Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
CCI451231475630130115520.0
CCA188991475634330111991e-165
CCI451271609872022029992e-137
PYU1_G001735147563423095606e-69
PYIR_13451147563593215563e-68
PYIW_19971147563482895302e-64
PYAP_17762147563482964991e-59
PHALS_06478147563453114953e-59
PPTG_17127147563513114945e-59
PITG_18456147563513114893e-58
PHYCA_556162147563513044852e-57
PYAR_13570147563223034778e-57
PHYSO_471523147563483044772e-56
PHYRA_81100147563493044684e-55
PHYKE_8393147563262904656e-55
PYVX_18171147562942984436e-52
SDRG_01781147563353083106e-32
SPRG_06336147563353053098e-32
H310_09223147563331942581e-24
H257_06294147563583202381e-21
HYAP_073868391461113732.7
PHYSO_554279273883336733.6
PITG_03156273882936706.8
CCI39615813036189697.8
PPTG_14464273882636708.3
SPRG_05711273853838698.5
SDRG_10289273875838699.2
PHYKE_7847273883636699.7
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= CCI45123

Length=301
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

CCI45123                                                              602        0.0   
CCA18899                                                              466        1e-165
CCI45127                                                              389        2e-137
PYU1_G001735                                                          220        6e-69 
PYIR_13451                                                            218        3e-68 
PYIW_19971                                                            208        2e-64 
PYAP_17762                                                            196        1e-59 
PHALS_06478                                                           195        3e-59 
PPTG_17127                                                            194        5e-59 
PITG_18456                                                            192        3e-58 
PHYCA_556162                                                          191        2e-57 
PYAR_13570                                                            188        8e-57 
PHYSO_471523                                                          188        2e-56 
PHYRA_81100                                                           184        4e-55 
PHYKE_8393                                                            183        6e-55 
PYVX_18171                                                            175        6e-52 
SDRG_01781                                                            124        6e-32 
SPRG_06336                                                            123        8e-32 
H310_09223                                                            103        1e-24 
H257_06294                                                            96.3       1e-21 
HYAP_07386                                                            32.7       2.7   
PHYSO_554279                                                          32.7       3.6   
PITG_03156                                                            31.6       6.8   
CCI39615                                                              31.2       7.8   
PPTG_14464                                                            31.6       8.3   
SPRG_05711                                                            31.2       8.5   
SDRG_10289                                                            31.2       9.2   
PHYKE_7847                                                            31.2       9.7   

>CCI45123
Length=301

 Score = 602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/301 (100%), Positives = 301/301 (100%), Gaps = 0/301 (0%)

Query  1    MQVSYYESKDSYKNRNATPKGSFILQNVEKHEYWISRMVTGSVKERPFGFKMVGHAPKQG  60
            MQVSYYESKDSYKNRNATPKGSFILQNVEKHEYWISRMVTGSVKERPFGFKMVGHAPKQG
Sbjct  1    MQVSYYESKDSYKNRNATPKGSFILQNVEKHEYWISRMVTGSVKERPFGFKMVGHAPKQG  60

Query  61   YVELDVFVDSLSNMDQWLDVINNGLKANKRMAREAFMAEMDTTKGVLGFSFAGTTSKQQV  120
            YVELDVFVDSLSNMDQWLDVINNGLKANKRMAREAFMAEMDTTKGVLGFSFAGTTSKQQV
Sbjct  61   YVELDVFVDSLSNMDQWLDVINNGLKANKRMAREAFMAEMDTTKGVLGFSFAGTTSKQQV  120

Query  121  KELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQLGKVEQNLSNIESDLNHSEKLI  180
            KELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQLGKVEQNLSNIESDLNHSEKLI
Sbjct  121  KELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQLGKVEQNLSNIESDLNHSEKLI  180

Query  181  KSIRHPLRYFFSKTHHHEKDAMSKNNTNHRSHHHQTGILHMRKNDGKIEHVAEEICVPTN  240
            KSIRHPLRYFFSKTHHHEKDAMSKNNTNHRSHHHQTGILHMRKNDGKIEHVAEEICVPTN
Sbjct  181  KSIRHPLRYFFSKTHHHEKDAMSKNNTNHRSHHHQTGILHMRKNDGKIEHVAEEICVPTN  240

Query  241  DleklamalkeleVQAQLINSEAVKSNDQITRIEGQLSGINDRIQSQTTQVVASSGKKNL  300
            DLEKLAMALKELEVQAQLINSEAVKSNDQITRIEGQLSGINDRIQSQTTQVVASSGKKNL
Sbjct  241  DLEKLAMALKELEVQAQLINSEAVKSNDQITRIEGQLSGINDRIQSQTTQVVASSGKKNL  300

Query  301  F  301
            F
Sbjct  301  F  301

>CCA18899
Length=343

 Score = 466 bits (1199),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 238/301 (79%), Positives = 271/301 (90%), Gaps = 1/301 (0%)

Query  1    MQVSYYESKDSYKNRNATPKGSFILQNVEKHEYWISRMVTGSVKERPFGFKMVGHAPKQG  60
            MQVSYYESKDS K++NATPKGSFILQ+ EKHEYWIS+MVTGSVKE+PFGFKMVGHAPKQG
Sbjct  44   MQVSYYESKDSSKSKNATPKGSFILQSAEKHEYWISQMVTGSVKEKPFGFKMVGHAPKQG  103

Query  61   YVELDVFVDSLSNMDQWLDVINNGLKANKRMAREAFMAEMDTTKGVLGFSFAGTTSKQQV  120
            Y+ELDVFVDS S+MDQWLDVINNGLKA+K MAREAFMAEMDTTK VLGFS+ GTTSKQQ+
Sbjct  104  YIELDVFVDSSSDMDQWLDVINNGLKASKCMAREAFMAEMDTTKSVLGFSYIGTTSKQQI  163

Query  121  KELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQLGKVEQNLSNIESDLNHSEKLI  180
            + LKS+K DYIHEALQQIEMAKSAG+AACDEIV+QGEQLGKVEQNLS I++DLNHSEKLI
Sbjct  164  QVLKSKKCDYIHEALQQIEMAKSAGNAACDEIVSQGEQLGKVEQNLSTIQNDLNHSEKLI  223

Query  181  KSIRHPLRYFFSKTHHHEKDAMSKNNTNHRSHHHQTGILHMRKNDGKIEHVAEEICVPTN  240
            KSIRHPLRYFFS++  H++ A    +++    HH  GILH  K D  ++H+AEEI VPTN
Sbjct  224  KSIRHPLRYFFSRSRPHDR-ATISKSSSIHRSHHHPGILHKTKKDRNVDHLAEEIRVPTN  282

Query  241  DleklamalkeleVQAQLINSEAVKSNDQITRIEGQLSGINDRIQSQTTQVVASSGKKNL  300
            D+EKLAMALK+LEVQAQLINSEAVKSN+QI RIEGQLSGINDRIQ+QT+QV+ SSGK+NL
Sbjct  283  DIEKLAMALKDLEVQAQLINSEAVKSNEQIARIEGQLSGINDRIQAQTSQVITSSGKQNL  342

Query  301  F  301
            F
Sbjct  343  F  343

>CCI45127
Length=202

 Score = 389 bits (999),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 202/202 (100%), Positives = 202/202 (100%), Gaps = 0/202 (0%)

Query  100  MDTTKGVLGFSFAGTTSKQQVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQL  159
            MDTTKGVLGFSFAGTTSKQQVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQL
Sbjct  1    MDTTKGVLGFSFAGTTSKQQVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQL  60

Query  160  GKVEQNLSNIESDLNHSEKLIKSIRHPLRYFFSKTHHHEKDAMSKNNTNHRSHHHQTGIL  219
            GKVEQNLSNIESDLNHSEKLIKSIRHPLRYFFSKTHHHEKDAMSKNNTNHRSHHHQTGIL
Sbjct  61   GKVEQNLSNIESDLNHSEKLIKSIRHPLRYFFSKTHHHEKDAMSKNNTNHRSHHHQTGIL  120

Query  220  HMRKNDGKIEHVAEEICVPTNDleklamalkeleVQAQLINSEAVKSNDQITRIEGQLSG  279
            HMRKNDGKIEHVAEEICVPTNDLEKLAMALKELEVQAQLINSEAVKSNDQITRIEGQLSG
Sbjct  121  HMRKNDGKIEHVAEEICVPTNDLEKLAMALKELEVQAQLINSEAVKSNDQITRIEGQLSG  180

Query  280  INDRIQSQTTQVVASSGKKNLF  301
            INDRIQSQTTQVVASSGKKNLF
Sbjct  181  INDRIQSQTTQVVASSGKKNLF  202

>PYU1_G001735
Length=342

 Score = 220 bits (560),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 130/309 (42%), Positives = 193/309 (62%), Gaps = 24/309 (8%)

Query  1    MQVSYYESKDSYKNRNATPKGSFILQNVEKHEYWISRMVTGSVKERPFGFKMVGHAPKQG  60
            +QVSY+ES+D+       PKGSF + +VEKHEYWI  M     KE+PFGFK+VGHAP +G
Sbjct  50   LQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWIGVM---GGKEKPFGFKLVGHAPSKG  106

Query  61   YVELDVFVDSLSNMDQWLDVINNGLKANKRMAREAFMAEMDTTKGVLGFSFAGTTSKQQV  120
            Y+ELD+FV+SL ++++WL+V+ N L A K++ R+      D+TK + GF  A  + + QV
Sbjct  107  YIELDIFVESLPDVNKWLEVVQNALDAAKKLTRKGMT---DSTKSMFGFG-ASISPQLQV  162

Query  121  KELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQLGKVEQNLSNIESDLNHSEKLI  180
            K+L + K + + EAL++IE AK  G  A +EIV+QGE+L +VE +L ++E DL+H++KL+
Sbjct  163  KKLAATKEELLREALREIEGAKLIGREAVNEIVSQGEKLDQVENDLGHVEGDLDHADKLL  222

Query  181  KSIRHPLRYFFSKTHHHEKDAMSKNNTNHRSHHHQT--------GILHMRKNDGKIEHVA  232
            + ++ P+ + FS  +  +K A +    +       T        G LH +   G      
Sbjct  223  RHLKSPVLHVFSNDNRQKKGAPTAATASASGGASATTSPVSGTEGQLHAKITGG------  276

Query  233  EEICVPTNDleklamalkeleVQAQLINSEAVKSNDQITRIEGQLSGINDRIQSQTTQVV  292
                   NDLE LA+AL ELE QA L+N+EA +S +QI RIE +L+ +NDR+Q QT +  
Sbjct  277  ---GGTLNDLEMLALALSELEEQANLMNAEAARSTEQIARIEERLTSVNDRVQHQTKKAT  333

Query  293  ASSGKKNLF  301
            A+    NLF
Sbjct  334  ATMKAGNLF  342

>PYIR_13451
Length=359

 Score = 218 bits (556),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 132/321 (41%), Positives = 200/321 (62%), Gaps = 36/321 (11%)

Query  1    MQVSYYESKDSYKNRN-------ATPKGSFILQNVEKHEYWISRMVTGSVKERPFGFKMV  53
            +QV+YYES+D+ K  +         PKGSF + +VEKHEYW+  M     +E+PFGFK+V
Sbjct  55   LQVAYYESRDASKGSSSSGGTGVPVPKGSFYVSSVEKHEYWVGVM---GGREKPFGFKLV  111

Query  54   GHAPKQGYVELDVFVDSLSNMDQWLDVINNGLKANKRMAREAFMAEMDTTKGVLGFSFAG  113
            GHAPK+GY+ELD+FV+SL ++++W++V+ N L A K+ +R     +  TTK + GFS A 
Sbjct  112  GHAPKKGYIELDIFVESLGDLNKWVEVVQNALDAAKKRSRTGGFQDNSTTKTMFGFS-AS  170

Query  114  TTSKQQVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQLGKVEQNLSNIESDL  173
             + + QVK+L + K D + +AL++IE AK  G  A +EIV QGE+L  VE +L  +E DL
Sbjct  171  ASPQLQVKKLAATKEDLLRDALREIEGAKLIGREAVNEIVVQGEKLDMVESDLGKVEGDL  230

Query  174  NHSEKLIKSIRHPLRYFFSKTHHHEKDAMSKNNTNH--RSHHHQTGI-----------LH  220
            +H++KL++ ++ P+ + FS     ++   +   + H  R+ H QT             +H
Sbjct  231  DHADKLLRHMKRPMLHLFSGDERVKQSPHTGGASGHTDRASHGQTPGTTNGGTAGGQQIH  290

Query  221  MRKNDGKIEHVAEEICVPTNDleklamalkeleVQAQLINSEAVKSNDQITRIEGQLSGI  280
             ++ND              +DLEKLA+AL ELE QA L+N+EAVKS +QI R+E +L+ +
Sbjct  291  GQRNDA------------LSDLEKLALALGELEEQANLMNAEAVKSTEQIARVEQRLTAV  338

Query  281  NDRIQSQTTQVVASSGKKNLF  301
            NDR+Q+QT +  A+    NLF
Sbjct  339  NDRVQTQTKKANATMKAGNLF  359

>PYIW_19971
Length=348

 Score = 208 bits (530),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 119/289 (41%), Positives = 180/289 (62%), Gaps = 10/289 (3%)

Query  18   TPKGSFILQNVEKHEYWISRMVTGSVKERPFGFKMVGHAPKQGYVELDVFVDSLSNMDQW  77
            TPKGSF + +VEKHEYW+  M     +E+PFGFK+VGHAPK+GY+ELD+FV++L ++++W
Sbjct  65   TPKGSFFVSSVEKHEYWVGVM---GGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKW  121

Query  78   LDVINNGLKANKRMAREAFMAEMDTTKGVLGFSFAGTTSKQQVKELKSRKSDYIHEALQQ  137
            ++V+ N L A K+  R    A+  TTK + GFS A  + + QVK+L + K + + +AL++
Sbjct  122  VEVVQNALDAAKKHTRTPGAADSSTTKNMFGFS-ATVSPQLQVKKLAATKEELLRDALRE  180

Query  138  IEMAKSAGSAACDEIVAQGEQLGKVEQNLSNIESDLNHSEKLIKSIRHPLRYFF-----S  192
            IE AK  G  A  +I  QG +L  +E +L  +ESDL+H  KL+  ++ P+ + F     S
Sbjct  181  IEGAKLIGREAVSDIKGQGGKLNMIEDDLGKVESDLDHGGKLLNHMKRPMLHLFSNDNRS  240

Query  193  KTHHHEKDAMSKNNTNHRSHHHQTGILHMRKNDGKIEHVAEEICVPTNDleklamalkel  252
            K + H   + S +   H   H  +G        G   H  ++  V  +DLE+L +AL EL
Sbjct  241  KPNAHHSGSHSDHKDGHSGAHPSSGGSSAETATGAQHHQQQDTSV-MSDLERLVLALGEL  299

Query  253  eVQAQLINSEAVKSNDQITRIEGQLSGINDRIQSQTTQVVASSGKKNLF  301
            E QA  +N+EAVKS +QI R+E +L+ +NDR+Q+QT +  A+    NLF
Sbjct  300  EEQATAMNAEAVKSTEQIARVEQRLTAVNDRVQAQTKKATATMKAGNLF  348

>PYAP_17762
Length=348

 Score = 196 bits (499),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 115/296 (39%), Positives = 184/296 (62%), Gaps = 11/296 (4%)

Query  1    MQVSYYESKDSYKNRNATPKGSFILQNVEKHEYWISRMVTGSVKERPFGFKMVGHAPKQG  60
            + VSYY+SK+  +   A PKGSF L +VEKHEY++   V G+ +E+PFGFKMVGHAP++G
Sbjct  58   LLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVG--VLGA-QEKPFGFKMVGHAPRKG  114

Query  61   YVELDVFVDSLSNMDQWLDVINNGLKANKRMAREAFMAEMDTTKGVLGFSFAGTTSKQQV  120
            YVELD+FV++L ++++WL+V  N L A K++ R     E    K + GFS A T+ +QQ+
Sbjct  115  YVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTG-QPEALAPKSLFGFSPA-TSPQQQM  172

Query  121  KELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQLGKVEQNLSNIESDLNHSEKLI  180
            K++ + K   + +A+++IE AK  G +AC EI  QGE+L  + Q L+++E DL++++KL+
Sbjct  173  KKMTATKEQMLKQAIEEIESAKLIGRSACQEIFIQGERLDHIGQELAHVEGDLDYADKLL  232

Query  181  KSIRHPLRYFFSKTHHHEKDAMSKNNTNHRSHHHQTGILHMRKNDGKIEHVAEEIC--VP  238
            + +++P  + FS          +KN    +     T      +    I   + +     P
Sbjct  233  RHMKNPGLHMFSSDARDR----AKNTGRTKPSSRDTPSAVSEETRAAILSDSHDAVGGAP  288

Query  239  TNDleklamalkeleVQAQLINSEAVKSNDQITRIEGQLSGINDRIQSQTTQVVAS  294
             +D+E+LA  L ELE QA L+N EA+K   Q+ R+  QL+ +N+R+++QT +  AS
Sbjct  289  LSDIERLASLLGELEQQATLLNEEAIKGTAQVERVGEQLAHVNERVKAQTRKANAS  344

>PHALS_06478
Length=345

 Score = 195 bits (495),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 126/311 (41%), Positives = 186/311 (60%), Gaps = 24/311 (8%)

Query  1    MQVSYYESKDSYKNRNA---TPKGSFILQNVEKHEYWISRMVTGSVKERPFGFKMVGHAP  57
            +QV+YYES+ +    N     PKGSF L N+E HEY I  M      +RPFGFKMVGHAP
Sbjct  49   LQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHEYVIGVM---GAADRPFGFKMVGHAP  105

Query  58   KQGYVELDVFVDSLSNMDQWLDVINNGLKANKRMAREAFMAEMDTT-KGVLGFSFAGTT-  115
            ++G+VELDVFV++ ++ ++WL+V  N LKA +++ R+A    +    K + GFS   +T 
Sbjct  106  RKGFVELDVFVETQTDRNKWLEVACNALKAKRQLTRQAIDQSVSPNKKKLFGFSVPSSTQ  165

Query  116  ----SKQQVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQLGKVEQNLSNIES  171
                 ++Q++ L + K   + EAL++IE AK  G  AC+EIV QGE+L  +EQ+LS I+ 
Sbjct  166  PVMSPQKQMQTLATSKEGLLLEALREIEAAKLVGREACNEIVNQGEKLDVIEQDLSAIDR  225

Query  172  DLNHSEKLIKSIRHPLRYFFSKTHHHEKDAMSKNNTNHRSHHHQTGILHMRKNDGKIEHV  231
            DL+  +KL+  ++ P  +FFS          ++       H H +G     +    IE +
Sbjct  226  DLDFGDKLLHRLKSPTLHFFSDD--------TRPKVPLGDHPHHSGSTSPSRLIPAIE-I  276

Query  232  AEEICVPTNDleklamalkeleVQAQLINSEAVKSNDQITRIEGQLSGINDRIQSQTTQV  291
              +  V  +DL++LA AL ELEVQA+L+NSE+  S+ QI RIE  LS + +R++ QT Q 
Sbjct  277  TRDAGV--SDLQRLAQALGELEVQAELLNSESGHSSQQIERIEHHLSHVTERVEKQTKQA  334

Query  292  VAS-SGKKNLF  301
            VA+ S    LF
Sbjct  335  VATLSAGPRLF  345

>PPTG_17127
Length=351

 Score = 194 bits (494),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 122/311 (39%), Positives = 184/311 (59%), Gaps = 18/311 (6%)

Query  1    MQVSYYESKDSY---KNRNATPKGSFILQNVEKHEYWISRMVTGSVKERPFGFKMVGHAP  57
            +QVSYYES+ +        + PKGSF L ++E HEY +  M      ++PFGFKMVGHAP
Sbjct  49   LQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHEYVVGVM---GAADKPFGFKMVGHAP  105

Query  58   KQGYVELDVFVDSLSNMDQWLDVINNGLKANKRMAREAFMAEMDTTKGVL-GFSFA----  112
            K+GYVELDVFVD+L++ ++WL+V  N L   +++ R+A    +   K  L GFS A    
Sbjct  106  KKGYVELDVFVDTLADRNKWLEVARNALSVKRQLTRQAIDQSVSPNKKTLFGFSVALSPQ  165

Query  113  -GTTSKQQVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQLGKVEQNLSNIES  171
               + ++Q++ L   K + + EAL+++E AK  G  AC+EIV QGE+L  +EQ+LS I+ 
Sbjct  166  PAMSPQKQMQTLAKSKDELLSEALRELEAAKLVGREACNEIVIQGEKLDTIEQDLSAIDR  225

Query  172  DLNHSEKLIKSIRHPLRYFFSKTHHHEKDAMSKNNTNHRSHHHQTGILHMRKNDGKIEHV  231
            DL+  +KL++ ++ P  + FS     +    SK ++  R   HQ+G     +     +  
Sbjct  226  DLDFGDKLLRRLKSPTLHLFSDDSRPKSTGGSKGSSPQR--FHQSGGSSPSRLPPAFDTS  283

Query  232  AEEICVPTNDleklamalkeleVQAQLINSEAVKSNDQITRIEGQLSGINDRIQSQTTQV  291
            ++      +DLE+LA AL ELEVQA+++N EA  S+ QI RIE  L+ +  R++ QT Q 
Sbjct  284  SD---AGGSDLERLAQALGELEVQAEMLNGEASHSSQQIERIEHHLTNVTTRVEKQTKQA  340

Query  292  VAS-SGKKNLF  301
             A+ S    LF
Sbjct  341  SATLSAGPRLF  351

>PITG_18456
Length=351

 Score = 192 bits (489),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 123/311 (40%), Positives = 190/311 (61%), Gaps = 18/311 (6%)

Query  1    MQVSYYESKDSYK---NRNATPKGSFILQNVEKHEYWISRMVTGSVKERPFGFKMVGHAP  57
            +QVSYYES+ +      + + PKG F L ++E HEY +  M      ++PFGFKMVGHAP
Sbjct  49   LQVSYYESRAACHPPIGQPSAPKGIFYLSSIEPHEYVVGVM---GAADKPFGFKMVGHAP  105

Query  58   KQGYVELDVFVDSLSNMDQWLDVINNGLKANKRMAREAFMAEMDT-TKGVLGFSFA----  112
            K+GYVELDVFVD+L++ ++WL+V  N L A +++ R+A    +    K + GFS +    
Sbjct  106  KKGYVELDVFVDTLADRNKWLEVARNALGAKRQLTRQAIDQSVSPGKKNLFGFSVSLSPQ  165

Query  113  -GTTSKQQVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQLGKVEQNLSNIES  171
               + ++Q++ L   K + + +AL+++E AK  G  AC+EIV QGE+L  +EQ+LS I+ 
Sbjct  166  PAMSPQKQIQTLSKSKDELLSQALRELEAAKLVGREACNEIVVQGEKLDAIEQDLSAIDR  225

Query  172  DLNHSEKLIKSIRHPLRYFFSKTHHHEKDAMSKNNTNHRSHHHQTGILHMRKNDGKIEHV  231
            DL+  +KL++ ++ P  + FS     +    SK ++  RS  HQ+G     +    +E +
Sbjct  226  DLDFGDKLLRRLKSPTLHLFSDDSRPKSTGSSKGSSPQRS--HQSGGSSPTRLPPALE-I  282

Query  232  AEEICVPTNDleklamalkeleVQAQLINSEAVKSNDQITRIEGQLSGINDRIQSQTTQV  291
            + +  V  +DLE+LA AL ELEVQA+L+N EA +S+ QI RIE  L+ +  R++ QT Q 
Sbjct  283  SSDAGV--SDLERLAQALGELEVQAELLNGEAGRSSQQIERIEHHLTNVTTRVEKQTKQA  340

Query  292  VAS-SGKKNLF  301
             A+ S    LF
Sbjct  341  SATLSAGPRLF  351

>PHYCA_556162
Length=351

 Score = 191 bits (485),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 120/304 (39%), Positives = 180/304 (59%), Gaps = 19/304 (6%)

Query  1    MQVSYYESKDSY---KNRNATPKGSFILQNVEKHEYWISRMVTGSVKERPFGFKMVGHAP  57
            +QV+YYES+ +        + PKGSF L ++E HEY +  M       +PFGFKMVGHAP
Sbjct  49   LQVTYYESRAACHPTTGEASPPKGSFYLSSIEPHEYVVGVMGAAG---KPFGFKMVGHAP  105

Query  58   KQGYVELDVFVDSLSNMDQWLDVINNGLKANKRMAREAFMAEMDTTK-GVLGFSFA----  112
            K+GYVELDVFV+++ + ++WL+V  N L A +++ R+A    +   K  + GFS +    
Sbjct  106  KKGYVELDVFVETVGDRNKWLEVARNALSAKRQLTRQAIDQSVSPNKKNLFGFSVSLSPQ  165

Query  113  -GTTSKQQVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQLGKVEQNLSNIES  171
               + ++Q++ L   K D + +AL+ IE AK  G  AC+EIV QGE+L  +EQ+LS I+ 
Sbjct  166  PALSPQKQMQTLTKNKDDLLSDALRDIEAAKQIGREACNEIVIQGEKLDAIEQDLSAIDR  225

Query  172  DLNHSEKLIKSIRHPLRYFFSKTHHHEKDAMSKNNTNHRSHHHQTGILHMRKNDGKIEHV  231
            DL+  +KL++ ++ P  + FS     +  + SK N+  RS   Q+G      +  ++   
Sbjct  226  DLDFGDKLLRRLKSPTLHMFSNDSRPKSTSSSKANSPQRS--QQSG----GSSPTRLAQA  279

Query  232  AEEICVP-TNDleklamalkeleVQAQLINSEAVKSNDQITRIEGQLSGINDRIQSQTTQ  290
            AE    P  +DLE+LA AL ELE+QA+L+N EA  S  QI  IE  LS +  R++ QT Q
Sbjct  280  AESRIDPGASDLERLAQALGELELQAELLNDEAGHSTQQIQTIEHHLSTVTGRVEKQTKQ  339

Query  291  VVAS  294
              A+
Sbjct  340  ASAT  343

>PYAR_13570
Length=322

 Score = 188 bits (477),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 116/303 (38%), Positives = 187/303 (62%), Gaps = 24/303 (8%)

Query  1    MQVSYYESKDSYKNRNATPKGSFILQNVEKHEYWISRMVTGSVKERPFGFKMVGHAPKQG  60
            + VSY++SKD  +   A+PKGSF L +VEKHEY +   V G+ K +PFGFKMVGHAP++G
Sbjct  21   LCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVG--VLGAQK-KPFGFKMVGHAPRKG  77

Query  61   YVELDVFVDSLSNMDQWLDVINNGLKANKRMAREAFMAEMDTTKGVLGFSFAGTTSKQQV  120
            YVELD+FV+S  ++ +WL+V  + L A K++ R   +++  +TK + GFS A T+ ++Q+
Sbjct  78   YVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSG-LSDAASTKSLFGFSPA-TSPQKQI  135

Query  121  KELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQG---------------EQLGKVEQN  165
            ++L + K + + +A+ +IE AK  G  AC EIV QG               E+L  +E  
Sbjct  136  QKLSASKEELLKQAIDEIESAKLMGREACQEIVVQGVRKRGRLTSGFSLHAEKLDHIESE  195

Query  166  LSNIESDLNHSEKLIKSIRHPLRYFFSKTHHHEKDAMSKNNTNHRSHHHQTGILHMRKND  225
            L  +++DL++ +KL+  ++ PL Y FS +   +K++ S  ++  +S   Q+ +    + D
Sbjct  196  LQRVDADLDYGDKLLSHLKSPLLYLFS-SDARDKNSASPAHSPVKS--KQSALSSAARAD  252

Query  226  GKIEHVAEEICVPTNDleklamalkeleVQAQLINSEAVKSNDQITRIEGQLSGINDRIQ  285
               + V E      +D+E+LA+ L ELE QA L+N EAV+   Q+ R+   L+ IN+R+Q
Sbjct  253  ALGQGV-ERASGEMSDMERLALLLGELEAQATLLNEEAVRGTTQVERVGDALAHINERVQ  311

Query  286  SQT  288
            +QT
Sbjct  312  NQT  314

>PHYSO_471523
Length=348

 Score = 188 bits (477),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 118/304 (39%), Positives = 181/304 (60%), Gaps = 22/304 (7%)

Query  1    MQVSYYESKDSY---KNRNATPKGSFILQNVEKHEYWISRMVTGSVKERPFGFKMVGHAP  57
            + VSYYES+ +        + PKGSF L ++E HEY +  M      E+PFGFKMVGHAP
Sbjct  49   LNVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHEYVVGVM---GAAEKPFGFKMVGHAP  105

Query  58   KQGYVELDVFVDSLSNMDQWLDVINNGLKANKRMAREAFMAEMDTT-KGVLGFSFA----  112
            ++GYVELDVFV++L++ ++WL+V  N L A +++ R+A    +    K + GF+ +    
Sbjct  106  RKGYVELDVFVETLNDRNKWLEVARNALSAKRQLTRQAIDQSVSPNRKNLFGFNISLSPQ  165

Query  113  -GTTSKQQVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQLGKVEQNLSNIES  171
               + ++Q++ L   + + + +AL+ IE AK  G  AC+EIV QGE+L  +EQ+LS I+ 
Sbjct  166  PNMSPQKQMQTLTKSRDELLSDALRDIEAAKQVGREACNEIVTQGEKLDAIEQDLSAIDR  225

Query  172  DLNHSEKLIKSIRHPLRYFFSKTHHHEKDAMSKNNTNHRSHHHQTGILHMRKNDGKIEHV  231
            DL+  +KL++ ++ P  + FS      K + SK ++  RS   Q+G         ++   
Sbjct  226  DLDFGDKLLRRLKSPTLHLFSD-DSRPKASASKASSPQRS--QQSG------RPPRLPPA  276

Query  232  AEEIC-VPTNDleklamalkeleVQAQLINSEAVKSNDQITRIEGQLSGINDRIQSQTTQ  290
             + I     +DLE+LA AL ELEVQA+L+N EA +   QI RIE QLS +  R++ QT Q
Sbjct  277  MDSINDAGVSDLERLAQALGELEVQAELLNGEAGRGTQQIERIEHQLSNVTARVEKQTKQ  336

Query  291  VVAS  294
              A+
Sbjct  337  ASAA  340

>PHYRA_81100
Length=349

 Score = 184 bits (468),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 118/304 (39%), Positives = 179/304 (59%), Gaps = 21/304 (7%)

Query  1    MQVSYYESKDSYKNRNA---TPKGSFILQNVEKHEYWISRMVTGSVKERPFGFKMVGHAP  57
            +Q+SYYES+ +     A    PKGSF L ++E HEY +  M       +PFGFKM+GHAP
Sbjct  49   LQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAG---KPFGFKMIGHAP  105

Query  58   KQGYVELDVFVDSLSNMDQWLDVINNGLKANKRMAREAFMAEMDTT-KGVLGFSFAGT--  114
            K+GYVELDVFV++  + ++WL+V  N L A +++ R+A    + +  K + GF  + +  
Sbjct  106  KKGYVELDVFVETQGDRNKWLEVARNALSAKRQLTRQAIDQSVSSNKKNLFGFGVSLSPQ  165

Query  115  ---TSKQQVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQLGKVEQNLSNIES  171
               T ++Q++ L   K + +  AL+ IE AK  G  AC+EIV QGE+L  +EQ+L  I+ 
Sbjct  166  PLMTPQKQMQTLTQNKDELLSGALRDIEAAKLVGREACNEIVIQGEKLDAIEQDLGAIDR  225

Query  172  DLNHSEKLIKSIRHPLRYFFSKTHHHEKDAMSKNNTNHRSHHHQTGILHMRKNDGKIEHV  231
            DL+  +KL++ ++ P  + FS      K   SK ++  RS   Q+G      +  ++   
Sbjct  226  DLDFGDKLLRRLKSPTLHLFSD-DSRPKSTASKGHSPQRS--QQSG-----GSPSRLPPA  277

Query  232  AEEIC-VPTNDleklamalkeleVQAQLINSEAVKSNDQITRIEGQLSGINDRIQSQTTQ  290
             E I     +DLE+LA AL ELEVQA+++N EA +S  QI R+E QLS +  R++ QT Q
Sbjct  278  METINDAGVSDLERLAQALGELEVQAEILNGEAGRSTQQIERVEHQLSNVTARVEKQTKQ  337

Query  291  VVAS  294
              A+
Sbjct  338  ASAT  341

>PHYKE_8393
Length=326

 Score = 183 bits (465),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 114/290 (39%), Positives = 173/290 (60%), Gaps = 17/290 (6%)

Query  20   KGSFILQNVEKHEYWISRMVTGSVKERPFGFKMVGHAPKQGYVELDVFVDSLSNMDQWLD  79
            KGSF L N+  HEY +  M      ++PFGFKMVGHAP++GYVELDVFV++LS+ ++WL+
Sbjct  46   KGSFYLSNIAPHEYVVGVM---GAADKPFGFKMVGHAPRKGYVELDVFVETLSDRNKWLE  102

Query  80   VINNGLKANKRMAREAFMAEMDTT-KGVLGFSFAGT-----TSKQQVKELKSRKSDYIHE  133
            V  N L A +++ R+A    +  T KG+ GF  + +       ++Q++ L   K + + E
Sbjct  103  VARNALGAKRQIMRQAIDQSVSPTKKGMFGFGLSLSPQPLVPPQKQIQALTHNKEELLAE  162

Query  134  ALQQIEMAKSAGSAACDEIVAQGEQLGKVEQNLSNIESDLNHSEKLIKSIRHPLRYFFSK  193
            AL+++E AK  G  AC+EIV QGE+L  VE +L  I+ DL+  +KL++ +++P  + FS 
Sbjct  163  ALRELEAAKMVGREACNEIVVQGEKLDSVEHDLHAIDRDLDFGDKLLRRLKNPTLHLFSD  222

Query  194  THHHEKDAMSKNNTNHRSHHHQ-TGILHMRKNDGKIEHVAEEICVPTNDleklamalkel  252
                +  A S  ++  R+H    +  +H+  + G             +DLE+LA AL EL
Sbjct  223  DTRPKSHANSNESSPQRTHQSAGSNPIHLPFSMGSANDAD------ASDLERLAHALGEL  276

Query  253  eVQAQLINSEAVKSNDQITRIEGQLSGINDRIQSQTTQVVAS-SGKKNLF  301
            E+QA+L+N EA +S  QI RIE QLS +  R++ QT Q  A+ S    LF
Sbjct  277  ELQAELLNGEAGRSTQQIARIEQQLSNVTARVEKQTKQASATLSAGPRLF  326

>PYVX_18171
Length=294

 Score = 175 bits (443),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 105/298 (35%), Positives = 165/298 (55%), Gaps = 53/298 (18%)

Query  1    MQVSYYESKDSYKNRNATPKGSFILQNVEKHEYWISRMVTGSVKERPFGFKMVGHAPKQG  60
            ++V+Y+ESK +++N  A  KG F L +++KH Y    M     +E+PFGFKMVGHAPK+G
Sbjct  40   LRVAYFESKTAFQN-GAASKGEFYLSSIDKHAYVAGGMGAVGAQEKPFGFKMVGHAPKKG  98

Query  61   YVELDVFVDSLSNMDQWLDVINNGLKANKRMAREAF--MAEMDTTKGVLGFSFAGTTSKQ  118
            Y ELD+FV++L+++ +WL+V +N L++   M+R+A        TTK + GFS   T+ +Q
Sbjct  99   YTELDIFVETLADLTKWLEVAHNALESAAAMSRKAAGDGGGSATTKSLFGFSTT-TSPQQ  157

Query  119  QVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQLGKVEQNLSNIESDLNHSEK  178
            Q+K +   K + + +AL+++E AK  G  AC E+V QGE+L  +E NL  IESDL++ +K
Sbjct  158  QLKAMSVSKDELLKDALRELEGAKLIGREACTEMVVQGEKLDGIEANLGGIESDLDYGDK  217

Query  179  LIKSIRHPLRYFFSKTHHHEKDAMSKNNTNHRSHHHQTGILHMRKNDGKIEHVAEEICVP  238
            L++ ++ P                               +LH+         +A ++  P
Sbjct  218  LLRRLKSP-------------------------------VLHL---------LARDLRRP  237

Query  239  TNDleklamalkeleVQAQLINSEAVKSNDQITRIEGQLSGINDRIQSQTTQVVASSG  296
             +  + L+ A        QL       S  QI RIE +L+ +NDR+Q QT Q  A+SG
Sbjct  238  PSPTKTLSNAGDGRAALEQL-------STQQIARIEERLTTVNDRVQRQTKQ--ATSG  286

>SDRG_01781
Length=335

 Score = 124 bits (310),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 96/308 (31%), Positives = 160/308 (52%), Gaps = 19/308 (6%)

Query  1    MQVSYYESKDSYKNRNATPKGSFILQNVEKHEYWISRMVTGSVKERPFGFKMVGHAPKQG  60
            ++VSY++SK  YK+     KGSFIL  +EKH+Y       G VK  P+GFK+VGHAP  G
Sbjct  39   LKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSDE---GGGVK--PYGFKLVGHAPGHG  93

Query  61   YVELDVFVDSLSNMDQWLDVINNGLKANKRMAREAFMAEMDTTKGVLGFSFAG---TTSK  117
            Y E  V+V++  +  QWL+V +N L   K +A +A   +  T   +LG   A    T++ 
Sbjct  94   YKEFCVYVETAKDQTQWLEVAHNAL--GKNVAPQASADQRAT--ALLGHRAASGFLTSAP  149

Query  118  QQVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQLGKVEQNLSNIESDLNHSE  177
             Q++ +   K + + +A+  +E A++ G     E+    E L   E N+  + ++L+  +
Sbjct  150  VQLRNVNKTKEELLRKAIVTLEHARTVGDNTVSEMGHNAEMLDIAEANMDYVGTELDRGD  209

Query  178  KLIKSIRHPLRYFFSKTHHHEKDAMSKNNTNHRSHHHQTGILHMRKNDGKIEHVAEEICV  237
             +IK +  P  Y+FS +   +K A S  + + RSH  QT +      + K      +   
Sbjct  210  NIIKKMTSPFFYYFSSSKSKKKGAGSPKSKSARSHLPQTPM--NSPTNKKPSGPTSKTGG  267

Query  238  PTNDl-----eklamalkeleVQAQLINSEAVKSNDQITRIEGQLSGINDRIQSQTTQVV  292
            PT D      ++L+  L  LEV A  I++E  ++ +QI RI+ ++   ++R+  Q+ +V 
Sbjct  268  PTTDAGDDELDQLSKILASLEVHANTISTEVERTTEQIDRIQKKMVEADERVVEQSAKVH  327

Query  293  ASSGKKNL  300
            A   K  L
Sbjct  328  AIQQKNKL  335

>SPRG_06336
Length=335

 Score = 123 bits (309),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 92/305 (30%), Positives = 154/305 (50%), Gaps = 13/305 (4%)

Query  1    MQVSYYESKDSYKNRNATPKGSFILQNVEKHEYWISRMVTGSVKERPFGFKMVGHAPKQG  60
            ++VSYY+SK  YK+     KGSFIL  +EKH+Y       G VK  P+GFK+VGHAP  G
Sbjct  39   LKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSDE---GGGVK--PYGFKLVGHAPGHG  93

Query  61   YVELDVFVDSLSNMDQWLDVINNGLKAN--KRMAREAFMAEMDTTKGVLGFSFAGTTSKQ  118
            Y E  V+V++  +  QWL+V +N L  N   + + +   + +   +   GF    T++  
Sbjct  94   YKEFCVYVETAKDQTQWLEVAHNALGKNVTPQASVDQRASALLGHRAPSGFL---TSAPV  150

Query  119  QVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQLGKVEQNLSNIESDLNHSEK  178
            Q++ +   K + + +A+  +E A++ G     E+    E L   E N+  +E++L+  + 
Sbjct  151  QLRNVNKTKEELLRKAIVTLEHARTVGDNTVSEMGHNAEMLDIAEANMDYVETELDRGDN  210

Query  179  LIKSIRHPLRYFFSKTHHHEKDAMSKNNTNHRSHHHQTGI--LHMRKNDGKIEHVAEEIC  236
            +IK +  P  Y+FS +   +K   S  + + RSH  QT +     +K+ G          
Sbjct  211  IIKKMTSPFFYYFSSSKSKKKGTGSPKSKSARSHQPQTPMNSPTHKKSSGPASKAGGATT  270

Query  237  VPTNDleklama-lkeleVQAQLINSEAVKSNDQITRIEGQLSGINDRIQSQTTQVVASS  295
               +D        L  LEV A  I++E  ++ +QI RI+ ++   ++RI  Q+ +V A  
Sbjct  271  DAGDDELDQLSKILASLEVHANTISTEVERTTEQIDRIQKKMVEADERIVEQSAKVHAIQ  330

Query  296  GKKNL  300
             K  L
Sbjct  331  EKNKL  335

>H310_09223
Length=333

 Score = 103 bits (258),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 66/194 (34%), Positives = 102/194 (53%), Gaps = 12/194 (6%)

Query  1    MQVSYYESKDSYKNRNATPKGSFILQNVEKHEYWISRMVTGSVKERPFGFKMVGHAPKQG  60
            + V+YY+SK+ YK+ N  PKGSF+L   EK +        GSVK  PFGFK +GH P QG
Sbjct  39   LLVAYYDSKEIYKS-NGPPKGSFVLSECEKQDLSDE---GGSVK--PFGFKFIGHCPGQG  92

Query  61   YVELDVFVDSLSNMDQWLDVINNGLKANKRMAREAFMAEMDTTKGVLGFSFAG--TTSKQ  118
            Y E  VFV++  +  +WL+V +N L     +   +    M++  G      AG   + + 
Sbjct  93   YKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSPS----MESHGGAGHKESAGLMISLEA  148

Query  119  QVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQLGKVEQNLSNIESDLNHSEK  178
            Q+K +K    + + +A+   + A   G A  DE+  Q E L   E  +  +   ++ +E 
Sbjct  149  QIKNVKKTSHELLQQAINDAKEADRIGDATVDEMAYQEEVLNDAENTVDAMGKQMDRAED  208

Query  179  LIKSIRHPLRYFFS  192
            L KSI+HP+ Y F+
Sbjct  209  LGKSIKHPILYKFT  222

>H257_06294
Length=358

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 81/320 (25%), Positives = 147/320 (46%), Gaps = 38/320 (12%)

Query  3    VSYYESKDSYKNRNATPKGSFILQNVEKHEYWISRMVTGSVKERPFGFKMVGHAPKQGYV  62
            VSYY+SK+ Y ++   PKGSF+L   EK +     +       +PFGFK +GH P QGY 
Sbjct  41   VSYYDSKEIYTSK-GHPKGSFVLSECEKQD-----LSDEGASVKPFGFKFIGHCPGQGYK  94

Query  63   ELDVFVDSLSNMDQWLDVINNGLKAN----KRMAR--EAFMAEMDTTKGV----------  106
            E  V+V+S  +  +WL+V +N L  N    K M++  E     +     V          
Sbjct  95   EYSVYVESQIDQTKWLNVAHNALGKNSSPQKSMSQRIEEITGPLLPCASVQLNCPRRDMI  154

Query  107  ----LGF-SFAGT--TSKQQVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQL  159
                LG    AG   + + Q+K +K    + + +A+   + A   G A  +E+V Q + L
Sbjct  155  HITTLGHKESAGLMQSLEAQMKNVKKTSQELLQQAINDAKEADRIGDATVNEMVYQEDVL  214

Query  160  GKVEQNLSNIESDLNHSEKLIKSIRHPLRY----FFSKTHHHEKDAM-SKNNTNHRSHHH  214
               E  +  +   ++H+E L +S++HP+ Y     F++   ++K    SK          
Sbjct  215  NDAEGTVDTMGRQMDHAEDLGRSLKHPILYKLTHLFTRKKSYKKGGRGSKTRKGGAKASR  274

Query  215  QTGILHMRKNDGKIEHVAEEICVPTNDleklamalkeleVQ-AQLINSEAVKSNDQITRI  273
             + +  ++    + +H A +   P +D       +     Q A  I+    ++ +Q+ RI
Sbjct  275  SSRVSRVKLQPPQQQHAAAQ---PEDDQLDQLSKILAKLGQTADTISDITARTTEQVDRI  331

Query  274  EGQLSGINDRIQSQTTQVVA  293
            + +++ ++DR++ +   V A
Sbjct  332  DQKVTSVDDRVKKEAKLVQA  351

>HYAP_07386
Length=461

 Score = 32.7 bits (73),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 27/113 (24%), Positives = 59/113 (52%), Gaps = 15/113 (13%)

Query  1    MQVSYYESKDSYKNRNATPK--GSFILQNVEKHEY--WISRMVTGSVKERPFGFKMVGHA  56
            + + Y+E  D   ++  +P+  G F++ +V++     W+ R+    +++      M GH 
Sbjct  297  LTIVYFEQYDVDGDKALSPREFGMFLVSHVDQRHIGKWVERV--DKLRD------MKGHI  348

Query  57   PKQGYVELDVFVDSLSNMDQWLDVIN--NGL-KANKRMAREAFMAEMDTTKGV  106
             +Q Y++ +VF++ L  ++  ++++   +G+ K   R A +A M E   TK V
Sbjct  349  TEQEYMDFNVFLEHLDKLEVAINLVMQVHGVDKVQFRRAAKAAMCENKHTKPV  401

>PHYSO_554279
Length=833

 Score = 32.7 bits (73),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 11/36 (31%), Positives = 21/36 (58%), Gaps = 0/36 (0%)

Query  194  THHHEKDAMSKNNTNHRSHHHQTGILHMRKNDGKIE  229
            +HHH    + + N  H++  H++  L  R++ GK+E
Sbjct  3    SHHHRSGPLKQKNKKHKTGRHESKTLLARRSGGKVE  38

>PITG_03156
Length=829

 Score = 31.6 bits (70),  Expect = 6.8, Method: Compositional matrix adjust.
 Identities = 11/36 (31%), Positives = 20/36 (56%), Gaps = 0/36 (0%)

Query  194  THHHEKDAMSKNNTNHRSHHHQTGILHMRKNDGKIE  229
            +HHH    + + N  H++  H +  L  R++ GK+E
Sbjct  3    SHHHRSGPLKQTNKKHKTGRHDSKTLLARRSGGKVE  38

>CCI39615
Length=361

 Score = 31.2 bits (69),  Expect = 7.8, Method: Compositional matrix adjust.
 Identities = 22/89 (25%), Positives = 37/89 (42%), Gaps = 18/89 (20%)

Query  123  LKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQLGKVEQNLSN--------------  168
             K+   DY ++    IE+ +      C+ +V   + LG    NLS+              
Sbjct  158  CKNEPVDYCNKCRDYIELRRPQSGRDCNSVVGYNKGLGVHVMNLSDRCFEEALPMRAAYG  217

Query  169  -IESDLNHSEKLIKSIRHPLR---YFFSK  193
                +L HS K++  ++HPLR   +F  K
Sbjct  218  TALHELGHSLKMLHELQHPLRTVLFFLDK  246

>PPTG_14464
Length=826

 Score = 31.6 bits (70),  Expect = 8.3, Method: Compositional matrix adjust.
 Identities = 11/36 (31%), Positives = 20/36 (56%), Gaps = 0/36 (0%)

Query  194  THHHEKDAMSKNNTNHRSHHHQTGILHMRKNDGKIE  229
            +HHH    + + N  H++  H +  L  R++ GK+E
Sbjct  3    SHHHRSGPLKQKNKKHKTGRHDSKTLLARRSGGKVE  38

>SPRG_05711
Length=538

 Score = 31.2 bits (69),  Expect = 8.5, Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 20/38 (53%), Gaps = 0/38 (0%)

Query  194  THHHEKDAMSKNNTNHRSHHHQTGILHMRKNDGKIEHV  231
            +HHH    + + N  H+   H T  L  +K+ GK+E V
Sbjct  2    SHHHRSGPLKQKNKKHKVGKHDTKTLLAKKSGGKVERV  39

>SDRG_10289
Length=758

 Score = 31.2 bits (69),  Expect = 9.2, Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 20/38 (53%), Gaps = 0/38 (0%)

Query  194  THHHEKDAMSKNNTNHRSHHHQTGILHMRKNDGKIEHV  231
            +HHH    + + N  H+   H T  L  +K+ GK+E V
Sbjct  2    SHHHRSGPLKQKNKKHKVGKHDTKTLLAKKSGGKVERV  39

>PHYKE_7847
Length=836

 Score = 31.2 bits (69),  Expect = 9.7, Method: Compositional matrix adjust.
 Identities = 11/36 (31%), Positives = 20/36 (56%), Gaps = 0/36 (0%)

Query  194  THHHEKDAMSKNNTNHRSHHHQTGILHMRKNDGKIE  229
            +HHH    + + N  H++  H++  L  ++  GKIE
Sbjct  3    SHHHRSGPLKQKNKKHKTGRHESKTLLAKRQGGKIE  38

Lambda      K        H        a         alpha
   0.313    0.127    0.356    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 18381146076

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40