87   AALRASGTDEEYEEREQLLQDIHDLVD  113
            A+LR SGT EEYEERE LLQDI   +D
Sbjct  51   ASLRKSGTAEEYEEREHLLQDIKTRMD  77

>PHYRA_78761
Length=184

 Score = 38.1 bits (87),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 44/83 (53%), Gaps = 7/83 (8%)

Query  26   DVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCG---DGITVNATRKRFDDLMTAFH  82
            DV LL++++  RP++ P G+V + W  +   L    G     ++   ++ R + L+   H
Sbjct  28   DVALLRQVLLDRPFDKPRGKVMQHWDSLAATLVASSGFTRSKLSGKNSQSRINQLVRT-H  86

Query  83   ADTM--AALRASGTDEEYEEREQ  103
             +TM  AAL  SG  EE  ER+Q
Sbjct  87   RETMKKAAL-LSGVSEEITERDQ  108

>PITG_08385
Length=204

 Score = 38.5 bits (88),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 23/35 (66%), Gaps = 0/35 (0%)

Query  69   ATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQ  103
            A R RF +L+  + AD   ++R SGT EEY EREQ
Sbjct  25   AMRTRFTNLVNQYKADQCQSMRKSGTTEEYAEREQ  59

>PHYSO_330097
Length=203

 Score = 38.5 bits (88),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 33/133 (25%), Positives = 67/133 (50%), Gaps = 9/133 (7%)

Query  20   RFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNA--TRKRFDDL  77
            RF    D +L++E     PY   +G+  + W +V   L+      + V+    R+R + L
Sbjct  3    RFTDELDFQLIQEAQARNPYGEDYGKKTQAWADVAAALE------VDVDGRRCRERCNQL  56

Query  78   MTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETNG  137
            + A+ A   A+ + SG  EEY  +++ L ++ ++ +  ++ K   K+++  Q ++ +   
Sbjct  57   VDAYEAKQKASEKRSGPCEEYTPKDECLAELLEMREIEALLKND-KKQQKDQQQQEDEQA  115

Query  138  EKIRDAAMSTMKR  150
              +RDAA+  M R
Sbjct  116  SAMRDAALEGMSR  128

>PPTG_04118
Length=274

 Score = 38.5 bits (88),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 59/115 (51%), Gaps = 2/115 (2%)

Query  33   IIHVRPYEAPHGEVHKGWTEVTEHLQ-RLCGDG-ITVNATRKRFDDLMTAFHADTMAALR  90
            ++ + P+   HG++   +  + ++L   L  D  ++    ++RF  L+  F  +  A  +
Sbjct  1    MLAIEPFAGGHGKIGARYQLMADNLSVHLKLDPKLSKRTVQERFTLLLDEFKQNDQAYRK  60

Query  91   ASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETNGEKIRDAAM  145
             +G  E YEE +QLLQD+ D +      K   K++K  + +R +T G  +R+ A+
Sbjct  61   KTGVAENYEEHKQLLQDLSDRIRDVKAIKTDKKQKKKDKEDRLQTQGAILREMAV  115

>H257_10707
Length=213

 Score = 38.5 bits (88),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 27/45 (60%), Gaps = 0/45 (0%)

Query  69   ATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVD  113
              + RF+ L  A    + +A+R SGTDEE+ E EQLL DI   V+
Sbjct  161  GCKTRFNKLAKANKERSFSAMRRSGTDEEFNECEQLLGDILSQVN  205

>PHYSO_322347
Length=202

 Score = 38.1 bits (87),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 66/143 (46%), Gaps = 17/143 (12%)

Query  8    EVQASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITV  67
            E   ++R KT  RF    D +L+++     PY   +G+  + W +V   L+         
Sbjct  14   EAPPTKRRKTMARFTDELDFQLIQKAQARNPYGEDYGKKTQAWADVAAALEV--------  65

Query  68   NATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKA  127
                    DL+ A+ A   A+ + SG  EEY  +++ L ++ +L +  ++ K   K+ K 
Sbjct  66   --------DLVDAYEAKQKASEKRSGPCEEYTPKDECLAELLELREIEALLKNDKKQPKD  117

Query  128  KQNERRETNGEKIRDAAMSTMKR  150
            +Q +  +     +RDAA+  M R
Sbjct  118  QQQQ-EDEQASAMRDAALEGMSR  139

>H257_18654
Length=162

 Score = 37.7 bits (86),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 41/80 (51%), Gaps = 0/80 (0%)

Query  69   ATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAK  128
            A   RF+ L+        A+LR SGT EEY E +QLL DI   +D  +  +   K+   +
Sbjct  7    ALNTRFEYLLAKHETGESASLRKSGTTEEYSEHDQLLTDIKLRMDDFAKNEAARKDAAKR  66

Query  129  QNERRETNGEKIRDAAMSTM  148
            + E  E +G  +R  AM+ +
Sbjct  67   KLEGVENSGLVMRQLAMAEL  86

>H257_01792
Length=162

 Score = 37.7 bits (86),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 41/80 (51%), Gaps = 0/80 (0%)

Query  69   ATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAK  128
            A   RF+ L+        A+LR SGT EEY E +QLL DI   +D  +  +   K+   +
Sbjct  7    ALNTRFEYLLAKHETGESASLRKSGTTEEYSEHDQLLTDIKLRMDDFAKNEAARKDAAKR  66

Query  129  QNERRETNGEKIRDAAMSTM  148
            + E  E +G  +R  AM+ +
Sbjct  67   KLEGVENSGLVMRQLAMAEL  86

>H310_04226
Length=236

 Score = 38.1 bits (87),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 56/131 (43%), Gaps = 15/131 (11%)

Query  26   DVELLKEIIHVRPYEAPHGEVHKGWTEVTEHL------QRLCGDGITVNATRKRFDDLMT  79
            DV LL ++    P+ A  G++   W  V  +L       R   DG    A   RF  L+ 
Sbjct  15   DVLLLTQVSVEMPFLAHRGKIMDVWESVARNLATIGEFDRPNFDGKKAQA---RFLILLR  71

Query  80   AFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRET---N  136
                   A+ RASG  E   E+  LL D+ + VD A   KQ +    A + E   T   N
Sbjct  72   DHRDSNNASQRASGAAEHVTEKTVLLDDLCNQVDEA---KQEEHRRAANECEEAATVEEN  128

Query  137  GEKIRDAAMST  147
            G  +RD AM +
Sbjct  129  GATVRDEAMRS  139

>H310_14075
Length=217

 Score = 37.7 bits (86),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 52/126 (41%), Gaps = 3/126 (2%)

Query  26   DVELLKEIIHVRPYEAPHGEVHKGWTEVTEHL---QRLCGDGITVNATRKRFDDLMTAFH  82
            D+ LL+++    P++A  G+V + W +V   L        D I       RF  L+   H
Sbjct  15   DIMLLRQVSLEMPFQARRGQVMERWADVASALLGSGEFTRDDIDAKRACNRFMLLLDGHH  74

Query  83   ADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETNGEKIRD  142
                 +  ASG  +E  E+   L D+    D   + +    +E  +  +  E  G  IR 
Sbjct  75   RINKESQCASGVSDEVGEKTNFLDDLMVAYDDTKMVEAQRADETREAADHAEAMGSFIRA  134

Query  143  AAMSTM  148
             AM +M
Sbjct  135  EAMKSM  140

>H310_15160
Length=200

 Score = 37.7 bits (86),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 31/101 (31%), Positives = 45/101 (45%), Gaps = 9/101 (9%)

Query  21   FKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRL------CGDGITVNATRKRF  74
            F    D+ LL ++   RP+ A  G +   W  V  +L  L        DG    A   RF
Sbjct  10   FNEREDILLLTQVSVERPHIARRGRIMDVWDSVARNLNTLDEFNRRHFDGKRAQA---RF  66

Query  75   DDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAA  115
            + L+       +A+ R SG+DE  +ER  LL D+   V+ A
Sbjct  67   NLLLRDHKERNVASNRPSGSDEVVDERVVLLDDLSSQVEEA  107

>SPRG_04833
Length=219

 Score = 37.0 bits (84),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 56/119 (47%), Gaps = 9/119 (8%)

Query  26   DVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGIT---VNATRK--RFDDLMTA  80
            DV LL+E+   RP+ A +G V   WT +   +  +  +G T    ++T+   RF  L++ 
Sbjct  12   DVILLREVARDRPFLARYGLVAGAWTSLAAKV--VATEGFTRTNFSSTKAQVRFTTLISN  69

Query  81   FHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIR--KQTDKEEKAKQNERRETNG  137
              ++T  +L  S   E   E+  LL  +  L  +   R  K+T +   A    R++T G
Sbjct  70   HRSETETSLLDSKCSEVCFEKRSLLDTLLPLWSSRKARADKKTPRTTDADSQRRKDTKG  128

>H257_07657
Length=212

 Score = 36.6 bits (83),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 35/131 (27%), Positives = 61/131 (47%), Gaps = 13/131 (10%)

Query  26   DVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGIT---VNATR--KRFDDLMTA  80
            DV LL+++    P++A  G V + W +V   L+    D      ++A R   RF  L+ A
Sbjct  15   DVMLLRQVSLEMPFQARRGHVMERWADVASALE--MADDFRRSDIDAKRACNRFMLLLDA  72

Query  81   FHADTMAALRASGTDEEYEEREQLLQDI---HDLVDAASIRKQTDKEEKAKQNERRETNG  137
                   + RASG  E+  E+  LL D+   +D +  A  ++  +    A+Q    E  G
Sbjct  73   HRKANNQSQRASGVAEDVSEKTVLLDDLLASYDDIKGAEAQRADETRHTAEQM---EAMG  129

Query  138  EKIRDAAMSTM  148
             ++R  A+ ++
Sbjct  130  SQVRAEALVSL  140

>PHYSO_435001
Length=138

 Score = 35.8 bits (81),  Expect = 0.028, Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 69/143 (48%), Gaps = 9/143 (6%)

Query  8    EVQASQRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITV  67
            E   ++R K   R     D +L++E     PY   +G+  + W +V   L+      + V
Sbjct  3    EAPPTKRRKMMVRVTDELDFQLIQEAQARNPYGEDYGKKTQAWADVAAALE------VDV  56

Query  68   NA--TRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEE  125
            +    R+R + L+ A+ A   A+ + SG  EEY  +++   ++ ++ +  ++ K   K++
Sbjct  57   DGRRCRERCNQLVDAYKAKQKASEKQSGPCEEYTPKDECRAELLEMREIEALLKND-KKQ  115

Query  126  KAKQNERRETNGEKIRDAAMSTM  148
            +  Q ++ +     +RDAA+  M
Sbjct  116  QKDQQQQEDEQASAMRDAALEGM  138

>PPTG_20418
Length=219

 Score = 36.2 bits (82),  Expect = 0.038, Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 45/100 (45%), Gaps = 6/100 (6%)

Query  20   RFKGCTDVELLKEI--IHV-RPYEAPHGEVHKGWTEVTEHL---QRLCGDGITVNATRKR  73
            R K  TD E L ++  IH  RP+    G +   W  +   L   +    + ++      R
Sbjct  6    RRKNFTDDEDLAQLRQIHADRPFLRQRGGIMAAWDALATKLVVDENFPRNKVSGKTASGR  65

Query  74   FDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVD  113
            FD L+ A  A      +ASG DE+  E+  LL D+  ++D
Sbjct  66   FDKLVEAHRAAAEEPAKASGVDEDESEKVILLDDLVAMLD  105

>PHALS_06409
Length=227

 Score = 36.2 bits (82),  Expect = 0.040, Method: Compositional matrix adjust.
 Identities = 26/94 (28%), Positives = 43/94 (46%), Gaps = 3/94 (3%)

Query  20   RFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTE--HLQRLCG-DGITVNATRKRFDD  76
            +F G  DV LL+ +    P+ A HG   + W  + E   LQ     +  + +  R R   
Sbjct  22   KFNGSMDVVLLQALQLNNPFTAKHGTRLQMWQHIAEAVGLQIFNNPNAFSWHTCRDRVTA  81

Query  77   LMTAFHADTMAALRASGTDEEYEEREQLLQDIHD  110
            LM  +       L   GT EE  ++E +L++I++
Sbjct  82   LMKMYTDGKHDKLFKHGTMEENAQKESILREINE  115

>H257_08837
Length=225

 Score = 36.2 bits (82),  Expect = 0.042, Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 51/126 (40%), Gaps = 3/126 (2%)

Query  26   DVELLKEIIHVRPYEAPHGEVHKGWTEVTEHL---QRLCGDGITVNATRKRFDDLMTAFH  82
            D+ LL+++    P+ A  G +   WT + E L   +              RF  L  A  
Sbjct  15   DIMLLRQVSADMPFLARRGLIMDNWTAIAETLAANEDFGRPDFDAKKANNRFIALAEAHR  74

Query  83   ADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERRETNGEKIRD  142
                 + RASG  E+  E+  LL DI    D A   +     +  K +E  +  G  +R+
Sbjct  75   KIHRVSARASGISEDVGEKVALLDDILSAHDDAKEEESQRIADAKKTHEHNDNLGSVVRE  134

Query  143  AAMSTM  148
             AM ++
Sbjct  135  EAMQSL  140

>PHYSO_309926
Length=160

 Score = 35.4 bits (80),  Expect = 0.044, Method: Compositional matrix adjust.
 Identities = 23/68 (34%), Positives = 34/68 (50%), Gaps = 1/68 (1%)

Query  26  DVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKRFDDLMTAFHADT  85
           DV LLK+ +    Y+  HG+V + W ++ + L   C D    N T KR    +T   AD 
Sbjct  15  DVMLLKQTLADELYQQEHGKVMEYWEKLAQTLV-ACADFSRKNLTAKRPRTALTRLSADK  73

Query  86  MAALRASG  93
            AA  ++G
Sbjct  74  DAANESAG  81

>PHYRA_93678
Length=217

 Score = 35.4 bits (80),  Expect = 0.058, Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 44/102 (43%), Gaps = 15/102 (15%)

Query  20   RFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITV---------NAT  70
            +F G  DV LL+ +    P+ A HG   + W  V E +      G++V         +  
Sbjct  29   KFNGAMDVLLLEALQVNNPFTAKHGTRLQMWHNVAESV------GVSVFKNPAAYSWHTC  82

Query  71   RKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLV  112
            R R   LM  +       L   GT EE   +E +L++I+D +
Sbjct  83   RDRVTALMKMYTDGKHDKLFKHGTMEENARKEAILREINDTL  124

>PITG_09590
Length=195

 Score = 35.4 bits (80),  Expect = 0.064, Method: Compositional matrix adjust.
 Identities = 35/117 (30%), Positives = 53/117 (45%), Gaps = 14/117 (12%)

Query  21   FKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCG---DGITVNATRKRFDDL  77
            F G  D+ LL++    RP+ +  G V   W  V   L    G   D ++    + R D L
Sbjct  10   FTGEEDLALLRQAAFDRPFLSERGGVIAAWDSVAATLVGDAGFPRDKLSGKHAQARLDKL  69

Query  78   MTAFHADTMAALRASGT-DEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNERR  133
            +         AL ASG  +EE E + Q         DAA  +++ D++E+A +N RR
Sbjct  70   IRRKRDANTVALAASGVAEEETEAKSQ--------KDAA--KRKRDEDEEASRNVRR  116

>PPTG_18296
Length=248

 Score = 35.4 bits (80),  Expect = 0.067, Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 43/96 (45%), Gaps = 3/96 (3%)

Query  20   RFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEH--LQRLCGDG-ITVNATRKRFDD  76
            +F G  DV LL+ +    P+ A HG   + W  V E   +Q     G  + +  R R   
Sbjct  40   KFNGTMDVMLLEALQVNNPFTAKHGTRLQMWQNVAESIGMQVFKNPGAFSWHTCRDRVTA  99

Query  77   LMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLV  112
            LM  +       L   GT EE   +E +L++I++ +
Sbjct  100  LMKMYTDGKHDKLFKHGTMEENARKETILREINETL  135

>PPTG_03797
Length=210

 Score = 35.4 bits (80),  Expect = 0.070, Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 33/78 (42%), Gaps = 0/78 (0%)

Query  19  FRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRKRFDDLM  78
           FRF    D EL+ E+I  RP+ A +GE    W +V   +       +     + R   L 
Sbjct  3   FRFSEDMDKELMCEVIKQRPFAAKYGETGTVWVQVATRVSASIKVVVIDKQVQDRVRLLK  62

Query  79  TAFHADTMAALRASGTDE  96
             + A  + A   SG +E
Sbjct  63  KNWRAGELRATLGSGIEE  80

Lambda      K        H        a         alpha
   0.313    0.128    0.358    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4590997920

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40