Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
CCI45122147571105110559400.0
CCA18898147571147112338580.0
PYIR_13453147571186116718720.0
PYIW_187931475799792217320.0
PYU1_G0017341475780075017120.0
PYAP_17746147571169116616470.0
PHYRA_95901147571075112215480.0
SDRG_01764147571092113215170.0
PPTG_17128147571177118414750.0
PHYSO_32115714757118076414580.0
SPRG_063541475788490114280.0
PHALS_06477147571166115514281e-177
H310_09212147571113115014188e-177
H257_06305147571099113614091e-175
PITG_1845714757117076913661e-168
PHYCA_344751475769273212773e-161
PYAR_13581147577302935684e-60
PHYKE_8394147574282194866e-52
PYAR_1738310613178449960.034
PHYKE_28442856150454950.045
PYIW_2304514367178937900.18
HYAP_03074624966112880.28
CCA232032450169569870.36
PITG_1351310976144121800.63
PYVX_2188410613144763850.71
PYIR_1887410613192062850.72
PYU1_G01223714367148140840.81
PYAP_1444114367127174841.0
SDRG_125231299441200114831.0
PYAP_14743252294764831.2
PYIR_202022856155538831.2
PYVX_167592856155539831.2
PITG_091197566446127811.5
SPRG_209881344241141113821.5
PYIR_2122814367218540812.1
PITG_1306510613188334802.6
CCI4919124501433116802.8
PHYCA_5273894473836761783.0
PPTG_020171209316974763.1
PHYRA_8453414050136844793.1
SPRG_144081299441205142793.8
PHALS_0940312335131364784.2
PYIR_1490213860136468775.3
PHYSO_25813695117286171755.9
PYAR_1363070846764766.7
PYAR_17112285767238767.2
PHYCA_539991405094744767.3
PYU1_G00032210613191239767.5
HYAP_06762127211736101768.1
SDRG_038484789178858768.3
PHALS_1217010613181634768.8
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= CCI45122

Length=1105
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

CCI45122                                                              2292       0.0   
CCA18898                                                              1490       0.0   
PYIR_13453                                                            725        0.0   
PYIW_18793                                                            671        0.0   
PYU1_G001734                                                          664        0.0   
PYAP_17746                                                            639        0.0   
PHYRA_95901                                                           600        0.0   
SDRG_01764                                                            588        0.0   
PPTG_17128                                                            572        0.0   
PHYSO_321157                                                          566        0.0   
SPRG_06354                                                            554        0.0   
PHALS_06477                                                           554        1e-177
H310_09212                                                            550        8e-177
H257_06305                                                            547        1e-175
PITG_18457                                                            530        1e-168
PHYCA_34475                                                           496        3e-161
PYAR_13581                                                            223        4e-60 
PHYKE_8394                                                            191        6e-52 
PYAR_17383                                                            41.6       0.034 
PHYKE_2844                                                            41.2       0.045 
PYIW_23045                                                            39.3       0.18  
HYAP_03074                                                            38.5       0.28  
CCA23203                                                              38.1       0.36  
PITG_13513                                                            35.4       0.63  
PYVX_21884                                                            37.4       0.71  
PYIR_18874                                                            37.4       0.72  
PYU1_G012237                                                          37.0       0.81  
PYAP_14441                                                            37.0       1.0   
SDRG_12523                                                            36.6       1.0   
PYAP_14743                                                            36.6       1.2   
PYIR_20202                                                            36.6       1.2   
PYVX_16759                                                            36.6       1.2   
PITG_09119                                                            35.8       1.5   
SPRG_20988                                                            36.2       1.5   
PYIR_21228                                                            35.8       2.1   
PITG_13065                                                            35.4       2.6   
CCI49191                                                              35.4       2.8   
PHYCA_527389                                                          34.7       3.0   
PPTG_02017                                                            33.9       3.1   
PHYRA_84534                                                           35.0       3.1   
SPRG_14408                                                            35.0       3.8   
PHALS_09403                                                           34.7       4.2   
PYIR_14902                                                            34.3       5.3   
PHYSO_258136                                                          33.5       5.9   
PYAR_13630                                                            33.9       6.7   
PYAR_17112                                                            33.9       7.2   
PHYCA_53999                                                           33.9       7.3   
PYU1_G000322                                                          33.9       7.5   
HYAP_06762                                                            33.9       8.1   
SDRG_03848                                                            33.9       8.3   
PHALS_12170                                                           33.9       8.8   

>CCI45122
Length=1105

 Score = 2292 bits (5940),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1105/1105 (100%), Positives = 1105/1105 (100%), Gaps = 0/1105 (0%)

Query  1     MDHLEQKHHTEDIGRILLQTQQELREIRAEISGRKQTTETYIADATPFEDYPAPIVSVNP  60
             MDHLEQKHHTEDIGRILLQTQQELREIRAEISGRKQTTETYIADATPFEDYPAPIVSVNP
Sbjct  1     MDHLEQKHHTEDIGRILLQTQQELREIRAEISGRKQTTETYIADATPFEDYPAPIVSVNP  60

Query  61    SKDLETLQNILDRAEREIQAKVDLLYKGVAHYGRKTQTGLPFVASPPRQIPSSANSSLER  120
             SKDLETLQNILDRAEREIQAKVDLLYKGVAHYGRKTQTGLPFVASPPRQIPSSANSSLER
Sbjct  61    SKDLETLQNILDRAEREIQAKVDLLYKGVAHYGRKTQTGLPFVASPPRQIPSSANSSLER  120

Query  121   KSSFQELSVDLIRKQLHSVKEKYKCLPTKQHSELISPKRPTQGLLTSKPSKKRYNASLRS  180
             KSSFQELSVDLIRKQLHSVKEKYKCLPTKQHSELISPKRPTQGLLTSKPSKKRYNASLRS
Sbjct  121   KSSFQELSVDLIRKQLHSVKEKYKCLPTKQHSELISPKRPTQGLLTSKPSKKRYNASLRS  180

Query  181   LPTVQRGEAGDFSSASRDQIGEASNTLSVNDRVLMQRTAHLHNRMEEPIKTTPYTTAISH  240
             LPTVQRGEAGDFSSASRDQIGEASNTLSVNDRVLMQRTAHLHNRMEEPIKTTPYTTAISH
Sbjct  181   LPTVQRGEAGDFSSASRDQIGEASNTLSVNDRVLMQRTAHLHNRMEEPIKTTPYTTAISH  240

Query  241   NMMSVKFDFMTPTSQSPCGKMQTQEKIVLTNDLQSKQRNGALLANQISLSPGGGCREDDS  300
             NMMSVKFDFMTPTSQSPCGKMQTQEKIVLTNDLQSKQRNGALLANQISLSPGGGCREDDS
Sbjct  241   NMMSVKFDFMTPTSQSPCGKMQTQEKIVLTNDLQSKQRNGALLANQISLSPGGGCREDDS  300

Query  301   RFSPGRDPSKKIGIIKAITPIFLNDVTKSLVGEISKTYDFVIHQGIIDRKRPEFEAFQRI  360
             RFSPGRDPSKKIGIIKAITPIFLNDVTKSLVGEISKTYDFVIHQGIIDRKRPEFEAFQRI
Sbjct  301   RFSPGRDPSKKIGIIKAITPIFLNDVTKSLVGEISKTYDFVIHQGIIDRKRPEFEAFQRI  360

Query  361   ANPIWSSVDVVLEALARILSLYFIPIAYINGQRILTLAQADNVPLTTKDLISCIRNEDEV  420
             ANPIWSSVDVVLEALARILSLYFIPIAYINGQRILTLAQADNVPLTTKDLISCIRNEDEV
Sbjct  361   ANPIWSSVDVVLEALARILSLYFIPIAYINGQRILTLAQADNVPLTTKDLISCIRNEDEV  420

Query  421   KMLLSKPGQRFQGAERTKRATIALQSFIRMAMHRKRFLVMRYKYWKVTAIQRNWRRFSAH  480
             KMLLSKPGQRFQGAERTKRATIALQSFIRMAMHRKRFLVMRYKYWKVTAIQRNWRRFSAH
Sbjct  421   KMLLSKPGQRFQGAERTKRATIALQSFIRMAMHRKRFLVMRYKYWKVTAIQRNWRRFSAH  480

Query  481   KATKLKIEAKREHQEMVFTDSMRSFCSNWDKIRMQRRTIIHIPSISIDSRQRMKTEQFSI  540
             KATKLKIEAKREHQEMVFTDSMRSFCSNWDKIRMQRRTIIHIPSISIDSRQRMKTEQFSI
Sbjct  481   KATKLKIEAKREHQEMVFTDSMRSFCSNWDKIRMQRRTIIHIPSISIDSRQRMKTEQFSI  540

Query  541   QQNLQLQRLCAVIDENVELIYICPFELTDDIVQYYMKLLQLGGISDAAARIKLICPENAS  600
             QQNLQLQRLCAVIDENVELIYICPFELTDDIVQYYMKLLQLGGISDAAARIKLICPENAS
Sbjct  541   QQNLQLQRLCAVIDENVELIYICPFELTDDIVQYYMKLLQLGGISDAAARIKLICPENAS  600

Query  601   RFPSHFSLSSVVLYSPRTLNRLSRCIRGRNAYMVPGFPGLEDKRVATILGVPILGLDSTK  660
             RFPSHFSLSSVVLYSPRTLNRLSRCIRGRNAYMVPGFPGLEDKRVATILGVPILGLDSTK
Sbjct  601   RFPSHFSLSSVVLYSPRTLNRLSRCIRGRNAYMVPGFPGLEDKRVATILGVPILGLDSTK  660

Query  661   SLQATTYSGSKRYFRKANVNTLPACIDLYDENELIFSLAKLVASHPHQLSVVLRLDYDPF  720
             SLQATTYSGSKRYFRKANVNTLPACIDLYDENELIFSLAKLVASHPHQLSVVLRLDYDPF
Sbjct  661   SLQATTYSGSKRYFRKANVNTLPACIDLYDENELIFSLAKLVASHPHQLSVVLRLDYDPF  720

Query  721   GTGIALMDISRLQSVKEVRLRTKTLESWLQPPIQAKLIRNLVLEMQNNISSFIFVVHPEI  780
             GTGIALMDISRLQSVKEVRLRTKTLESWLQPPIQAKLIRNLVLEMQNNISSFIFVVHPEI
Sbjct  721   GTGIALMDISRLQSVKEVRLRTKTLESWLQPPIQAKLIRNLVLEMQNNISSFIFVVHPEI  780

Query  781   FPSSKSFLQAIRIYGVIIELSPKKRQGHVRANLFIEPSRRVCVSSTHEIHSLETDTKIDD  840
             FPSSKSFLQAIRIYGVIIELSPKKRQGHVRANLFIEPSRRVCVSSTHEIHSLETDTKIDD
Sbjct  781   FPSSKSFLQAIRIYGVIIELSPKKRQGHVRANLFIEPSRRVCVSSTHEIHSLETDTKIDD  840

Query  841   RVRKFGLDKASAAKMRTFGVTFPQTLIDHEVLKDASLAIGQALAKDGICGYISVDFVVCL  900
             RVRKFGLDKASAAKMRTFGVTFPQTLIDHEVLKDASLAIGQALAKDGICGYISVDFVVCL
Sbjct  841   RVRKFGLDKASAAKMRTFGVTFPQTLIDHEVLKDASLAIGQALAKDGICGYISVDFVVCL  900

Query  901   DDQTQKKTLYATGLQPFLTNTAASFALFQLLSRGGSYNSMTGSLHLPQEVPLVGVQNDPP  960
             DDQTQKKTLYATGLQPFLTNTAASFALFQLLSRGGSYNSMTGSLHLPQEVPLVGVQNDPP
Sbjct  901   DDQTQKKTLYATGLQPFLTNTAASFALFQLLSRGGSYNSMTGSLHLPQEVPLVGVQNDPP  960

Query  961   SSLSATDLMIREARLSGIVSNVLPPTPTRTYALIEYVCNPCVATLSCSSFFQHCRSRGVY  1020
             SSLSATDLMIREARLSGIVSNVLPPTPTRTYALIEYVCNPCVATLSCSSFFQHCRSRGVY
Sbjct  961   SSLSATDLMIREARLSGIVSNVLPPTPTRTYALIEYVCNPCVATLSCSSFFQHCRSRGVY  1020

Query  1021  FDTERDSGTVFLLADSLTAGVFGIMCISDTRKNALSNCRAAMEAIAGVAGTKMSVSKSSD  1080
             FDTERDSGTVFLLADSLTAGVFGIMCISDTRKNALSNCRAAMEAIAGVAGTKMSVSKSSD
Sbjct  1021  FDTERDSGTVFLLADSLTAGVFGIMCISDTRKNALSNCRAAMEAIAGVAGTKMSVSKSSD  1080

Query  1081  GMNELIRTDRMRDQFSEILRALHVM  1105
             GMNELIRTDRMRDQFSEILRALHVM
Sbjct  1081  GMNELIRTDRMRDQFSEILRALHVM  1105

>CCA18898
Length=1147

 Score = 1490 bits (3858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 749/1123 (67%), Positives = 887/1123 (79%), Gaps = 19/1123 (2%)

Query  1     MDHLEQKHHTEDIGRILLQTQQELREIRAEISGRKQTTETYIADATPFEDYPAPIVSVNP  60
             M+ +EQK+H ED+GRILLQTQQELR+IRAEIS RKQ   +++ DA P  +  A + + N 
Sbjct  26    MEQVEQKYHKEDVGRILLQTQQELRDIRAEISARKQAGISHVVDAHPHREDHASLANENQ  85

Query  61    SKDLETLQNILDRAEREIQAKVDLLYKGVAHYGRKTQTGLPFVASPPRQIPSSANSSLER  120
             SKDLETL +ILDRAEREIQAKVDL+++G A++G+  QTGLP V SPPRQ+ ++  S  ++
Sbjct  86    SKDLETLHDILDRAEREIQAKVDLMFRGAANFGQMMQTGLPAVTSPPRQVSTTTKSLSDQ  145

Query  121   KSSFQELSVDLIRKQLHSVKEKYKCLPTKQHSELISPKRPTQGLLTSKPSKKRYNASLRS  180
               S QE  VD  RKQL + K+ YKC P+ Q SELISPKRPTQGLLTSK SKKRYN SL+S
Sbjct  146   IFSTQESKVDGTRKQLTAAKDDYKCSPSMQQSELISPKRPTQGLLTSKASKKRYNVSLKS  205

Query  181   LPTVQRGEAGDFSSASRDQIGEASNTL---------------SVNDRVLMQRTAHLHNRM  225
             LP VQ G A   SSA  DQ  E ++ L               S  DR LMQRTA LHNR+
Sbjct  206   LPAVQNGHASTSSSALADQSSETAHFLNSRHGSPLNSIEISQSTYDRALMQRTAQLHNRL  265

Query  226   EEPIKTTPYTTAISHNMMSVKFDFMTPTS-QSPCGKMQTQEKIVLTNDLQSKQRNGALLA  284
             EEPI+TTP T+ ISH++ S+KFDF  PT  QSP GK+Q  E++   ND    + N  L  
Sbjct  266   EEPIRTTPCTSTISHDITSLKFDFSAPTILQSP-GKVQIHEQVTHFNDQALGECNCRLST  324

Query  285   NQISLSPGGGCREDDSRFSPGRDPSKKIGIIKAITPIFLNDVTKSLVGEISKTYDFVIHQ  344
             NQ+S++   G RED+S+ SP RD SKK+GI K I    +N  T+S  G  S  +DF IHQ
Sbjct  325   NQVSMALINGFREDNSKLSPSRDHSKKMGIPKVIKSTKINTDTESHKGNNSSNHDFTIHQ  384

Query  345   GIIDRKRPEFEAFQRIANPIWSSVDVVLEALARILSLYFIPIAYINGQRILTLAQADNVP  404
             GI+DR+R +F++FQ  AN +W++V+ V+  L R+LS+YFIPIA+INGQRILTL+Q +N  
Sbjct  385   GIVDRRRSDFKSFQCFANDVWNNVEEVVTTLERLLSVYFIPIAHINGQRILTLSQENNKI  444

Query  405   LTTKDLISCIRNEDEVKMLLSKPGQRFQGAERTKRATIALQSFIRMAMHRKRFLVMRYKY  464
             +T +DL+SC++NE EV+MLL KPGQRFQG E+  RA +A+QSF+RM   R+ +L+M   +
Sbjct  445   ITNRDLLSCVKNEHEVRMLLLKPGQRFQGVEKCTRAAMAVQSFMRMITFRRTYLLMISNH  504

Query  465   WKVTAIQRNWRRFSAHKATKLKIEAKREHQEMVFTDSMRSFCSNWDKIRMQRRTIIHIPS  524
              KV AIQ+NWRR++A+KATK+KIEA RE Q++VF + MRSFCSNWDKIR QRRT++HIPS
Sbjct  505   RKVRAIQQNWRRYAAYKATKIKIEAIRERQDIVFNEIMRSFCSNWDKIRTQRRTVMHIPS  564

Query  525   ISIDSRQRMKTEQFSIQQNLQLQRLCAVIDENVELIYICPFELTDDIVQYYMKLLQLGGI  584
             ISID R RMKTEQFSIQQNLQLQRLCA+IDENVELIYICPFELTDDIVQYYMKLLQL GI
Sbjct  565   ISIDPRHRMKTEQFSIQQNLQLQRLCALIDENVELIYICPFELTDDIVQYYMKLLQLAGI  624

Query  585   SDAAARIKLICPENASRFPSHFSLSSVVLYSPRTLNRLSRCIRGRNAYMVPGFPGLEDKR  644
             SDAAARIKL+CPENASRFPSHFSLS+VVL SP T+ RLSR IRGRNAY+VPGFPG EDKR
Sbjct  625   SDAAARIKLMCPENASRFPSHFSLSNVVLCSPHTMKRLSRYIRGRNAYLVPGFPGTEDKR  684

Query  645   VATILGVPILGLDSTKSLQATTYSGSKRYFRKANVNTLPACIDLYDENELIFSLAKLVAS  704
             +A +L +PILGLD  K  Q TT+SG KR F+K N NTLP  IDLYDENELIFSLAKL+A+
Sbjct  685   LAALLRIPILGLDPAKFFQMTTHSGIKRCFKKTNANTLPGSIDLYDENELIFSLAKLIAA  744

Query  705   HPHQLSVVLRLDYDPFGTGIALMDISRLQSVKEVRLRTKTLESWLQPPIQAKLIRNLVLE  764
             +PHQ S+VL+LDYDPF TG AL+DIS+LQS++ +RLRT+TL+ W QPPIQ KLIRN+V E
Sbjct  745   NPHQSSMVLKLDYDPFRTGTALVDISQLQSIQVLRLRTRTLDYWRQPPIQNKLIRNIVQE  804

Query  765   MQNNISSFIFVVHPEIFPSSKSFLQAIRIYGVIIELSPKKRQGHVRANLFIEPSRRVCVS  824
             MQ+ ISS +F+V+PE++PS KSFLQAIR+YGV+IE+ PK RQG+VRANLFIEPSRRVC+S
Sbjct  805   MQSIISSLVFMVNPEVYPSWKSFLQAIRMYGVVIEVCPKNRQGYVRANLFIEPSRRVCIS  864

Query  825   STHEIHSLETDTKIDDRVRKFGLDKASAAKMRTFGVTFPQTLIDHEVLKDASLAIGQALA  884
             ST E  S E   + DDR RK   DKA AAKMRT G TFPQTLIDHEVLK ASL IGQALA
Sbjct  865   STQEFLSFENIHENDDRARKVVFDKAFAAKMRTIGFTFPQTLIDHEVLKSASLVIGQALA  924

Query  885   KDGICGYISVDFVVCLDDQTQKKTLYATGLQPFLTNTAASFALFQLLSRGGSYNSMTGSL  944
             KDGICGYISVDF+V LDDQTQ K LYA  LQPFLTN+AASF+LFQ LSRGG YNS TG  
Sbjct  925   KDGICGYISVDFLVILDDQTQNKILYAMALQPFLTNSAASFSLFQFLSRGGGYNSKTGLF  984

Query  945   HLPQEVPLVGVQNDPP--SSLSATDLMIREARLSGIVSNVLPPTPTRTYALIEYVCNPCV  1002
             HLP+ +   GV +D P  SSLSATDLMIREARLSGIVSN LP TPTR+Y L+EYVCNP V
Sbjct  985   HLPRAITSHGVTSDTPSSSSLSATDLMIREARLSGIVSNELPLTPTRSYVLLEYVCNPNV  1044

Query  1003  ATLSCSSFFQHCRSRGVYFDTERDSGTVFLLADSLTAGVFGIMCISDTRKNALSNCRAAM  1062
             ATLS  SFFQ+CRSRGVYFD ERD GTVFLLADSLTAGV GIMCISDTRKNAL +CRAAM
Sbjct  1045  ATLSYGSFFQNCRSRGVYFDIERDIGTVFLLADSLTAGVLGIMCISDTRKNALLSCRAAM  1104

Query  1063  EAIAGVAGTKMSVSKSSDGMNELIRTDRMRDQFSEILRALHVM  1105
             EAIA  AGTK S+SKS+  MN+L+R D  RD+FSEILRALH+M
Sbjct  1105  EAIAASAGTKSSISKSNHSMNDLMRADSTRDRFSEILRALHLM  1147

>PYIR_13453
Length=1186

 Score = 725 bits (1872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/1167 (37%), Positives = 648/1167 (56%), Gaps = 120/1167 (10%)

Query  1     MDHLEQKHHTEDIGRILLQTQQELREIRAEISGRKQTTETYIADATPFEDYPAPIVSVNP  60
             MD  +Q+HH ED+GRILLQTQ++LR +R +++    T  + +  A+     P        
Sbjct  1     MDQFQQQHHVEDVGRILLQTQEQLRLMREQMAATSTTPSSSMRFASSGASQP--------  52

Query  61    SKDLETLQNILDRAEREIQAKVDLLYKGVAHYGRKTQTGLPFV-------ASPPRQIPSS  113
               D+   Q IL RAE EI+AK +L+  G  +   +  + LP V       ASP  ++  +
Sbjct  53    --DVLAFQEILQRAEVEIRAKAELVLNGFVNTSSQA-SALPTVSSSANGNASPKARLRQN  109

Query  114   ANS-SLERKSS---FQELSVDLIRKQLHSVKEKYKCLPTKQHSELISP-KRPTQGLLTSK  168
               S +  R++S     E  +D  R + H+   ++   P      L SP +R T+G L   
Sbjct  110   VTSLTAARRNSRLASDEPDLDYFRARFHNPAVEFVSSPV-----LPSPVQRITKGQLV--  162

Query  169   PSKKRYNASLRSLPTV--------------QRGEAGDFSSASRD--QIGEASNTLSVNDR  212
               KK+   + R LP+V              Q  ++G  S  +R    +G       +N+ 
Sbjct  163   --KKKMAQNARLLPSVNKSDPSAPTPELSEQDAKSGMLSLVNRGFLPVGADLTPAFINNH  220

Query  213   --VLMQRTAHLHNRMEEPIKTTPYTTAISHNMMSVKFD----------------------  248
               ++      +++R E+PI++ P T     N+ S+KFD                      
Sbjct  221   GSIIKNSKTRIYDRQEQPIRSMPSTNPSGFNVASLKFDIAPPSTTVSDRENSNGSEPSLQ  280

Query  249   ---------------FMTPTSQSPCGKMQTQEKIVLTNDLQSKQRNGALLANQISLSPGG  293
                             ++P        ++++   V+T + Q     G L A+  S++   
Sbjct  281   RTAAATQFVSKGGSSLLSPRQYENSANVRSRGAKVVTVNFQGDAVRGNLQASVGSVTAAA  340

Query  294   GCREDDSRF--SPGRDPSKKIGIIKAITPIFLNDVTKSL------------VGEISKTYD  339
                 D S+   SP  +   ++           ND T ++              E+  TY 
Sbjct  341   MLSTDQSQEAESPETNLDDEVNSGGNDNADDDNDDTSAMDELRKNVEKIRGYNELLDTYS  400

Query  340   ---FVIHQGIIDRKRPEFEAFQRIANPIWSSVDVVLEALARILSLYFIPIAYINGQRILT  396
                F+IH+G   R+ PEF +F+R+A  +W SV+ V+ AL  +L+ YF+P+AYI+GQR++T
Sbjct  401   LHQFIIHKGRAMRETPEFVSFKRVAQEVWGSVEEVIRALEALLTRYFVPLAYIDGQRLMT  460

Query  397   LAQADNVPLTTKDLISCIRNEDEVKMLLSKPGQRFQGAERTKRATIALQSFIRMAMHRKR  456
             +A  +    + +DL+SCI NED+V  L+ +PGQR++G +R +RA I +Q+F RM  ++K+
Sbjct  461   VAAMEMAAFSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAITIQNFFRMWWNQKK  520

Query  457   FLVMRYKYWKVTAIQRNWRRFSAHKATKLKIEAKREHQEMVFTDSMRSFCSNWDKIRMQR  516
             +   R+    V  IQR WR F++H++ K K++ +R  Q   +   M+    +W  I+  R
Sbjct  521   YTRFRHHLASVVTIQRVWRAFASHESLKRKLKFQRAQQHEQWEAKMQRLKRDWTHIKGNR  580

Query  517   RTIIHIPSISIDSRQRMKTEQFSIQQNLQLQRLCAVIDENVELIYICPFELTDDIVQYYM  576
             R +IH+PS+SID R R+  + FS++QN+QL RLC +ID NV+++Y+ PFELT D+ QY M
Sbjct  581   RVVIHVPSLSIDERSRISADNFSVKQNIQLSRLCGLIDPNVDIVYVSPFELTADVAQYSM  640

Query  577   KLLQLGGISDAAARIKLICPENASRFPSHFSLSSVVLYSPRTLNRLSRCIRGRNAYMVPG  636
             KLLQLGGI+D  AR+KL+ PE A+RFP+HFSL++++LYSP  L R+ R IR + AY+V G
Sbjct  641   KLLQLGGIADPVARVKLVYPEQAARFPAHFSLTTLLLYSPHCLRRIQRYIRNKEAYLVTG  700

Query  637   FPGLEDKRVATILGVPILGLDSTKSLQATTYSGSKRYFRKANVNTLPACIDLYDENELIF  696
              PG EDKR+A  L VPILG+D   +L   T SGSKR+F +A+VN      D+YDE+EL+F
Sbjct  701   IPGREDKRLAVALNVPILGMDPLSALPLMTKSGSKRFFMRADVNVPTGTYDIYDEDELVF  760

Query  697   SLAKLVASHPHQLSVVLRLDYDPFGTGIALMDISRLQSVKEVRLRTKTLESWLQPPIQAK  756
             SLAKL+ SH  Q   VL++DYDPFGTG AL+D+S +  ++E+R   K+ E W QP  +  
Sbjct  761   SLAKLIMSHIEQSVWVLKIDYDPFGTGTALLDVSTMTVLREIRREKKSPEYWKQPSTRDN  820

Query  757   LIRNLVLEMQNNISSFIFVVHPEIFPSSKSFLQAIRIYGVIIELSPKKRQGHVRANLFIE  816
               R ++ E++  ++  +  +HPE++PS + F+ AI  +GV++E +P    GHVRANLFIE
Sbjct  821   AARAIIAELERTLAHLVTPLHPEVYPSWQEFVDAISQFGVVVEAAPSAVIGHVRANLFIE  880

Query  817   PSRRVCVSSTHEIHSLETDTKIDDRVRKFGLDKASAAKMRTFGVTFPQTLIDHEVLKDAS  876
             PS  V VSST +I    T +            KA A + +T G  FPQT   +E ++ AS
Sbjct  881   PSGEVHVSSTQDII---TTSSNSSSSGGGAGKKAGAYRSKTVGYAFPQTAAPYEAIRGAS  937

Query  877   LAIGQALAKDGICGYISVDFVVCLDDQTQKKTLYATGLQPFLTNTAASFALFQLLSRGGS  936
              AIG+ LA + + GY S+D++V  +D+T    L+A  L P+LT++A++FA F LL+R G+
Sbjct  938   TAIGKLLADECVFGYSSIDYLVFQEDKTHAARLWAMALHPYLTDSASTFATFHLLNR-GA  996

Query  937   YNSMTGSLHLPQEVPLVGV-----------QNDPPSSLSATDLMIREARLSGIVSNVLPP  985
              N+ +G  HLP                   +    +  SA DL+++EA  SG+VS +   
Sbjct  997   LNASSGLYHLPPVAASPSSSSTKSLKPSHSRAAGATGTSAADLVMQEATHSGLVS-LEKA  1055

Query  986   TPTRTYALIEYVCNPCVATLSCSSFFQHCRSRGVYFDTERDSGTVFLLADSLTAGVFGIM  1045
                RTY + EY+ +P V+T+  S+FF  CR  GV FD ER  G+VFLLADSLTAGVFGIM
Sbjct  1056  GAQRTYVVSEYIFHPNVSTMQYSAFFHTCRLHGVCFDVERCVGSVFLLADSLTAGVFGIM  1115

Query  1046  CISDTRKNALSNCRAAMEAIAGVAGTK  1072
             C SD+   AL   R A+E I    GT+
Sbjct  1116  CCSDSASGALGFLRTALEVIGREVGTQ  1142

>PYIW_18793
Length=997

 Score = 671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/922 (39%), Positives = 536/922 (58%), Gaps = 70/922 (8%)

Query  213   VLMQRTAHLHNRMEEPIKTTPYTTAISHNMMSVKFDFMTPT-------SQSPC-------  258
             ++      +++R E+PI+  P+T     N+ ++KFD            S SP        
Sbjct  58    IIQNHKTRIYDRQEQPIRAVPHTNPSGFNIATLKFDLAATAECREGDGSDSPSQHKAALA  117

Query  259   -----------GKMQTQEKIVLTNDLQSKQRNGALLA------------------NQISL  289
                         + + +   VLT   Q   R G   A                  NQ + 
Sbjct  118   VVNGSQLDHDSAETRARGPNVLTVSFQGDARRGNFHATVRSAQQQHSGIRHHASANQEAE  177

Query  290   SPGGGCREDDSRFSPGRDPSKKIGIIKAITPIFLNDVTKSLVGEISKTYD---FVIHQGI  346
             SP     ED        D +    + K +  I           E+  TY    F+IH+G 
Sbjct  178   SPETNVDEDLMYDEKDDDANAMDELRKNVEKI-------RGYNELLDTYSLHQFIIHKGR  230

Query  347   IDRKRPEFEAFQRIANPIWSSVDVVLEALARILSLYFIPIAYINGQRILTLAQADNVPLT  406
               R+ PEF +F+R+A  +W SVD V++AL  +L+ YF+P+AY++GQR++T+A  +    +
Sbjct  231   AMRETPEFVSFKRVAQEVWGSVDEVIKALEALLTRYFVPLAYVDGQRLMTVAAMEMASYS  290

Query  407   TKDLISCIRNEDEVKMLLSKPGQRFQGAERTKRATIALQSFIRMAMHRKRFLVMRYKYWK  466
              +DL+SCI NED+V  L+ +PGQR++G +R +RA + +Q+F RM  ++K++   R+    
Sbjct  291   KRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAVTIQNFFRMWWNQKKYSRFRHHLAS  350

Query  467   VTAIQRNWRRFSAHKATKLKIEAKREHQEMVFTDSMRSFCSNWDKIRMQRRTIIHIPSIS  526
             V AIQR WR +++H   K +I+++R+ Q   +   M+    +W +I+  RR +IH+PS S
Sbjct  351   VVAIQRVWRVYASHDDLKRRIKSQRDQQHAQWEAKMQRLKRDWIRIKGNRRVVIHVPSFS  410

Query  527   IDSRQRMKTEQFSIQQNLQLQRLCAVIDENVELIYICPFELTDDIVQYYMKLLQLGGISD  586
             +D R R+  + FS++QNLQL RLC ++D NV+++Y+ PFELT D+VQY MKLLQLGGI+D
Sbjct  411   VDERLRLSADNFSVKQNLQLSRLCGLVDSNVDIVYVSPFELTTDVVQYSMKLLQLGGIAD  470

Query  587   AAARIKLICPENASRFPSHFSLSSVVLYSPRTLNRLSRCIRGRNAYMVPGFPGLEDKRVA  646
               AR+KL+ PE+A RFP+HFSL++++LYSP  L R+ R I+ + AY+V G PG EDKR+A
Sbjct  471   PVARVKLVFPEHAPRFPTHFSLTTLLLYSPHCLRRIQRYIKNKEAYLVTGMPGPEDKRLA  530

Query  647   TILGVPILGLDSTKSLQATTYSGSKRYFRKANVNTLPACIDLYDENELIFSLAKLVASHP  706
               L VPILG+D   +L   T SG KR+F +A+VN      D+YDE+EL+FSLAKL+ SH 
Sbjct  531   MALNVPILGMDPLSALPLMTKSGGKRFFMRADVNVPTGTYDIYDEDELVFSLAKLIVSHI  590

Query  707   HQLSVVLRLDYDPFGTGIALMDISRLQSVKEVRLRTKTLESWLQPPIQAKLIRNLVLEMQ  766
              Q   VL++DYDPF TG AL+D+S + +++E+R   ++ E W QP  +    R ++ E++
Sbjct  591   EQSVWVLKIDYDPFSTGTALLDVSTMVALREIRREKRSPEYWRQPGTRDNAARVIIAELE  650

Query  767   NNISSFIFVVHPEIFPSSKSFLQAIRIYGVIIELSPKKRQGHVRANLFIEPSRRVCVSST  826
               + + +  +HPE++PS + +  AI  +GV++E +P    GHVRANLF+EPS  V VSST
Sbjct  651   RTLGNLVTPLHPELYPSWQDYADAIVQFGVVVEAAPSAVVGHVRANLFVEPSGEVHVSST  710

Query  827   HEIHSLETDTKIDDRVRKFGLDKASAAKMRTFGVTFPQTLIDHEVLKDASLAIGQALAKD  886
              +I        +       G     A + ++ G  FPQT   +E ++ AS AIG+ LA+D
Sbjct  711   QDI--------LLSSSGGCGGKPGGAYRHKSVGYAFPQTAAPYEAIRGASTAIGKLLAED  762

Query  887   GICGYISVDFVVCLDDQTQKKTLYATGLQPFLTNTAASFALFQLLSRGGSYNSMTGSLHL  946
              + GY S+DF+V  +D++    L+A  L+P+LT++AA+F  F LL+R G+ N+ +G  +L
Sbjct  763   NVFGYASIDFLVFQEDKSHTARLWAMALRPYLTDSAATFTTFHLLNR-GALNTTSGLYYL  821

Query  947   PQE-------VPLVGVQNDPPSSLSATDLMIREARLSGIVSNVLPPTPTRTYALIEYVCN  999
             P         V L        S  SA DL++ EA  SG+VS +       TY + EY+ +
Sbjct  822   PAATVTSASLVQLQSSSAAFASGASAADLVLHEATHSGLVS-LEKVGAQHTYVVSEYIFH  880

Query  1000  PCVATLSCSSFFQHCRSRGVYFDTERDSGTVFLLADSLTAGVFGIMCISDTRKNALSNCR  1059
             P V+T+  S+FF  CR  GV FD ER  G+VFLLADSLTAGVFG+MC SDT   AL   R
Sbjct  881   PNVSTMQYSAFFHTCRLHGVCFDVERCVGSVFLLADSLTAGVFGLMCCSDTASGALGFLR  940

Query  1060  AAMEAIAGVAGTKMSVSKSSDG  1081
              A+E +    GT+    + + G
Sbjct  941   TALEVVGREVGTQALTDEFTSG  962

>PYU1_G001734
Length=800

 Score = 664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/750 (43%), Positives = 482/750 (64%), Gaps = 33/750 (4%)

Query  338   YDFVIHQGIIDRKRPEFEAFQRIANPIWSSVDVVLEALARILSLYFIPIAYINGQRILTL  397
             + F+IH+G   R+ PEF +F+R+A  IW  V+ V++AL  +L+ YF+P+AY++GQR++T+
Sbjct  24    HQFIIHKGKAMRETPEFVSFKRVAQEIWGGVEEVIKALETLLTRYFVPLAYVDGQRLMTV  83

Query  398   AQADNVPLTTKDLISCIRNEDEVKMLLSKPGQRFQGAERTKRATIALQSFIRMAMHRKRF  457
             A  +    + +DL+SCI NED+V  L+ +PGQR++G +R +RA I +Q+  RM  ++K++
Sbjct  84    ASMEMASFSKQDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAITIQNVFRMWSNQKKY  143

Query  458   LVMRYKYWKVTAIQRNWRRFSAHKATKLKIEAKREHQEMVFTDSMRSFCSNWDKIRMQRR  517
                R     V  IQ+ WR +++H+  + K++A+R+ Q   +   M+     W +I+  RR
Sbjct  144   SRYRRHLSSVVLIQQVWRAYASHEDLRRKLKAQRQQQHEQWEARMQRLQREWPRIKANRR  203

Query  518   TIIHIPSISIDSRQRMKTEQFSIQQNLQLQRLCAVIDENVELIYICPFELTDDIVQYYMK  577
              IIH+PS+SID R R++ + F+++QNLQL RLC +ID NV+++Y+ PFELT ++ QY+MK
Sbjct  204   VIIHVPSLSIDERFRIRADNFAVKQNLQLSRLCGIIDANVDIVYVSPFELTSEVGQYFMK  263

Query  578   LLQLGGISDAAARIKLICPENASRFPSHFSLSSVVLYSPRTLNRLSRCIRGRNAYMVPGF  637
             LLQLGGI+D   R+KL+ PE A+RFP+HFSL++V+LYSP  L R+ RC++G+ AY+V G 
Sbjct  264   LLQLGGIADPVTRVKLVFPEQATRFPAHFSLTTVLLYSPHCLRRIRRCVKGKEAYLVTGM  323

Query  638   PGLEDKRVATILGVPILGLDSTKSLQATTYSGSKRYFRKANVNTLPACIDLYDENELIFS  697
             PG EDKR+A  L VPILG+D   +L   T SGSKR+F +A+VN      D+YDE+ELIFS
Sbjct  324   PGQEDKRLAMALNVPILGMDPLATLPLMTKSGSKRFFMRADVNVPTGTYDIYDEDELIFS  383

Query  698   LAKLVASHPHQLSVVLRLDYDPFGTGIALMDISRLQSVKEVRLRTKTLESWLQPPIQAKL  757
             LAKL+ SH  Q   +L++DYDPFGTG A++D S + +++E+R   K+ E W QP  +   
Sbjct  384   LAKLIVSHIEQNVWLLKIDYDPFGTGTAIVDASVVTALREIRREKKSPEYWRQPGTRDNA  443

Query  758   IRNLVLEMQNNISSFIFVVHPEIFPSSKSFLQAIRIYGVIIELSPKKRQGHVRANLFIEP  817
              R ++ E++  I   +  +HPE++P+ + F  AI  +GV+IE +P    G++RANLF+EP
Sbjct  444   ARMIIAELERTIGKLVTPLHPEVYPTWQEFADAIAQFGVVIEAAPSAIVGYIRANLFVEP  503

Query  818   SRRVCVSSTHEIHSLETDTKIDDRVRKFGLDKASAAKMRTFGVTFPQTLIDHEVLKDASL  877
             S  V VSST ++                 L  AS  K +  G  FPQT   +E ++ AS+
Sbjct  504   SGEVHVSSTQDVI----------------LSTASIHKRKVAGYAFPQTTAPYEAIRGASM  547

Query  878   AIGQALAKDGICGYISVDFVVCLDDQTQKKTLYATGLQPFLTNTAASFALFQLLSRGGSY  937
             AIG+ L  D + GY SVD++V  +D+T    L+A  L P+LT++A++FA+F LL+R G+ 
Sbjct  548   AIGKVLVDDSVFGYSSVDYLVFREDKTHVPRLWAMALHPYLTDSASTFAVFHLLNR-GAL  606

Query  938   NSMTGSLHLP----QEVP-----------LVGVQNDPPSSLSATDLMIREARLSGIVSNV  982
             N  TG  HLP      VP           L         S ++ +L+++EA   G+VS +
Sbjct  607   NIHTGQYHLPAPAASGVPSSSTASSVSLKLNASSTRAAGSATSANLVLQEATHLGLVS-L  665

Query  983   LPPTPTRTYALIEYVCNPCVATLSCSSFFQHCRSRGVYFDTERDSGTVFLLADSLTAGVF  1042
                   RTYA+ EY+ +P V+T+  SSFF  CR  GV FD ER  GT+F+LADSLTAGVF
Sbjct  666   EKAGAQRTYAVNEYIFHPNVSTMQYSSFFHTCRLHGVCFDVERCFGTIFMLADSLTAGVF  725

Query  1043  GIMCISDTRKNALSNCRAAMEAIAGVAGTK  1072
             GI+C  DT   AL   R A+E I    GT+
Sbjct  726   GIICCGDTASAALGFLRTALEVIGREVGTQ  755

>PYAP_17746
Length=1169

 Score = 639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/1166 (35%), Positives = 620/1166 (53%), Gaps = 120/1166 (10%)

Query  1     MDHLEQKHHTEDIGRILLQTQQELREIRAEISGRKQTTETYIADATPFEDYPAPIVSVNP  60
             M+ L+Q+HH ED+GRILLQTQ +LR++R ++ G        +            I S N 
Sbjct  1     MEQLQQRHHVEDVGRILLQTQDQLRQLREQLVGSNGPGNGSV------------IASNNA  48

Query  61    SKDLETLQNILDRAEREIQAKVDLLYK-----GVAHYGRKTQTG----LPFVASPPRQIP  111
               ++E    IL RAE E++ K +L+       G A  G   + G    LP V  PP    
Sbjct  49    GAEIE---EILQRAEDELRMKAELVLSNIVTAGPASPGANDREGGLIPLPTVRRPPIARR  105

Query  112   SSANSSLERKSSFQELSVDLIRKQLH--SVKEKYKCL------------PTKQHSELISP  157
                 + L    S+ +L ++  R++    +V +    +            PT  H +++  
Sbjct  106   RRRKAELHDGGSY-DLDIEYFRQRFKRTAVDDASSTMTTAPRQRGGGPTPTHAHGKVVKH  164

Query  158   KRPTQGLL----------TSKPSKKRYNASLRSLPTVQRG---EAGDFSSASRDQIGEAS  204
             K  +   L            +P     +A    L  + RG      D + A +      S
Sbjct  165   KTTSNARLLPFVNKYDPTAPRPVLSPVDAKQGVLSLLNRGFLPPNVDLTPAFQSVSSPKS  224

Query  205   NTLSVNDRVLMQRTAHLHNRMEEPIKTTPYTTAISHNMMSVKFDF-------------MT  251
                  +  V+   +  LH R E+P++ T Y++  + N+ ++KFD              + 
Sbjct  225   QGNPTS--VIQNGSVKLHRREEQPVRATAYSSPGNFNLATLKFDMAAVNTVTAAENRSIE  282

Query  252   PTSQS---PCGKMQTQEKIVLTNDLQSKQRNGALLANQISLSPGGGCREDDSRFSPGRDP  308
             P  +S   P   M+T          +S  RN A        S   G RED +  +P    
Sbjct  283   PHDESEALPLRAMKTVTISFHNGKSESSPRNNA------RESEHDGRREDGNDTAPLERE  336

Query  309   SKKIGIIKAITPI--FLNDVTK-SLVGEISKTYD---FVIHQGIIDRKRPEFEAFQRIAN  362
                +   +A   +    N+V K     E+   Y    F+IH+G   R  PEF++F+R+A 
Sbjct  337   DLDVTADEAANSMEDLRNNVEKIRGYNELLDAYSLHQFIIHKGRALRDTPEFQSFKRVAQ  396

Query  363   PIWSSVDVVLEALARILSLYFIPIAYINGQRILTLAQADNVPLTTKDLISCIRNEDEVKM  422
              IW S++ V++AL  +L+ YF+P+AYI+GQR++TLA  +   L+T +L++C+ NED+V  
Sbjct  397   EIWGSIEEVIQALEILLTRYFVPLAYIDGQRLMTLASMEMAKLSTCELLTCVVNEDQVAS  456

Query  423   LLSKPGQRFQGAERTKRATIALQSFIRMAMHRKRFLVMRYKYWKVTAIQRNWRRFSAHKA  482
             L+ +PGQR++G +R +RA   LQ+F RM +HR RF  +R        IQ+ WR ++  ++
Sbjct  457   LIRRPGQRYKGKDRKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQS  516

Query  483   TKLKIEAKREHQEMVFTDSMRSFCSNWDKIRMQRRTIIHIPSISIDSRQRMKTEQFSIQQ  542
              + ++   RE +   +   +R   S W  IR QRR +IH+ SIS+D R R+  E FS++Q
Sbjct  517   LRRRLAHVREERLGEWKAKVRRMRSQWRDIRQQRRVVIHVASISVDERTRLSMENFSVKQ  576

Query  543   NLQLQRLCAVIDENVELIYICPFELTDDIVQYYMKLLQLGGISDAAARIKLICPENASRF  602
             NLQL RL  ++D+NVE++Y+ PFEL+ ++ QY++KLLQL GI++A  R++L+ PE+A++F
Sbjct  577   NLQLSRLAGLVDQNVEIVYVTPFELSTEVSQYFIKLLQLSGIANAHTRVRLVFPEHAAQF  636

Query  603   PSHFSLSSVVLYSPRTLNRLSRCIRGRNAYMVPGFPGLEDKRVATILGVPILG-LDSTKS  661
             P HFSL++ ++YSP  + R+ R ++G+ AY+V G PG ED+R+A  L VPILG  D T  
Sbjct  637   PQHFSLATHLIYSPNCIRRIQRLVQGKEAYLVMGVPGPEDQRLAVALQVPILGPEDPTSI  696

Query  662   LQATTYSGSKRYFRKANVNTLPACIDLYDENELIFSLAKLVASHPHQLSVVLRLDYDPFG  721
             L   T SGSKR+F KA+VN      D+YD +EL+FSLAKL+ SH +Q   +L+LD DP G
Sbjct  697   LPLMTRSGSKRFFIKADVNVPTGTYDIYDIDELLFSLAKLIISHLNQNVWLLKLDADPLG  756

Query  722   TGIALMDISRLQSVKEVRLRTKTLESWLQPPIQAKLIRNLVLEMQNNISSFIFVVHPEIF  781
             TG A++D+S + +++++R   +  E W QP I+  + R L+ E++  I S +   HPEIF
Sbjct  757   TGTAILDVSLMTTLRDIRREKRPPEYWKQPGIRDTIARALLQELEREIGSLLKPSHPEIF  816

Query  782   PSSKSFLQAIRIYGVIIELSPKKRQGHVRANLFIEPSRRVCVSSTHEIHSLETDTKIDDR  841
              S K F  AI  +GV++E  P    G +R N+FIEPS  V V ST+++ S    T +  R
Sbjct  817   ASWKEFASAIPEFGVVVEALPFHVAGVIRMNIFIEPSGDVHVMSTNDVLS-GNGTTLSQR  875

Query  842   VRKFGLDKASAAKMRTFGVTFPQTLIDHEVLKDASLAIGQALAKD-GICGYISVDFVV--  898
              R            R     FPQTL+ HE +  AS A+G+ L ++   CGY SVD  +  
Sbjct  876   QR------------RPAAFVFPQTLVPHEAIVGASSAVGRVLYEEHAFCGYASVDLQLSQ  923

Query  899   --CLDDQTQKKTLYATGLQPFLTNTAASFALFQLLSRGGSYNSMTGSLHLPQEVPLVGVQ  956
                L    + + L+A  L P+LT++AA+FA F  L R G  N  TG  +      L   +
Sbjct  924   EESLTSPHKAERLWAVSLFPYLTDSAATFAAFHALHR-GVLNPATGRYN------LTARE  976

Query  957   NDPPSSLSATDLMIREARLSGIVSNVLPPTPTRTYALIEYVCNPCVATLSCSSFFQHCRS  1016
             + PP S SA         +S ++  +      R+YA+ EYV +P V+ +S ++FF  CR 
Sbjct  977   STPPESDSAL--------VSSVIGTLDRIGAPRSYAVAEYVFHPNVSIMSYNAFFHTCRL  1028

Query  1017  RGVYFDTERDSGTVFLLADSLTAGVFGIMCISDTRKNALSNCRAAMEAIAGVAGTKMSVS  1076
              GV FD ER  G+VFLLADSLTAG+FG++   ++   AL   R A E I    GT+  VS
Sbjct  1029  HGVCFDVERCVGSVFLLADSLTAGIFGVLSSGESATQALQYLRTAFEVIGREVGTQSMVS  1088

Query  1077  KSSDGMNELIRTDRMRDQFSEILRAL  1102
               SD    +  + ++   F+EIL  L
Sbjct  1089  GDSD----IGSSVQLSGNFAEILGLL  1110

>PHYRA_95901
Length=1075

 Score = 600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/1122 (34%), Positives = 600/1122 (53%), Gaps = 128/1122 (11%)

Query  1     MDHLEQKHHTEDIGRILLQTQQELREIRAEISGRKQTTETYIADATPFEDYPAPIVSVNP  60
             M+ ++Q+HH ED+GR+LLQTQ++LR +R +++      E   +        P    +V  
Sbjct  1     MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANAS--------PMRHSAVVT  52

Query  61    SKDLETLQNILDRAEREIQAKVDLLYKGVAHYGRKTQTG-------LPFV--ASPPRQIP  111
             + +++    IL + E E++AK +L+ KG+ +     QT        LP V  A+PP    
Sbjct  53    TAEVQAFNAILQQTEVELRAKAELVLKGMVNSSSSAQTNQSQSGTLLPVVTVAAPP----  108

Query  112   SSANSSLERKSSFQELS---VDLIRKQLH--SVKEKYKCLPTKQHSELISPKRPTQGLLT  166
                  S   +S + + S   ++  R+Q H  SV+ +   +P+ QH +         G+  
Sbjct  109   -----STRHRSGYGDASSIPIEFFREQFHNSSVEVRQSLMPSPQHWQR------HLGIQH  157

Query  167   SKPSKKRYNASLRSLPTVQRGEAGDFSSASRDQ---------IGEASNTLSVNDRVLMQR  217
              +  +K+     R LP+V + +    +   R++         +  +S T      V+ QR
Sbjct  158   GRLLRKKTTQHCRLLPSVNKVDPTAPTPELREEDAKHGVLNLVTRSSGTKD-GSGVMKQR  216

Query  218   TAHLHNRMEEPIKTTPYTTAISHNMMSVKFDFMTPTSQSPCGKMQTQEKIVLTNDLQSKQ  277
                +++R E+P + TP+T +  +N+ ++KFD  +    +  GK          +D++  +
Sbjct  217   ATRIYDRSEQPARATPFTQSTGYNLAALKFDLRS----TGTGKNDRS-----NDDMEGNR  267

Query  278   RNGALLANQISLSPGGGCREDDSRFSPGRDPSKKIGIIKAITPIFLNDVTKSLVGEISKT  337
              +   +  +IS    GG   D    +   +    +  I+       ND+  +        
Sbjct  268   EH---IDGEISDEDQGGADNDKDEEAEMEELGANVDKIRGY-----NDLLDAY-----SL  314

Query  338   YDFVIHQGIIDRKRPEFEAFQRIANPIWSSVDVVLEALARILSLYFIPIAYINGQRILTL  397
             + F+IH+G   R  PEF +F+R+A  +W SV+  L AL  +L+ YF+P+AY++GQR+L+L
Sbjct  315   HQFLIHKGRSMRDTPEFVSFRRVAQELWGSVEEALRALETLLTQYFVPLAYVDGQRLLSL  374

Query  398   AQADNVPLTTKDLISCIRNEDEVKMLLSKPGQRFQGAERTKRATIALQSFIRMAMHRKRF  457
             A       +  +L++CI NE++V  +L +PGQR++G +R +RA   +Q+ +RM   R+R+
Sbjct  375   AATGQPRFSKSELLACIVNEEQVMSVLRRPGQRYKGRDRKRRAATTIQACVRMWSIRRRY  434

Query  458   LVMRYKYWKVTAIQRNWRRFSAHKATKLKIEAKREHQEMVFTDSMRSFCSNWDKIRMQRR  517
             +  R      T IQ  WR +S H A K ++   R  Q   +   M+   + W +I  +RR
Sbjct  435   VRSRASDISATRIQLAWRSYSCHAALKTRLREVRREQLERWEARMQDLRTQWPQIAGRRR  494

Query  518   TIIHIPSISIDSRQRMKTEQFSIQQNLQLQRLCAV-IDENVEL-IYICPFELTDDIVQYY  575
              ++H+PS+S+D   R+  E F++QQNLQL R+CA  +D +V+L +Y+ PFELT D+ QY+
Sbjct  495   VVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSHVDLLVYVSPFELTADVSQYF  554

Query  576   MKLLQLGGISDAAARIKLICPENASRFPSHFSLSSVVLYSPRTLNRLSRCIRGRNAYMVP  635
             +KLLQLGG++D+  R+KL+ PE A+RFP HFSLSS++LYSP  L R+     G+ AY+V 
Sbjct  555   LKLLQLGGLADSRPRVKLVFPEQAARFPDHFSLSSLLLYSPHCLRRIRHYTAGKEAYLVM  614

Query  636   GFPGLEDKRVATILGVPILGLDSTKSLQATTYSGSKRYFRKANVNTLPACIDLYDENELI  695
             G PG ED+R+A  L +PILG    ++L   T SG KR   +A+VN      +LYDE+EL 
Sbjct  615   GLPGAEDQRLAVALDLPILGAPPAQALPLLTRSGGKRLLIRADVNVPTGTYELYDEHELF  674

Query  696   FSLAKLVASHPHQLSVVLRLDYDPFGTGIALMDISRLQSVKEVRLRTKTLESWLQP---P  752
              +LAKL  +H  Q   +L+LDYDP G G A++D+S +Q+++E+R   +T E W QP    
Sbjct  675   AALAKLAVAHMEQPKWLLKLDYDPLGIGEAVVDLSGMQAMRELRREKRTPEYWRQPGPRD  734

Query  753   IQAKLIRNLVLEMQNNISSFIFVVHPEIFPSSKSFLQAIRIYGVIIELSPKK--------  804
               AKL+    LE    ++     +H EIFP+ + F +AI  +G +IE  P          
Sbjct  735   AAAKLVLA-ELERPGVLARLATPMHTEIFPAWRDFTEAIGHFGCVIEAVPPAGIAATPES  793

Query  805   -----RQGHVRANLFIEPSRRVCVSSTHEIHSLETDTKIDDRVRKFGLDKASAAKMRTFG  859
                     +VRANLF+ P  +  ++S+                   GL++      +T  
Sbjct  794   SSLLVEPAYVRANLFVYPDGKNVLASS-----------------GGGLNR------KTVA  830

Query  860   VTFPQTLIDHEVLKDASLAIGQALAKDGICGYISVDFVVCLDDQTQKKT-LYATGLQPFL  918
              TFPQT   HE ++ A  A G+ L +  + GY+S+DFVV  D++      L+A  + PFL
Sbjct  831   FTFPQTAAPHEAVQGACDATGKLLVETSVWGYVSLDFVVFQDEKNGGSPRLWALAVHPFL  890

Query  919   TNTAASFALFQLLSRGGSYNSMTGSLHLPQEVPLVGVQNDPPSSLS--ATDLMIREARLS  976
             T++AASFA F LL+RG    + + S+          V  +P  S S  A DL++REA L+
Sbjct  891   TDSAASFACFHLLARGAYRVAASNSM----------VNANPGRSGSGGAADLLLREASLT  940

Query  977   GIVSNVLPPTPTRTYALIEYVCNPCVATLSCSSFFQHCRSRGVYFDTERDSGTVFLLADS  1036
                    P    R + +  YV +P V T+  S+FF  CR  GV FD ER  GT+FLLADS
Sbjct  941   KAALAGAP----RCFVVCSYVFHPHVTTMQYSAFFHACRLHGVCFDVERTLGTLFLLADS  996

Query  1037  LTAGVFGIMCISDTRKNALSNCRAAMEAIAGVAGTKMSVSKS  1078
             LTAGVFGI+ + +T + AL+  R A+E I    G  + ++ S
Sbjct  997   LTAGVFGILSVGETTEGALAFLRTALEVIGREVGATIEMATS  1038

>SDRG_01764
Length=1092

 Score = 588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/1132 (33%), Positives = 592/1132 (52%), Gaps = 123/1132 (11%)

Query  1     MDHLEQKHHTEDIGRILLQTQQELREIRAEISGRKQTTETYIADATPFEDYPAPIVSVNP  60
             MD L Q++H ED+GRILLQ Q ELR +R ++                       + S N 
Sbjct  1     MDRLAQQYHVEDVGRILLQAQDELRNMREQV-----------------------LTSNN-  36

Query  61    SKDLETLQNILDRAEREIQAKVDLLYKGVAHYGRKTQTGLPFVASPPRQIPSSANSSLER  120
               D++ LQ IL+RAE ++++K +++  GV +   KT   LP + +P    PS   S    
Sbjct  37    -IDIDALQAILERAELDLRSKAEIVLNGVVNNTMKT---LPVIEAPGGGQPSV--SKFSS  90

Query  121   KSSFQELSVDLIRKQLHSVKEKYKCLPT----KQHSELISP--------KRPT-QGLLTS  167
             K + Q    D + +       + +  P     +Q  + + P        KRP  + +   
Sbjct  91    KLAKQRELADAMARDGSLDDHRTRSSPVERLRQQLGQPVVPVERDRPPGKRPIGRTMQVG  150

Query  168   KPSKKRYNASLRSLPTVQR--------------GEAGDFSSASRDQI---GEASNTLSVN  210
             +  KK+     R LP V R               + G  +  +R  I    + S   +  
Sbjct  151   RLIKKKVTGPQRLLPKVNRIDPLAPVPDLEDDDAKRGVLNLVNRGFIPTSADLSLAFTHG  210

Query  211   DRVLMQRTAHLHNRMEEPIKTTPYTTAISHNMMSVKFDFMTPTSQSPCGKMQTQEKIVLT  270
             D ++      L++R E+P+K+ PY  + S N+ S+K D   P ++          ++ + 
Sbjct  211   DGIIQNSKLRLYDRSEQPVKSQPYMNSSSFNVASLKLDLAPPPTEP---DPTPLTRLAV-  266

Query  271   NDLQSKQRNGALLANQISLSPGGGCREDDSRFSPGRDPSKKIGIIKAITPI--FLNDVTK  328
                 ++ +  A+   Q++  PG    +D+    P  DP+   G I+    I    N+V K
Sbjct  267   ----ARNKKSAVATVQLTF-PGA---KDEGDVVPVEDPTTDDGPIEPTDTIDELRNNVEK  318

Query  329   -SLVGEISKTYD---FVIHQGIIDRKRPEFEAFQRIANPIWSSVDVVLEALARILSLYFI  384
                  ++  TY    F+I +G    + PEF +F+RI   +W SV + +  L  +L  Y +
Sbjct  319   IRGYNDLLDTYSLHQFIIRKGQTLAETPEFISFKRITEDLWGSVSMAIRELETLLINYSV  378

Query  385   PIAYINGQRILTLAQADNVPLTTKDLISCIRNEDEVKMLLSKPGQRFQGAERTKRATIAL  444
             P+AYI+GQ++L +A  D V  +  +L++C+ N DEV   +++PGQRF+G +    A I L
Sbjct  379   PLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGEDSRHAAAILL  438

Query  445   QSFIRMAMHRKRFLVMRYKYWKVTAIQRNWRRFSAHKATKLKIEAKREHQEMVFTDSMRS  504
             QS  RM + R+R L   + +   + IQR +R + + K  ++K+   RE     +   M +
Sbjct  439   QSVYRMHLTRRR-LRQHHGHSYASHIQRVYRTYKSVKEIQVKLRLAREADARTWETQMTA  497

Query  505   FCSNWDKIRMQRRTIIHIPSISIDSRQRMKTEQFSIQQNLQLQRLCAVIDENVELIYICP  564
             F +NWDKI+MQRR ++H+PS S + R R+  + F+I+QNLQ+ RLCA+ D NV++IYI P
Sbjct  498   FHANWDKIKMQRRVVVHVPSFSAEERTRLNMDNFAIRQNLQMARLCAIADPNVDVIYISP  557

Query  565   FELTDDIVQYYMKLLQLGGISDAAARIKLICPENASRFPSHFSLSSVVLYSPRTLNRLSR  624
             FEL+ DI +Y M+LLQLGG++D  +R++++ PENA RFP HFSL++++LYSP  L ++ R
Sbjct  558   FELSADIQKYMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLATILLYSPHCLKKIKR  617

Query  625   CIRGRNAYMVPGFPGLEDKRVATILGVPILGLDSTKSLQATTYSGSKRYFRKANVNTLPA  684
              +RG+ AY+V G  G EDKR+A  L +P+LG+D  ++L   T SG+KR F +A+VN    
Sbjct  618   YVRGKEAYIVAGTVGPEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKRLFTQADVNIPFG  677

Query  685   CIDLYDENELIFSLAKLVASHPHQLSVVLRLDYDPFGTGIALMDISRLQSVKEVRLRTKT  744
               D+YDE+ELI SLAKL A++ HQ   +++LD DP  TG+A +D+  L+ V +VR   + 
Sbjct  678   AHDIYDEDELILSLAKLTAANLHQGMWLIKLDADPSDTGLASIDMHALECVNKVRTEKRA  737

Query  745   L---ESWLQPPIQAKLIRNLVLEMQNNISSFIFVVHPEIFPSSKSFLQAIRIYGVIIELS  801
             +   E + QP I+  ++R +V E+       I    P+++P+ +     +   G +IE  
Sbjct  738   MKNDEYYSQPNIKEGIVRAIVAELSEQFHRLISPCFPDVYPTWQHMRPVVNRIGAVIEAY  797

Query  802   PKKRQGHVRANLFIEPSRRVCVSSTHEIHSLETDTKIDDRVRKFGLDKASAAKMRTFGVT  861
             P K    VRAN+FIEPS  V ++S  E                  L +A   K ++ G  
Sbjct  798   PPKVLARVRANVFIEPSGGVHLTSAQE-----------------QLMQAK-NKHQSVGAV  839

Query  862   FPQTLIDHEVLKDASLAIGQALAKDGICGYISVDFVVCLDDQTQKKT-------LYATGL  914
             +P T + +  ++ ASLA+ QA+   GI GY S+D+V  LD +T           L+A  L
Sbjct  840   YPSTTVPYAAIRGASLAVAQAMYASGIIGYASIDYVAFLDVKTVNGKAGPPHLRLWALQL  899

Query  915   QPFLTNTAASFALFQLLSRGGSYNSMTGSLHLPQEV----PLVGVQNDPPSSLSATDLMI  970
              P LT TA SF LF  LS   + ++ TG   LPQ      P  G      + L+   ++ 
Sbjct  900   LPCLTPTAMSFVLFTFLS-CATLDAATGRSFLPQPAPHPSPATGQLPVTETQLAVEKILS  958

Query  971   REARLSGIVSNVLPPTPTRTYALIEYVCNPCVATLSCSSFFQHCRSRGVYFDTERDSGTV  1030
                R S +        P R Y   EY+ +P +ATL  + FF  CR  GV FD ++  G  
Sbjct  959   ESPRSSNV-------GPERAYIAHEYIFHPNMATLQYAVFFNMCRVHGVSFDLQKSIGAA  1011

Query  1031  FLLADSLTAGVFGIMCISDTRKNALSNCRAAMEAIAGVAGTKMSVSKSSDGM  1082
             F+LADSLTAGV G++CI ++ K A+   RAA+E I    G ++ V  + D +
Sbjct  1012  FVLADSLTAGVVGLLCIGESDKEAVRLTRAALELI----GDQVGVQPAPDAL  1059

>PPTG_17128
Length=1177

 Score = 572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/1184 (33%), Positives = 620/1184 (52%), Gaps = 152/1184 (13%)

Query  1     MDHLEQKHHTEDIGRILLQTQQELREIRAEISGRKQTTETYIADATPFEDYPAPIVSVNP  60
             M+ ++Q+ H ED+GR+LLQTQ++LR +R +++      E   +        P    ++  
Sbjct  1     MEKVQQQQHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANAS--------PMRHSAIVT  52

Query  61    SKDLETLQNILDRAEREIQAKVDLLYKGVAHYGRK-----TQTG--LPFV----------  103
             + +++    IL + E E+++K +L+  G+ +         TQ+G  LP V          
Sbjct  53    TAEVQAFNAILQQTETELRSKAELVLNGMVNSSNNAQNNQTQSGNFLPAVTVAALPSTKH  112

Query  104   ------ASPPRQIPSSANSSLERKSSFQELSVDLIRKQLHSVKEKYKCLPTKQHSELISP  157
                   A+ PRQ+ +S+      +  F+  SV+ IR+ L    E ++      H  L+  
Sbjct  113   RSGYNGANKPRQMDASSIPMEFFREQFRNSSVE-IRQSLMPSPEPWQRHFGVHHGRLMR-  170

Query  158   KRPTQG--LLTS---------KPSKKRYNASLRSLPTVQRGEAGDFSSASRDQIGEASNT  206
             K+ TQ   LL S          P  +  +A    L  V RG    ++  +    G    +
Sbjct  171   KKTTQHCRLLPSVNKVDPSAPAPELREEDAKHGVLNLVTRGFLPAYADLTPAFAGPNGTS  230

Query  207   LSVNDRVLMQRTAHLHNRMEEPIKTTPYTTAISHNMMSVKF----------------DFM  250
                   ++ QR   +++R E+ +++TP+T +  +N+ S+KF                D M
Sbjct  231   NGSCGGIMKQRATRIYDRSEQAVRSTPFTQSTGYNLASLKFDLCAPPTPPPPIPESKDLM  290

Query  251   TPTSQS------PCGKMQTQEKIVLTNDLQSKQRNGALLANQISL---------SPGGGC  295
              P S +          +Q   ++ ++      +   +  A+Q SL         + G   
Sbjct  291   PPESTTRRRSVRKSSAVQGPNRVTMSFPKSGNKVKNSRSAHQTSLMSAAVAAFTNQGEDM  350

Query  296   REDDSRFSP-------------GRDPSKKIGIIKAITPIFLNDVTK-SLVGEISKTYD--  339
               +  RFS              G+D   ++  + A       +V K     E+   Y   
Sbjct  351   DNNRGRFSDDDVSDEDQENDENGKDEDAEMEELGA-------NVDKIRGYNELLDAYSLH  403

Query  340   -FVIHQGIIDRKRPEFEAFQRIANPIWSSVDVVLEALARILSLYFIPIAYINGQRILTLA  398
              F+IH+G   R  PEF +F+R+A  +W SV+  L AL  +L+ YF+P+AY++GQR+L LA
Sbjct  404   QFLIHKGRTMRDTPEFISFRRVAQELWGSVEEALRALEALLTQYFVPLAYVDGQRLLALA  463

Query  399   QADNVPLTTKDLISCIRNEDEVKMLLSKPGQRFQGAERTKRATIALQSFIRMAMHRKRFL  458
                    + ++L+SCI NED++  +L +PGQR++G +R +RA   +Q+ IRM + R+R+ 
Sbjct  464   GTGQPRFSKRELLSCIVNEDQIMSVLRRPGQRYKGRDRKRRAATTVQACIRMWLVRRRYA  523

Query  459   VMRYKYWKVTAIQRNWRRFSAHKATKLKIEAKREHQEMVFTDSMRSFCSNWDKIRMQRRT  518
               R      T IQ  WR +S H A K ++   R  +   +   M +  S W +I  +RR 
Sbjct  524   RSRASDINATKIQLAWRAYSCHTALKTRLREVRREKLEKWEKRMCTLKSQWSQIAARRRV  583

Query  519   IIHIPSISIDSRQRMKTEQFSIQQNLQLQRLCAV-IDENVEL-IYICPFELTDDIVQYYM  576
             ++H+PS+S+D   R+  E F++QQNLQL R+CAV +D NV+L +Y+ PFELT D++QY++
Sbjct  584   VVHVPSLSLDEHYRLSAENFAVQQNLQLTRVCAVALDSNVDLLVYVSPFELTADVLQYFL  643

Query  577   KLLQLGGISDAAARIKLICPENASRFPSHFSLSSVVLYSPRTLNRLSRCIRGRNAYMVPG  636
             KLLQLGG+ D+  R+K + PE ++RFP+HFSLSS++LYSP  L R+     G+ AY+V G
Sbjct  644   KLLQLGGLVDSGPRVKFVFPEQSTRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMG  703

Query  637   FPGLEDKRVATILGVPILGLDSTKSLQATTYSGSKRYFRKANVNTLPACIDLYDENELIF  696
              PG ED+R+A  L +PILG    ++L   T SG KR   +A+VN      +LYDE+EL  
Sbjct  704   LPGAEDQRLAIALDLPILGAPPAQALPLLTRSGGKRLLIRADVNVPNGTYELYDEHELCA  763

Query  697   SLAKLVASHPHQLSVVLRLDYDPFGTGIALMDISRLQSVKEVRLRTKTLESWLQPPIQAK  756
             +LAKL  +H  Q   +++LDYDP G G A++D+S +Q+++E+R   +T E W QP  +  
Sbjct  764   ALAKLAIAHMDQPKWLIKLDYDPLGVGEAVVDLSNIQAMRELRREKRTPEYWRQPGPRDA  823

Query  757   LIRNLVLEMQ--NNISSFIFVVHPEIFPSSKSFLQAIRIYGVIIELSPKK----------  804
               + ++ E++    ++     +H E+FP+ + ++ A+  +G +IE  P            
Sbjct  824   AAKMILAELERPGMLARLAAPMHSEMFPTWRDYIDAVGHFGCVIEAVPPTAIAASPEAST  883

Query  805   ---RQGHVRANLFIEPSRRVCVSSTHEIHSLETDTKIDDRVRKFGLDKASAAKMRTFGVT  861
                   +VRANLF++P   V V+ST  +  L T           GL++      +T   T
Sbjct  884   ALVEPAYVRANLFVDPDGSVHVTSTQNV--LATGGG--------GLNR------KTVAFT  927

Query  862   FPQTLIDHEVLKDASLAIGQALAKDGICGYISVDFVVCLDDQTQKKT-LYATGLQPFLTN  920
             FPQT   HE +K A  A G+ L +  + GY+S+DFVV  D+++     L+A  + PFLT+
Sbjct  928   FPQTAAPHEAIKGACNAAGKLLVETNVWGYVSLDFVVFQDEKSNGAPRLWALAVHPFLTD  987

Query  921   TAASFALFQLLSRG------GSYNSMTGSLHLPQEVPLVGVQNDPPSSLSATDLMIREAR  974
             +AASFA F LL+RG      G+Y   + SL        V  +N    S   TDL++REA 
Sbjct  988   SAASFACFHLLARGVLDTNSGAYRVASKSL------TTVTGRN---GSGCTTDLLLREAS  1038

Query  975   LSGIVSNVLPPTPTRTYALIEYVCNPCVATLSCSSFFQHCRSRGVYFDTERDSGTVFLLA  1034
             L+    + L   P R + +  YV +P V T+  ++FF  CR  GV FD ER  GT+FLLA
Sbjct  1039  LA---KDSLAGAP-RCFVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLA  1094

Query  1035  DSLTAGVFGIMCISDTRKNALSNCRAAMEAIAGVAGTKMSVSKS  1078
             DSLTAGVFG++ I +T + AL+  R A+E I   AG+ +++  S
Sbjct  1095  DSLTAGVFGVLSIGETMEGALAFLRTALEVIGREAGSTINMVSS  1138

>PHYSO_321157
Length=1180

 Score = 566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/764 (40%), Positives = 444/764 (58%), Gaps = 41/764 (5%)

Query  338   YDFVIHQGIIDRKRPEFEAFQRIANPIWSSVDVVLEALARILSLYFIPIAYINGQRILTL  397
             + F+IH+G   R  PEF +F+R+A  +W SV+  L AL  +L+ YF+P+AY +GQR+L+L
Sbjct  404   HQFLIHKGRTMRDTPEFVSFRRVAQELWGSVEEALRALETLLTQYFVPLAYADGQRLLSL  463

Query  398   AQADNVPLTTKDLISCIRNEDEVKMLLSKPGQRFQGAERTKRATIALQSFIRMAMHRKRF  457
             A       + ++L+SCI NE++V  +L +PGQR++G +R +RA   +Q+ +RM   R+R+
Sbjct  464   ASTGQPRFSKRELLSCIVNEEQVMAVLRRPGQRYKGRDRKRRAATTIQACVRMWSIRRRY  523

Query  458   LVMRYKYWKVTAIQRNWRRFSAHKATKLKIEAKREHQEMVFTDSMRSFCSNWDKIRMQRR  517
             +  R   +  T IQ  WR FS H A K ++   R  Q   +   M    + W +I  +RR
Sbjct  524   VRSRASDFSATKIQLAWRAFSCHAALKARLRELRREQLDNWEAKMNDLKTQWHQIAGRRR  583

Query  518   TIIHIPSISIDSRQRMKTEQFSIQQNLQLQRLCAV-IDENVEL-IYICPFELTDDIVQYY  575
              ++H+PS+S+D   R+  E F++QQNLQL R+CA  +D NV+L +Y+ PFELT D+  Y+
Sbjct  584   VVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSNVDLLVYVAPFELTADVSHYF  643

Query  576   MKLLQLGGISDAAARIKLICPENASRFPSHFSLSSVVLYSPRTLNRLSRCIRGRNAYMVP  635
             +KLLQLGG++D+  R+KL+ PE A+RFP+HFSLSSV+LYSP  L R+     G++AY+V 
Sbjct  644   LKLLQLGGLADSRPRVKLVFPEQAARFPAHFSLSSVLLYSPHCLRRIRHYTAGKDAYLVM  703

Query  636   GFPGLEDKRVATILGVPILGLDSTKSLQATTYSGSKRYFRKANVNTLPACIDLYDENELI  695
             G PG ED+R+A  L +PILG    ++L   T SG KR   +A+VN      +LYDE+EL 
Sbjct  704   GLPGTEDQRLAIALDLPILGAPPPQALPLLTRSGGKRLLIRADVNVPTGTYELYDEHELF  763

Query  696   FSLAKLVASHPHQLSVVLRLDYDPFGTGIALMDISRLQSVKEVRLRTKTLESWLQPPIQA  755
              +LAKL  +H  Q   +L+LDYDP G G A++D+S +Q+++E+R   KT E W QP  + 
Sbjct  764   AALAKLAVAHMDQPRWLLKLDYDPLGVGEAVVDLSGMQAMRELRREKKTPEYWRQPGPRD  823

Query  756   KLIRNLVLEMQ--NNISSFIFVVHPEIFPSSKSFLQAIRIYGVIIELSPKK---------  804
                + ++ E++    ++     +H EIFPS + + +AI  +G ++E  P           
Sbjct  824   AASKLVLAELERPGVLARLATPMHTEIFPSWREYTEAISHFGCVVEAVPPTSFVASPETA  883

Query  805   ----RQGHVRANLFIEPSRRVCVSSTHEIHSLETDTKIDDRVRKFGLDKASAAKMRTFGV  860
                    +VRANLFI+P   V ++ST  +                 L        +T   
Sbjct  884   SSSVEPAYVRANLFIDPDGTVHITSTQNV-----------------LASGGGLNRKTVAF  926

Query  861   TFPQTLIDHEVLKDASLAIGQALAKDGICGYISVDFVVCLDDQTQKKT-LYATGLQPFLT  919
             TFPQT+  HE +K A  A G+ L +  + GY+S+DFVV  DD++     L+A  + PFLT
Sbjct  927   TFPQTVAPHEAVKGACTAAGKLLVETNVWGYVSLDFVVFQDDKSGGAPRLWALAVHPFLT  986

Query  920   NTAASFALFQLLSRGGSYNSMTGSLHLPQEVPLVGVQNDPPSSLSATDLMIREARLSGIV  979
             ++AASFA F LL+RG    S  G         L  V +        TDL++REA L+   
Sbjct  987   DSAASFACFHLLARGVLDASSGGYRMAAANSTLAAVNSGRSGGGGTTDLLLREASLAKGA  1046

Query  980   SNVLPPTPTRTYALIEYVCNPCVATLSCSSFFQHCRSRGVYFDTERDSGTVFLLADSLTA  1039
                 P    R Y +  YV +P V T+  ++FF  CR  GV FD ER  GT+FLL DSLTA
Sbjct  1047  QAGTP----RCYVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLTDSLTA  1102

Query  1040  GVFGIMCISDTRKNALSNCRAAMEAIAGVAGT--KMSVSKSSDG  1081
             GVFG++ + +T   AL+  R A+E I   AG   +M+ S S  G
Sbjct  1103  GVFGVLSVGETTDGALAFMRTALEVIGREAGATVEMATSPSRPG  1146

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 69/288 (24%), Positives = 123/288 (43%), Gaps = 54/288 (19%)

Query  1    MDHLEQKHHTEDIGRILLQTQQELREIRAEISGRKQTTETYIADATPFEDYPAPIVSVNP  60
            M+ ++Q+HH ED+GR+LLQTQ++LR +R +++      E   +        P    +V  
Sbjct  1    MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANAS--------PMRHSAVVT  52

Query  61   SKDLETLQNILDRAEREIQAKVDLLYKGVAHYGRKTQ-------TGLPF--VASPP--RQ  109
            + +++    IL + E E++AK +L+  G+ +     Q       T LP   VA+PP  R 
Sbjct  53   TAEVQAFNAILQQTEAELRAKAELVLNGMVNSSSSAQNNQSQSGTLLPAVTVAAPPSTRH  112

Query  110  IPSSANSSLERKSSFQELSVDLIRKQLH--SVKEKYKCLP--------------------  147
                A   + +      + ++  R+Q    SV+ +   +P                    
Sbjct  113  RSGYAKPRVAKSMDASSIPMEFFREQFRNSSVEVRQTLMPSPLHLQRHLGIHHGRLMRKK  172

Query  148  TKQHSEL------ISPKRPTQGLLTSKPSKKRYNASLRSLPTVQRGEAGDFSSASRDQIG  201
            T QH  L      + P  PT       P  +  +A    L  V RG    ++  +    G
Sbjct  173  TTQHCRLLPSVNKVDPSAPT-------PELREEDAKHGVLNLVTRGFLPAYADLTPAFAG  225

Query  202  EASNTLSVNDRVLMQRTAHLHNRMEEPIKTTPYTTAISHNMMSVKFDF  249
             +         V+ QR   +H+R E+ ++ TP+T +  +N+ ++KFD 
Sbjct  226  PSGANDGSGGGVMKQRATRIHDRSEQSVRPTPFTQSTGYNLAALKFDL  273

>SPRG_06354
Length=884

 Score = 554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/901 (36%), Positives = 495/901 (55%), Gaps = 66/901 (7%)

Query  221   LHNRMEEPIKTTPYTTAISHNMMSVKFDFMTPTSQSPCGKMQTQEKIVLTNDLQSKQRNG  280
             L++R E+P+K+ PY  +   N+ S+K D   P ++         + +  T    +++R  
Sbjct  8     LYDRSEQPVKSQPYMNSSGFNVASLKLDLAPPPTEP--------DAVPPTRPAVARKRKS  59

Query  281   ALLANQISLSPGGGCREDDSRFSPGRDPSKKIGIIKAITPI--FLNDVTK-SLVGEISKT  337
              +   Q+S     G +++     P  DP+   G I+    I    N+V K     ++  T
Sbjct  60    TVATVQLSFP---GAKDELVDAVPVEDPATDDGPIEPTDTIDELRNNVEKIRGYNDLLDT  116

Query  338   YD---FVIHQGIIDRKRPEFEAFQRIANPIWSSVDVVLEALARILSLYFIPIAYINGQRI  394
             Y    F+I +G    + PEF +F+RI   +W SV + +  L  +L  Y +P+AYI+GQ++
Sbjct  117   YSLHQFIIRKGQTLSETPEFISFKRITEDLWGSVSMAIRELETLLVHYSVPLAYIDGQKL  176

Query  395   LTLAQADNVPLTTKDLISCIRNEDEVKMLLSKPGQRFQGAERTKRATIALQSFIRMAMHR  454
             L +A  D V  +  +L++C+ N DEV   +++PGQRF+G +    A I +QS  RM  HR
Sbjct  177   LKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGGDGRHAAAIVIQSVYRM--HR  234

Query  455   -KRFLVMRYKYWKVTAIQRNWRRFSAHKATKLKIEAKREHQEMVFTDSMRSFCSNWDKIR  513
              +R L   + +   T IQR +R +   K  ++K+   RE     +   M +F +NWDKI+
Sbjct  235   TRRLLRQHHGHSYATHIQRVYRTYKCVKDIQVKLRLAREADARTWETQMTTFHANWDKIK  294

Query  514   MQRRTIIHIPSISIDSRQRMKTEQFSIQQNLQLQRLCAVIDENVELIYICPFELTDDIVQ  573
             MQRR ++H+PS S + R R+  + F+I+QNLQ+ RLCA+ D NV++IYI PFEL+ DI +
Sbjct  295   MQRRVVVHVPSFSAEERARLNMDNFAIRQNLQMARLCAIADPNVDVIYISPFELSVDIQK  354

Query  574   YYMKLLQLGGISDAAARIKLICPENASRFPSHFSLSSVVLYSPRTLNRLSRCIRGRNAYM  633
             Y M+LLQLGG++D  +R++++ PENA RFP HFSL++++LYSP  L ++ R +RG+ AY+
Sbjct  355   YMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLATILLYSPHCLKKIKRYVRGKEAYI  414

Query  634   VPGFPGLEDKRVATILGVPILGLDSTKSLQATTYSGSKRYFRKANVNTLPACIDLYDENE  693
             V G  G EDKR+A  L +P+LG+D  ++L   T SG+KR F +A+VN      D+YDE+E
Sbjct  415   VAGTVGPEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKRLFTQADVNIPYGAHDIYDEDE  474

Query  694   LIFSLAKLVASHPHQLSVVLRLDYDPFGTGIALMDISRLQSVKEVRLRTKTL---ESWLQ  750
             LI SLAKL A++ HQ   +++LD DP  TG+A +D+  L+ V +VR   + +   E + Q
Sbjct  475   LILSLAKLTAANLHQGMWLIKLDADPSDTGLAAIDMHALECVNKVRAEKRAMKNDEYYSQ  534

Query  751   PPIQAKLIRNLVLEMQNNISSFIFVVHPEIFPSSKSFLQAIRIYGVIIELSPKKRQGHVR  810
             P I+  ++R +V E+       I    P+++P+ +     +   G +IE  P K    VR
Sbjct  535   PNIKEGIVRAIVAELSEQFHRLISPCFPDVYPTWQHMRPVVNRIGAVIEAYPPKVLARVR  594

Query  811   ANLFIEPSRRVCVSSTHE--IHSLETDTKIDDRVRKFGLDKASAAKMRTFGVTFPQTLID  868
             AN+FIEPS  V V+S  E  +H                       K ++ G  +P T + 
Sbjct  595   ANVFIEPSGGVHVTSAQEQLMHVKN--------------------KHQSVGAVYPPTAVP  634

Query  869   HEVLKDASLAIGQALAKDGICGYISVDFVVCLDDQTQKKT-------LYATGLQPFLTNT  921
             +  ++ ASLA+ QA+   GI GY S+D+V  LD +T           L+A  L P LT T
Sbjct  635   YAAIRGASLAVAQAMYASGIIGYASIDYVAFLDVKTVNGKAGPPHLRLWALQLLPCLTPT  694

Query  922   AASFALFQLLSRGGSYNSMTGSLHLPQEVPLVGVQNDPPSSLSATDLMIREARLSGIVSN  981
             A SF LF  LS   + ++ TG   LP   P       PP    AT+  +   ++ G  S 
Sbjct  695   AMSFVLFTFLS-CATLDAATGRSFLPLPAPRPSSLAGPP----ATETQLAVEKILGESSP  749

Query  982   VLPPTPTRTYALIEYVCNPCVATLSCSSFFQHCRSRGVYFDTERDSGTVFLLADSLTAGV  1041
                    R Y   EY+ +P +ATL  + FF  CR  GV FD ++  G  F+LADSLTAGV
Sbjct  750   AATMGAERAYIAHEYIFHPNMATLQYAVFFNMCRVHGVSFDLQKSIGAAFVLADSLTAGV  809

Query  1042  FGIMCISDTRKNALSNCRAAMEAIAGVAGTKMSVSKSSDGMNELIRTDRMRDQFSEILRA  1101
              G++CI ++ K A+   RAA+E I    G ++ V  + D +     T      F+ +L A
Sbjct  810   VGLLCIGESDKEAVRLTRAALELI----GDQVGVQPAPDAL-----TGERLGNFAAVLGA  860

Query  1102  L  1102
             +
Sbjct  861   I  861

>PHALS_06477
Length=1166

 Score = 554 bits (1428),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 368/1155 (32%), Positives = 589/1155 (51%), Gaps = 115/1155 (10%)

Query  1     MDHLEQKHHTEDIGRILLQTQQELREIRAEISGRKQTTETYIADATPFEDYPAPIVSVNP  60
             M+ ++Q +H ED+GR+LL+TQ++LR +R +++    + E   A+ +P         SV  
Sbjct  16    MEKVQQHYHVEDVGRLLLETQEQLRAMREQMTAAAASME---ANKSPKRH-----SSVIT  67

Query  61    SKDLETLQNILDRAEREIQAKVDLLYKGV---------AHYGRKTQTGLPFVASPP----  107
             + +++    +L + E E++AK +L+  G+         +   R T+     VA+P     
Sbjct  68    NAEVQAFHALLQQTESELRAKAELVLNGIINSSNSVHNSQVQRNTRLPAVSVAAPSPIKH  127

Query  108   -------------RQIPSSANSSLERKSSFQELSVDLIRKQLHSVKEKYKCLP-------  147
                           +I +++ S    +  F+   V+ IR+ L +  E ++          
Sbjct  128   RRGDSRADEFGHINRIDNNSTSMEFFRQQFRNNRVE-IRQSLMTSPENWRRKSGARRVRK  186

Query  148   -TKQHSELI------SPKRPTQGLLTSKPSKKRYNASLRSLPTVQRGEAGDFSSASRDQI  200
              T QH  L+       P  PT       P  +  +A+   L  V RG    ++  +    
Sbjct  187   KTTQHYRLLPCVNKADPSEPT-------PDLREEDATCGLLNLVTRGFLPAYADLTPAFA  239

Query  201   GEASNTLSVNDRVLMQRTAHLHNRMEEPIKTTPYTTAISHNMMSVKFDFMTPTSQSPCGK  260
             G    +       L  R  ++++R +   + TP   +I  N+  +KFDF T ++ S   K
Sbjct  240   GPNGKSNGSGGCALKHRATYIYDRSKRSARCTPLVYSIGFNLAGLKFDFRTSSTPSSAPK  299

Query  261   MQTQEKIVLT------NDLQSKQRNGALLANQISLSPGGGCRED----------DSRFSP  304
                   +  +      + +     +G    N + ++      ED          D     
Sbjct  300   PNHSATVSASMPNTKFSSIMQTVSSGPAKRNSLVVAAPRNQNEDIENNCTHSFEDQEDEE  359

Query  305   GRDPSKKIGIIKAITPIFLNDVTK-----SLVGEISKTYDFVIHQGIIDRKRPEFEAFQR  359
             G D S  I      T     +V K      LV   S  +  +I++G   R  PEF +F+R
Sbjct  360   GSDDSDIIKDEGFSTKDLAVNVAKIREYNDLVDAYS-LHQILIYKGRAIRDTPEFTSFRR  418

Query  360   IANPIWSSVDVVLEALARILSLYFIPIAYINGQRILTLAQADNVPLTTKDLISCIRNEDE  419
             + + +W SV+ VL AL  IL  YF+P+A+++GQR++ LA  +    + ++L+SCI N+++
Sbjct  419   VVHDLWGSVEEVLRALEAILFQYFVPLAHVDGQRLIALASTNQPQFSRRELLSCIVNKEQ  478

Query  420   VKMLLSKPGQRFQGAERTKRATIALQSFIRMAMHRKRFLVMRYKYWKVTAIQRNWRRFSA  479
             V  +L +PGQR+ G +R  RA   +Q+  RM M   R++  R        IQ  +R +S 
Sbjct  479   VMSVLRRPGQRYNGRDRKHRAATTIQACARMWMVHHRYVKSRSSNINAIKIQSAFRAYSR  538

Query  480   HKATKLKIEAKREHQEMVFTDSMRSFCSNWDKIRMQRRTIIHIPSISIDSRQRMKTEQFS  539
               A K ++   R  +   +   M  F S W +I  +RR ++H+PS+S+    R+  E F+
Sbjct  539   CTALKARLREIRCEKAAKWEARMYEFKSQWSQIAARRRIVVHVPSMSLGEHSRLNAENFA  598

Query  540   IQQNLQLQRLC-AVIDENVE-LIYICPFELTDDIVQYYMKLLQLGGISDAAARIKLICPE  597
             +QQNLQL R+C A +D  V+ L+Y+ P+ELT D+ QY+ KLLQL G +D+  R+K + PE
Sbjct  599   VQQNLQLTRICAAALDLQVDLLVYVSPYELTADVSQYFHKLLQLSGPADSRPRVKFVYPE  658

Query  598   NASRFPSHFSLSSVVLYSPRTLNRLSRCIRGRNAYMVPGFPGLEDKRVATILGVPILGLD  657
              A+RFP+HFSLSS++LYSP  L R+     G  AY+V G PG ED+R+A  L +PILG  
Sbjct  659   QAARFPAHFSLSSLILYSPYCLRRIRHYTAGNEAYLVMGLPGPEDQRLAITLDLPILGAL  718

Query  658   STKSLQATTYSGSKRYFRKANVNTLPACIDLYDENELIFSLAKLVASHPHQLSVVLRLDY  717
              +++L   T SG KR   +A++N      +LYDE+E+  +LAKL  +H  Q   +++LDY
Sbjct  719   PSQALPLLTRSGGKRLLIQADINVPTGTYELYDEHEISVALAKLAVAHIDQSKWLIKLDY  778

Query  718   DPFGTGIALMDISRLQSVKEVRLRTKTLESWLQPPIQAKLIRNLVL---EMQNNISSFIF  774
             DP G G A++D+S +Q+++E+    +T E W QP  +     NL L   E    ++    
Sbjct  779   DPLGVGEAVVDLSSMQAMRELHREKRTPEYWRQPGTR-DAAANLFLTEFERPGKLARLTT  837

Query  775   VVHPEIFPSSKSFLQAIRIYGVIIELSPKKRQG-------HVRANLFIEPSRRVCVSSTH  827
              +H E++P+ + +  AI  +G +IE  P            ++RAN+F++P+  V ++ST 
Sbjct  838   PIHTELYPTWREYAAAIGHFGCVIEAVPPTASAASMEEPTYLRANIFVDPNGTVHMTSTQ  897

Query  828   EIHSLETDTKIDDRVRKFGLDKASAAKMRTFGVTFPQTLIDHEVLKDASLAIGQALAKDG  887
              + +            + GL + S          FPQT+  H  +K A  A+G+ LA+  
Sbjct  898   NVLT----------TTRGGLSRKSEI------FAFPQTVAPHAAIKGACNAVGKQLAETN  941

Query  888   ICGYISVDFVVCLDDQTQKKT-LYATGLQPFLTNTAASFALFQLLSRGGSYNSMTGSLHL  946
             + GY+S+DFVV  D ++     L+A  + PFLTN+AA+FA F LL+R G  ++ +G   +
Sbjct  942   VWGYVSLDFVVFQDIKSNAAVRLWALAIHPFLTNSAATFACFHLLTR-GCLDANSGIYRV  1000

Query  947   PQEVPL-VGVQNDPPSSLSATDLMIREARLSGIVSNVLPPTPTRTYALIEYVCNPCVATL  1005
             P    L      +   +  A DL++REA L+  +        TR Y +  YV +P V   
Sbjct  1001  PGTKKLQTACTAEQSGNHDAMDLLLREASLTKAIFQ----GATRCYVVCSYVFHPNVTAT  1056

Query  1006  SCSSFFQHCRSRGVYFDTERDSGTVFLLADSLTAGVFGIMCISDTRKNALSNCRAAMEAI  1065
               ++FFQ+CR  GV FD  R  GT+FLLADSLTAGVFGI+ I +T ++ALS  R A+E I
Sbjct  1057  QYTTFFQNCRLHGVCFDVSRALGTLFLLADSLTAGVFGILSIGETAQDALSYLRTALEVI  1116

Query  1066  AGVAG-TKMSVSKSS  1079
                AG TK  VS SS
Sbjct  1117  GREAGATKGIVSSSS  1131

>H310_09212
Length=1113

 Score = 550 bits (1418),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 374/1150 (33%), Positives = 581/1150 (51%), Gaps = 154/1150 (13%)

Query  1     MDHLEQKHHTEDIGRILLQTQQELREIRAEISGRKQTTETYIADATPFEDYPAPIVSVNP  60
             M+ L Q++H ED+GRILLQ Q ELR +R +                         V  N 
Sbjct  1     MEKLCQQYHAEDVGRILLQAQDELRSMREK-------------------------VHENN  35

Query  61    SKDLETLQNILDRAEREIQAKVDLLYKGVAHYGRKTQTGLPFVASPPRQ-IPSSANSSLE  119
             + D+  +  IL+RAE +++AK +++  GV +   K    LP + +P  Q   S  +S L 
Sbjct  36    NLDVNQIHAILERAEADLRAKAEIVLNGVVNNSMKM---LPAIDAPGGQRYLSKFSSKLA  92

Query  120   RKSSFQELSVDLIRKQLHSVKEKYKCLPT--KQHSELISPKRPTQ---------------  162
             +K   ++L+  + R+  +          T  ++H  L  P  P +               
Sbjct  93    QK---RDLAATMARENTYEPGSPTYGHDTSYREHPSLSGPIEPMERDRTPGRRPVGRIVK  149

Query  163   --GLLTSKPSKKRYNASLRSLPTVQRGEAGDFSSA--SRDQIGEASNTLS----------  208
                L+  K +K R     R LP + R +      A    D  G   N L+          
Sbjct  150   AGSLVKHKTTKPR-----RILPKMNRLDPTAPPPALLDDDARGGVHNLLTRGFLPPSVDV  204

Query  209   ----VNDRVLMQRT-AHLHNRMEEPIKTTPYTTAISHNMMSVKFDFMTPTSQS-------  256
                  +   ++Q T   +++R  +P+K+ PYT     NM S+KFD +TPT  +       
Sbjct  205   TPAFTHGTSVIQNTRVKIYDRASQPVKSMPYTNPSGFNMASLKFDMVTPTPPTVANVPIN  264

Query  257   -----PCGKMQTQEKIVLTNDLQSKQRNGALLANQISLSPGGGCREDDSRFSPGRDPSKK  311
                  P  K      I +T D  +         N +   P         +   G DPS K
Sbjct  265   QGGDIPPSKTSIPTPIDITFDGHAN--------NAVPFRP--------EQPKGGNDPSGK  308

Query  312   IGIIKAITPIFLNDVT---------KSLVG--EISKTYD---FVIHQGIIDRKRPEFEAF  357
                  A      ND T         + + G  E+  TY    F+I +G      PEF +F
Sbjct  309   -DCASADDGAGGNDSTSIHNLRRNVEKIRGYNELLDTYSLHQFIIRKGKTLADTPEFISF  367

Query  358   QRIANPIWSSVDVVLEALARILSLYFIPIAYINGQRILTLAQADNVPLTTKDLISCIRNE  417
             QR    +W SV   ++ L  +L+ Y +P+AY++GQ+++ +A  D     T +L+SCI N 
Sbjct  368   QRTTEDLWGSVSKSIQELEAMLTNYSVPLAYVDGQKLMKIAAMDGTARGTMELLSCILNM  427

Query  418   DEVKMLLSKPGQRFQGAERTKRATIALQSFIRMAMHRKRFLVMRYKYWKVTAIQRNWRRF  477
             DEV  L+ +PGQRF+G      A + LQS  RM + +KR L   +       IQR +R +
Sbjct  428   DEVSSLMRRPGQRFKGKSGPDLAAVLLQSVWRMYITKKR-LKNHHGNEDAAVIQRIYRSY  486

Query  478   SAHKATKLKIEAKREHQEMVFTDSMRSFCSNWDKIRMQRRTIIHIPSISIDSRQRMKTEQ  537
                   + ++++ RE    ++   M+ F +NWD I+MQRR ++H+PS S + R R+K E 
Sbjct  487   RCFSQLQQRLKSVREADLRIWDAQMQRFRANWDSIKMQRRVVVHVPSFSSEERTRLKMEN  546

Query  538   FSIQQNLQLQRLCAVIDENVELIYICPFELTDDIVQYYMKLLQLGGISDAAARIKLICPE  597
             FSIQQNLQ+ R+CA+ D NV++IYI PFEL+ DI +Y ++LLQLGGI+D   RI+++ PE
Sbjct  547   FSIQQNLQMARMCAIADPNVDIIYISPFELSPDIQKYQVRLLQLGGIADPQTRIRMLHPE  606

Query  598   NASRFPSHFSLSSVVLYSPRTLNRLSRCIRGRNAYMVPGFPGLEDKRVATILGVPILGLD  657
             N  RFP HFSL++V+LYSP  L ++ R +RG++AY+V G  G EDKR+A  L +P+LG+D
Sbjct  607   NVDRFPEHFSLTTVLLYSPHCLKKIKRFVRGKDAYIVTGNVGPEDKRLAIALQLPLLGMD  666

Query  658   STKSLQATTYSGSKRYFRKANVNTLPACIDLYDENELIFSLAKLVASHPHQLSVVLRLDY  717
               K+L   T SG KR F  A+VN      D+YDE+ELI SL+KL+A+   Q   ++++D 
Sbjct  667   PDKALLYGTRSGGKRIFMAADVNIPMGAHDIYDEDELIQSLSKLIAADIDQTEWLIKIDA  726

Query  718   DPFGTGIALMDISRLQSVKEVRLRTKTL-----ESWLQPPIQAKLIRNLVLEM-QNNISS  771
             D   TGIA +++ ++QSV + R   + +     E + QP ++  ++R++  E+ ++  ++
Sbjct  727   DQSNTGIASLNVDKMQSVAKFRAEKREMKHGAAEYFQQPDVRDAVLRSVYSELNESYFAA  786

Query  772   FIFVVHPEIFPSSKSFLQ-AIRIYGVIIELSPKKRQGHVRANLFIEPSRRVCVSSTHEIH  830
              +    PE++ S  +    A+R+ GV+IE  P K   HVR N+FIEPS  V ++S H++ 
Sbjct  787   NVTPCFPEMYASWAAMRPIALRV-GVVIEAYPSKVLSHVRTNIFIEPSGGVHITSAHDVF  845

Query  831   SLETDTKIDDRVRKFGLDKASAAKMRTFGVTFPQTLIDHEVLKDASLAIGQALAKDGICG  890
                 +  +                       FPQ+ + ++ ++ ASLAI  ++   GI G
Sbjct  846   MCPVNKHLPQ------------------CAVFPQSSVPYQAIRGASLAIASSMFIKGIIG  887

Query  891   YISVDFVVCLDDQTQ-----KKTLYATGLQPFLTNTAASFALFQLLSRGGSYNSMTGSLH  945
             Y S+D++   D +       ++ L+A  + P LTNTA SF +F  LS    +N +TG  H
Sbjct  888   YASIDYISFADPKAMVSGRPRQRLWAMQVVPGLTNTAVSFVMFAFLS-CSQFNPITGKSH  946

Query  946   L---PQEVPLVGVQNDPPSSLSATDLMIREARLSGIVSNVLPPTPTRTYALIEYVCNPCV  1002
             L   P  V  +   N P +        I     S   ++V    P RTY +++Y+ +P +
Sbjct  947   LQVAPAPVATLSTANAPITPTQQEIATILSPPSSAAAASVC--GPERTYMVLDYIYHPNM  1004

Query  1003  ATLSCSSFFQHCRSRGVYFDTERDSGTVFLLADSLTAGVFGIMCISDTRKNALSNCRAAM  1062
             ATL  ++FF  CR  GV FD +R  G  ++LADSLTAGV G++CI ++ K A    R A+
Sbjct  1005  ATLQFATFFNTCRLHGVSFDLQRAIGAAYILADSLTAGVVGLICIGESDKEAFRIARQAV  1064

Query  1063  EAIAGVAGTK  1072
             E I    G +
Sbjct  1065  ELIGDQVGVQ  1074

>H257_06305
Length=1099

 Score = 547 bits (1409),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 369/1136 (32%), Positives = 578/1136 (51%), Gaps = 140/1136 (12%)

Query  1     MDHLEQKHHTEDIGRILLQTQQELREIRAEISGRKQTTETYIADATPFEDYPAPIVSVNP  60
             MD L Q++H ED+GRILLQ Q ELR +R +++ +                          
Sbjct  1     MDKLCQQYHAEDVGRILLQAQDELRSMREKVNEKNNV-----------------------  37

Query  61    SKDLETLQNILDRAEREIQAKVDLLYKGVAHYGRKTQTGLPFVASPPRQIPSSANSS---  117
               D+  +  IL+RAE +++AK +++  GV +   K    LP + +P  +   S  SS   
Sbjct  38    --DVNEINAILERAEADLRAKAEIVLNGVVNNSMKM---LPAIEAPGGKTSLSKFSSKLA  92

Query  118   --------LERKSSFQELSVDLIRKQLHSVKEKYKCLPTKQHSELISPKRPTQGLLTSKP  169
                     + R SS++  S    ++     +E     P +      +P R   G +    
Sbjct  93    QKRELAATMTRDSSYEPASPTYRQED----REPRFGGPIEPMERDRAPGRRPVGRIIKAG  148

Query  170   S--KKRYNASLRSLPTVQRGEAGDFSSASRDQIGE--------------------ASNTL  207
             S  KK+     R LP + R    D ++ S D + E                     +   
Sbjct  149   SLVKKKTTKPHRLLPKMNRT---DPTAPSPDLVEEDARGGVHNLVTRGFLPPSVDVTPAF  205

Query  208   SVNDRVLMQRTAHLHNRMEEPIKTTPYTTAISHNMMSVKFDF-MTPTSQSP------CGK  260
             +    V+      +++R  +P+K+ PYT     NM S+KFD   TP + +P         
Sbjct  206   THGTSVIQNSRVKIYDRASQPVKSMPYTNPSGFNMASLKFDMSTTPATSTPSPVAAVVSG  265

Query  261   MQTQEKIVLTNDLQSKQRNGALLANQISLSPGGGCREDDSRFSPGRDPSKKIGIIKAITP  320
                 + +V   D+     + +     +    GG    DD+    G D S    + + +  
Sbjct  266   GDVSKMVVTPIDISFDAPSSS--HPPVEQPKGGATGGDDTN---GGDSSTIHNLRRNVEK  320

Query  321   IFLNDVTKSLVGEISKTYD---FVIHQGIIDRKRPEFEAFQRIANPIWSSVDVVLEALAR  377
             I           E+  TY    F+I +G      PEF +FQR    +W SV   ++ L  
Sbjct  321   I-------RGYNELLDTYSLHQFIIRKGKTLSDTPEFISFQRTTEDLWGSVSTSIQELET  373

Query  378   ILSLYFIPIAYINGQRILTLAQADNVPLTTKDLISCIRNEDEVKMLLSKPGQRFQGAERT  437
             +L+ Y +P+AY++GQ+++ +A  D     T +L+SCI N DEV  L+ +PGQR++G++  
Sbjct  374   MLTSYSVPLAYVDGQKLMKIAAMDATTRGTTELLSCILNMDEVSSLMRRPGQRYKGSQGP  433

Query  438   KRATIALQSFIRMAMHRKRFLVMRYKYWKVTAIQRNWRRFSAHKATKLKIEAKREHQEMV  497
               A + +QS  RM + +KR L   +       IQR +R +      + +++  RE    +
Sbjct  434   DLAVVLIQSVWRMFLTKKR-LKNHHGNEDAAVIQRIYRSYRCFSQLQQRLKLVREADLRI  492

Query  498   FTDSMRSFCSNWDKIRMQRRTIIHIPSISIDSRQRMKTEQFSIQQNLQLQRLCAVIDENV  557
             +   M+ F +NWD ++MQRR ++H+PS + D R R+K + FSI+QNLQ+ R+CA+ D NV
Sbjct  493   WDAQMQRFRANWDTMKMQRRVVVHVPSFASDDRTRLKMDNFSIRQNLQMARMCAIADPNV  552

Query  558   ELIYICPFELTDDIVQYYMKLLQLGGISDAAARIKLICPENASRFPSHFSLSSVVLYSPR  617
             ++IYI PFEL+ DI +Y ++LLQLGGI+D   RI+++ PEN  RFP HFSL++++LYSP 
Sbjct  553   DIIYISPFELSPDIQRYQVRLLQLGGITDPQTRIRMLHPENVDRFPEHFSLTTLLLYSPH  612

Query  618   TLNRLSRCIRGRNAYMVPGFPGLEDKRVATILGVPILGLDSTKSLQATTYSGSKRYFRKA  677
              L ++ R +RG+NAY+V G  G EDKR+A  L +P+LG+D  K+L   T SG KR F  A
Sbjct  613   CLKKIKRFVRGKNAYIVTGNVGPEDKRLAIALQIPLLGMDPDKALLYGTRSGGKRIFMAA  672

Query  678   NVNTLPACIDLYDENELIFSLAKLVASHPHQLSVVLRLDYDPFGTGIALMDISRLQSVKE  737
             +VN      D+YDE+ELI SL+KL+A+   Q   ++++D D   TGIA +++ ++QSV +
Sbjct  673   DVNIPMGAHDIYDEDELIQSLSKLIAADVDQNEWLVKIDADQSDTGIASINVQQMQSVAK  732

Query  738   VRLRTKTL-----ESWLQPPIQAKLIRNLVLEM-QNNISSFIFVVHPEIFPSSKSFLQAI  791
             VR   + +     E + QP ++  ++R++  E+ ++  ++ I    P+++ S        
Sbjct  733   VRAEKRDMKHMAAEYFQQPDVRDAVLRSIFNELTESYFAANITPCFPDVYASWAELRPVA  792

Query  792   RIYGVIIELSPKKRQGHVRANLFIEPSRRVCVSSTHEIHSLETDTKIDDRVRKFGLDKAS  851
                GV+IE  P K    VRAN+FIEPS  V ++S H++                    + 
Sbjct  793   LRVGVVIEAYPSKVLSQVRANVFIEPSGGVHITSAHDLF------------------MSP  834

Query  852   AAKMRTFGVTFPQTLIDHEVLKDASLAIGQALAKDGICGYISVDFVVCLDDQT------Q  905
             A K       FPQT + ++ ++ ASLAI  ++   GI GY S+D++   D +T       
Sbjct  835   ANKHLPQCALFPQTSVPYQAIRGASLAIASSMFIKGIIGYASIDYMSFADPKTLVGGGRP  894

Query  906   KKTLYATGLQPFLTNTAASFALFQLLSRGGSYNSMTGSLHLPQEVPLVGVQNDPPSSLSA  965
             ++ L+A  + P LTNTA SF +F  LS    +N +TG  HL        V   PP + SA
Sbjct  895   RQRLWAMQVVPGLTNTAVSFVMFAFLS-CSQFNPITGKCHL-------QVAAPPPIAASA  946

Query  966   TDLMIREARLSGIVSNVL---PPT------PTRTYALIEYVCNPCVATLSCSSFFQHCRS  1016
             T   I +A+ +  V  +L   PP       P RTY +++Y+ +P +ATL  S+FF  CR 
Sbjct  947   TVAPITQAQKA--VETILSARPPNGAVVCGPERTYMVLDYIYHPNMATLHFSTFFNTCRL  1004

Query  1017  RGVYFDTERDSGTVFLLADSLTAGVFGIMCISDTRKNALSNCRAAMEAIAGVAGTK  1072
              GV FD +R  G  F+LADSLTAGV G+MCI +  K A    R A+E I    G +
Sbjct  1005  NGVSFDLQRAIGAAFILADSLTAGVMGLMCIGENDKEAFRIARQAVELIGDQVGVQ  1060

>PITG_18457
Length=1170

 Score = 530 bits (1366),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 301/769 (39%), Positives = 450/769 (59%), Gaps = 49/769 (6%)

Query  333   EISKTYDFVIHQGIIDRKRPEFEAFQRIANPIWSSVDVVLEALARILSLYFIPIAYINGQ  392
             ++   + F+IH+G   R  PEF +F+R+   +W SV+  L AL  +L+ YF+P+AY++GQ
Sbjct  389   DVYSLHQFLIHKGRTMRDTPEFVSFRRVTQELWGSVEEALRALETLLAQYFVPLAYVDGQ  448

Query  393   RILTLAQADNVPLTTKDLISCIRNEDEVKMLLSKPGQRFQGAERTKRATIALQSFIRMAM  452
             R+L LA       + ++L+SCI NED+V  +L +PGQR++G +R +RA   +++ +RM +
Sbjct  449   RLLALAGTGQPRFSKRELLSCIVNEDQVMSVLRRPGQRYKGRDRKRRAATTIEACVRMWL  508

Query  453   HRKRFLVMRYKYWKVTAIQRNWRRFSAHKATKLKIEAKREHQEMV--FTDSMRSFCSNWD  510
              R+R+   R   +  + IQ  WR +S H  T LK   +  H E +  +   M +  S+W 
Sbjct  509   VRRRYARTRASDFNASKIQLAWRAYSCH--TSLKARLREVHLEKLEKWEKRMHNLKSHWP  566

Query  511   KIRMQRRTIIHIPSISIDSRQRMKTEQFSIQQNLQLQRLCAV-IDENVELI-YICPFELT  568
             +I  +RR ++H+PS+S+D   R+  E F+IQQNLQL R+CA  +D NVEL+ Y+ PFELT
Sbjct  567   QIAGRRRVVVHVPSLSLDEHSRLGAENFAIQQNLQLTRVCAAALDSNVELLLYVSPFELT  626

Query  569   DDIVQYYMKLLQLGGISDAAARIKLICPENASRFPSHFSLSSVVLYSPRTLNRLSRCIRG  628
              D+ QY++KLLQLGG+ D+  R+KL+ PE  +RFP+HFSLSS++LYSP  L R+     G
Sbjct  627   SDVSQYFLKLLQLGGLVDSRPRVKLVFPEQTTRFPAHFSLSSLLLYSPHCLRRIRHYTTG  686

Query  629   RNAYMVPGFPGLEDKRVATILGVPILGLDSTKSLQATTYSGSKRYFRKANVNTLPACIDL  688
             + AY+V G PG ED+R+A  L +PILG    ++L   T SG KR   +A+VN      +L
Sbjct  687   KEAYLVMGLPGAEDQRLAMALDLPILGAPPAQALPLLTRSGGKRLLIRADVNVPNGTYEL  746

Query  689   YDENELIFSLAKLVASHPHQLSVVLRLDYDPFGTGIALMDISRLQSVKEVRLRTKTLESW  748
             YDE+E+  +LAKL  +H  Q   +++LDYDP   G A++D+S +Q+++E+R   +T E W
Sbjct  747   YDEHEVCAALAKLAIAHMDQPRWLIKLDYDPLDVGEAVVDLSNMQAMRELRREKRTPEYW  806

Query  749   LQP---PIQAKLIRNLVLEMQNNISSFIFVVHPEIFPSSKSFLQAIRIYGVIIELSPKK-  804
              QP      AKLI    LE    ++     +  EIFP  + F+ A+  +G ++E  P   
Sbjct  807   RQPGPRDAAAKLIL-AELERPGMLARIATPMQTEIFPKWREFIDAVGHFGCVVEAVPPTA  865

Query  805   ------------RQGHVRANLFIEPSRRVCVSSTHEIHSLETDTKIDDRVRKFGLDKASA  852
                            +VRANLF++P   V +SST  + +              GL++   
Sbjct  866   IAASSEASTVLVEPAYVRANLFVDPDGSVHISSTQNVLAAGGG----------GLNR---  912

Query  853   AKMRTFGVTFPQTLIDHEVLKDASLAIGQALAKDGICGYISVDFVVCLDDQTQKKT-LYA  911
                +T   TFPQT   +E +K A  A G+ L +  + GY+S+DFVV  D+++     L+A
Sbjct  913   ---KTVAFTFPQTAAPYEAIKGACNAAGKLLVETNVWGYVSLDFVVFQDEKSNDAPRLWA  969

Query  912   TGLQPFLTNTAASFALFQLLSRGGSYNSMTGSLHLPQEVPLVGVQNDPPSSLSATDLMIR  971
               + PFLT++A SFA F LL+R G  ++ +G   +  +            S SATDL++R
Sbjct  970   LAVHPFLTDSATSFACFHLLAR-GVLDTNSGVYRVANKSLTTANSGRKSESGSATDLLLR  1028

Query  972   EARL--SGIVSNVLPPTPTRTYALIEYVCNPCVATLSCSSFFQHCRSRGVYFDTERDSGT  1029
             EA L  S +V         R +    YV +P V T+  ++FF  CR  GV FD ER  GT
Sbjct  1029  EALLAKSSLVG------ARRCFVACSYVFHPHVITMQYTAFFHACRLHGVCFDVERTLGT  1082

Query  1030  VFLLADSLTAGVFGIMCISDTRKNALSNCRAAMEAIAGVAGTKMSVSKS  1078
             +FLLADSLTAGVFGI+ I +T + AL+  R A+E I   AG+ +SV+ S
Sbjct  1083  LFLLADSLTAGVFGILSIGETTEGALAFLRTALEVIGREAGSTISVASS  1131

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 74/287 (26%), Positives = 129/287 (45%), Gaps = 58/287 (20%)

Query  1    MDHLEQKHHTEDIGRILLQTQQELREIRAEISGRKQTTETYIADATPFEDYPAPIVSVNP  60
            MD ++Q+HH ED+GR+LLQTQ++LR +R +++      E   +        P    ++  
Sbjct  1    MDKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANAS--------PMRHNAIVT  52

Query  61   SKDLETLQNILDRAEREIQAKVDLLYKGVAHY-----GRKTQTG--LPFV----------  103
            + +++    IL + E E++AK +L+  G+ +        + Q+G  LP V          
Sbjct  53   TAEVQAFNAILQQTETELRAKAELVLNGMVNSSSSARNNQAQSGTLLPAVTVAAAPSIMH  112

Query  104  ------ASPPRQIPSSANSSLERKSSFQELSVDLIRKQLHSVKEKYKCL--------PTK  149
                  A+ PRQ+ +S+      +  F+  SV+ IR+ L    E++  +         T 
Sbjct  113  RSGYDKANKPRQMDASSIPVEFFREQFRNNSVE-IRQSLPEPWERHFGIHHGRLMRKKTT  171

Query  150  QHSELI------SPKRPTQGLLTSKPSKKRYNASLRSLPTVQRGEAGDFSSASRDQIGE-  202
            QH  L+       P  PT       P  +  +A    L  V RG    F  A  D     
Sbjct  172  QHCRLLPSVNKTDPSVPT-------PELREEDAKHGVLNLVTRG----FLPAYADLTPVF  220

Query  203  ASNTLSVNDRVLMQRTAHLHNRMEEPIKTTPYTTAISHNMMSVKFDF  249
            +  +      V+ QR   ++NR E+ +++TP+T +  +N+ S+KFD 
Sbjct  221  SGTSDGSGGGVMKQRATRIYNRSEQVVRSTPFTQSTGYNLASLKFDL  267

>PHYCA_34475
Length=692

 Score = 496 bits (1277),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 290/732 (40%), Positives = 418/732 (57%), Gaps = 73/732 (10%)

Query  338   YDFVIHQGIIDRKRPEFEAFQRIANPIWSSVDVVLEALARILSLYFIPIAYINGQRILTL  397
             + F+IH+G   R  PEF +F R+A  +W SV+  L AL  +L+ YF+P+AY++GQR+L+L
Sbjct  13    HQFLIHKGRTMRDTPEFISFHRVAQELWGSVEEALRALETLLTHYFVPLAYVDGQRLLSL  72

Query  398   AQADNVPLTTKDLISCIRNEDEVKMLLSKPGQRFQGAERTKRATIALQSFIRMAMHRKRF  457
             A       + ++L+SCI NE++V   L +PGQR++G +R +RA   +Q+F+RM   R+R+
Sbjct  73    AATGQPRFSKRELLSCIVNEEQVMAALRRPGQRYKGRDRKRRAATTIQAFVRMWAARRRY  132

Query  458   LVMRYKYWKVTAIQRNWRRFSAHKATKLKIEAKREHQEMVFTDSMRSFCSNWDKIRMQRR  517
                R +    T IQ  WR +S H A K ++   R  Q   +   M    S W +I   RR
Sbjct  133   ARSRARDINATRIQLAWRAYSCHAALKARLREVRREQLEKWEARMHRLKSQWAQIASHRR  192

Query  518   TIIHIPSISIDSRQRMKTEQFSIQQNLQLQRLCAV-IDENVEL-IYICPFELTDDIVQYY  575
              ++H+PS+S+D   R+  E  +++QNLQL R+CA  +D  V+L +Y+ PFELT D+ QY+
Sbjct  193   VVVHVPSLSLDEYSRLSAENLAVRQNLQLTRICAAALDSRVDLLVYVSPFELTTDVSQYF  252

Query  576   MKLLQLGGISDAAARIKLICPENASRFPSHFSLSSVVLYSPRTLNRLSRCIRGRNAYMVP  635
             +KLLQLGG++D+  R+KL+ PE A+RFP+HFSLSS++LYSP  L R+     G+ AY+V 
Sbjct  253   IKLLQLGGLADSRPRVKLLFPEQATRFPAHFSLSSLLLYSPHCLRRIRHYTAGKEAYLVM  312

Query  636   GFPGLEDKRVATILGVPILGLDSTKSLQATTYSGSKRYFRKANVNTLPACIDLYDENELI  695
             G PG ED+R+A  L +PILG    ++L   T SG KR   +A+VN      +LYDE+EL 
Sbjct  313   GLPGAEDQRLAMTLDLPILGAPPAQALPLLTRSGGKRLLIRADVNVPAGTYELYDEHELF  372

Query  696   FSLAKLVASHPHQLSVVLRLDYDPFGTGIALMDISRLQSVKEVRLRTKTLESWLQP---P  752
              +LAKL  +H  Q   + +LDYDP G G A++D+S +Q+++E+R   +T E W QP    
Sbjct  373   SALAKLAVAHMDQPKWLFKLDYDPLGVGEAVVDLSGMQAMRELRREKRTPEYWRQPGPRD  432

Query  753   IQAKLIRNLVLEMQNNISSFIFVVHPEIFPSSKSFLQAIRIYGVIIELSPKK--------  804
               AKL+    LE    ++     VH +IFPS   F +AI  +G +IE  P          
Sbjct  433   AAAKLVLT-ELERPGTLARLAMPVHKDIFPSWLEFAEAIGHFGCVIEAVPLTAIAVTPET  491

Query  805   -----RQGHVRANLFIEPSRRVCVSSTHEIHSLETDTKIDDRVRKFGLDKASAAKMRTFG  859
                     ++RANLF++P   V V+ST  ++ L T           GL++      RT  
Sbjct  492   STALLEPAYIRANLFVDPDGSVHVTST--LNMLATGGG--------GLNR------RTVA  535

Query  860   VTFPQTLIDHEVLKDASLAIGQALAKDGICGYISVDFVVCLDDQTQKKT-LYATGLQPFL  918
              TFPQT   HE +K A  A G+ L +  + GY+S+DFVV  DD++     L+A  + PFL
Sbjct  536   FTFPQTAAPHEAVKGACSAAGKLLVETNVWGYVSLDFVVFQDDKSNGAPRLWALAVHPFL  595

Query  919   TNTAASFALFQLLSRGGSYNSMTGSLHLPQEVPLVGVQNDPPSSLSATDLMIREARLSGI  978
             T++AASFA F LL+RG                            L A          SG+
Sbjct  596   TDSAASFACFHLLARG---------------------------VLDAN---------SGV  619

Query  979   VSNVLPPTPTRTYALIEYVCNPCVATLSCSSFFQHCRSRGVYFDTERDSGTVFLLADSLT  1038
                    TP R + +  YV +P V T+  ++FF  CR  GV FD ER  GT+FLLADSLT
Sbjct  620   YRMAAASTP-RCFVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLADSLT  678

Query  1039  AGVFGIMCISDT  1050
             AGVFG++ I +T
Sbjct  679   AGVFGVLSIGET  690

>PYAR_13581
Length=730

 Score = 223 bits (568),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 114/293 (39%), Positives = 174/293 (59%), Gaps = 29/293 (10%)

Query  338  YDFVIHQGIIDRKRPEFEAFQRIANPIWSSVDVVLEALARILSLYFIPIAYINGQRILTL  397
            + F+IH+G   R+ PEF++F+R+   IW +VD V+ AL  +L+ YF+             
Sbjct  104  HQFIIHKGRAMRETPEFQSFKRVGQEIWGAVDEVIRALEALLTRYFM-------------  150

Query  398  AQADNVPLTTKDLISCIRNEDEVKMLLSKPGQRFQGAERTKRATIALQSFIRMAMHRKRF  457
                     T  L+SC+ NED+V  LL +PGQR++G +R +RA   LQ+F RM  HR RF
Sbjct  151  -----ASFPTSVLLSCVVNEDQVASLLRRPGQRYKGKDRKRRAATTLQAFFRMLFHRNRF  205

Query  458  LVMRYKYWKVTAIQRNWRRFSAHKATKLKIEAKREHQEMVFTDSMRSFCSNWDKIRMQRR  517
              +  +    T IQ  WR+F+A ++ + ++  +R  Q  V+   M    S W +I  QRR
Sbjct  206  RRVCRRGASATRIQTTWRKFAAQQSLRRELTLRRAEQLRVWQLQMARLRSQWREISTQRR  265

Query  518  TIIHIPSISIDSRQRMKTEQFSIQQNLQLQRLCAVIDENVE-LIYICPFELTDDIVQYYM  576
             ++H+PS+S+D   R+  + F++QQNLQL RL AV+D  VE ++Y+ PFEL  D+     
Sbjct  266  VVVHVPSLSLDEHARVSLDHFAVQQNLQLARLAAVVDATVEYVVYVSPFELPTDLSH---  322

Query  577  KLLQLGGISDAAARIKLICPENASRFPSHFSLSSVVLYSPR-TLNRLSRCIRG  628
                  G+++AA R+K++ PE+A+ FP HFSL++ +LYSP  TL +L RC R 
Sbjct  323  ------GVANAAHRVKIVVPEHAATFPGHFSLATQLLYSPHLTLEKLGRCSRA  369

 Score = 115 bits (288),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 91/304 (30%), Positives = 136/304 (45%), Gaps = 59/304 (19%)

Query  725   ALMDISRLQSVKEVRLRTKTLESWLQPPIQAKLIRNLVLEMQNNISSFIFVVHPEIFPSS  784
             AL+D+S L +++E+R   K    W QP I+  + R L+ E++  I +     H E FP  
Sbjct  389   ALLDVSALTTLREIRRAHKPPAYWKQPGIRDTVARALLQELERAIGTLAKPCHSERFPDW  448

Query  785   KSFLQAIRIYGVIIELSPKKRQGHVRANLFIEPSRRVCVSSTHEIHSLETDTKIDDRVRK  844
             ++F QAI   GV+IE  P + +G VR N+F+ P+     SS H+       T+   R   
Sbjct  449   RAFAQAIGRDGVVIEALPARVRGVVRVNIFVTPA-----SSDHDADVPVVSTQEALR---  500

Query  845   FGLDKASAAKMRTFGVTFPQTLIDHEVLKDASLAIGQALAKD-GICGYISVDFVVCLDDQ  903
                  ASA +        PQTL+ H+ +  A+ AIG+ L +D   CGY SVD  +C D+ 
Sbjct  501   -----ASAGRA-PLAFACPQTLVPHDAVVGAAQAIGRLLREDYAFCGYASVDLQLCRDE-  553

Query  904   TQKKTLYATGLQPFLTNTAASFALFQLLSRGGSYNSMTGSLHLPQEVPLVGVQNDPPSSL  963
                                                  T  L+L   +P   V    P S 
Sbjct  554   -------------------------------------TSGLYL---LPSPAVDTSAPLS-  572

Query  964   SATDLMIREARLSGIVSNVL--PPTPTRTYALIEYVCNPCVATLSCSSFFQHCRSRGVYF  1021
              AT L+++EA L    S  L  P    R +  +++  +P + T+  ++FF  CR RGV F
Sbjct  573   PATPLVLQEAHLLARSSRPLASPSASPRCFVSVDWAVHPNLCTMPTAAFFLACRRRGVCF  632

Query  1022  DTER  1025
             D  R
Sbjct  633   DVTR  636

>PHYKE_8394
Length=428

 Score = 191 bits (486),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 96/219 (44%), Positives = 138/219 (63%), Gaps = 25/219 (11%)

Query  535  TEQFSIQQNLQLQRLCAV-IDENVEL-IYICPFELTDDIVQYYMKLLQLGGISDAAARIK  592
            TE F++QQNLQL R+CA  +D NV+L +Y+ PFELT D+ QY++KLLQLGG++D+  R+K
Sbjct  177  TENFAVQQNLQLTRICAAALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVK  236

Query  593  LICPENASRFPSHFSLSSVVLYSPRTLNRLSRCIRGRNAYMVPGFPGLEDKRVATILGVP  652
            L+ PE A RFP+                       G++AY+V G PG ED+R+A  L +P
Sbjct  237  LVFPEQALRFPT-----------------------GKDAYLVMGLPGAEDQRLAIALDLP  273

Query  653  ILGLDSTKSLQATTYSGSKRYFRKANVNTLPACIDLYDENELIFSLAKLVASHPHQLSVV  712
            ILG    ++L   T SG KR   +A+VN      +LYD++EL  +LAKL  +H  Q   +
Sbjct  274  ILGAPPAQALPLLTRSGGKRLLIRADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWL  333

Query  713  LRLDYDPFGTGIALMDISRLQSVKEVRLRTKTLESWLQP  751
            L+LDYDP G G A++D+S +Q+++E+R   +  E W QP
Sbjct  334  LKLDYDPLGVGEAIIDLSGMQAMRELRREKRAPEYWRQP  372

 Score = 44.7 bits (104),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 28/32 (88%), Gaps = 0/32 (0%)

Query  1   MDHLEQKHHTEDIGRILLQTQQELREIRAEIS  32
           M+ ++Q+HH ED+GR+LLQTQ++LR +R +++
Sbjct  1   MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMT  32

>PYAR_17383
Length=1784

 Score = 41.6 bits (96),  Expect = 0.034, Method: Compositional matrix adjust.
 Identities = 16/49 (33%), Positives = 33/49 (67%), Gaps = 0/49 (0%)

Query  436   RTKRATIALQSFIRMAMHRKRFLVMRYKYWKVTAIQRNWRRFSAHKATK  484
             R KRA+I L++F+R  + R++F  ++++  K+ A+ R W+   ++KA +
Sbjct  1025  RLKRASIVLEAFVRQCLARRKFRHLKHRIVKLQALVRQWKHHKSYKALR  1073

>PHYKE_2844
Length=1504

 Score = 41.2 bits (95),  Expect = 0.045, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 3/54 (6%)

Query  440   ATIALQSFIRMAMHRKRFLVMRYKYWKVTAIQRNWRRFSAHKATKLKIEAKREH  493
             A I LQS+ RM++  K F   R +   +  IQR WRR+ A   T+ + E+ +E+
Sbjct  1327  AAIVLQSYARMSLDYKEFHFQRRE---IIKIQRGWRRYQAGPVTEPEYESGKEY  1377

>PYIW_23045
Length=1789

 Score = 39.3 bits (90),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 0/37 (0%)

Query  439   RATIALQSFIRMAMHRKRFLVMRYKYWKVTAIQRNWR  475
             R  IALQ   R  + RK++  M+ + W V  +QRNWR
Sbjct  1314  RCAIALQRLWRAKLARKKYHGMKKEDWAVRLLQRNWR  1350

>HYAP_03074
Length=966

 Score = 38.5 bits (88),  Expect = 0.28, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 47/112 (42%), Gaps = 13/112 (12%)

Query  293  GGCREDDSRFSPGRDPSKKIGIIKAITPIFLNDVTKSLVGEISKTYDFVIHQGIIDRKRP  352
            G C  +D++ S   DP  K+ +I  +    LND T      IS  YD      ++  KRP
Sbjct  681  GDCPYNDNQSSEAVDPYFKLPVIALVLITILNDGTI-----ISIAYD-----NVVPSKRP  730

Query  353  EFEAFQRIANPIWSSVDVVLEALARILSLYFIPIAYINGQRILTLAQADNVP  404
            E     RI    W +  + L A+A  L L F  +   N   +L      N+P
Sbjct  731  EVWNLPRI---YWVATTLGLIAVASSLMLLFWGLDSWNENGVLAYFGVGNLP  779

>CCA23203
Length=1695

 Score = 38.1 bits (87),  Expect = 0.36, Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 33/69 (48%), Gaps = 7/69 (10%)

Query  439   RATIALQSFIRMAMHRKRFLVMRYKYWKVTA--IQRNWRRFSAHKATKLKIEAKREHQEM  496
             R+ I LQSF R+ + R+     R   W   A  IQ+ WRR++      ++  A R H  +
Sbjct  1149  RSIITLQSFFRVCLARRFVQRRRLSVWNAAALRIQKYWRRYAV-----MRHAAIRRHSVI  1203

Query  497   VFTDSMRSF  505
             V   S R F
Sbjct  1204  VIQASFRGF  1212

>PITG_13513
Length=144

 Score = 35.4 bits (80),  Expect = 0.63, Method: Composition-based stats.
 Identities = 34/121 (28%), Positives = 47/121 (39%), Gaps = 19/121 (16%)

Query  89   VAHYGRKTQTGLPFVAS----PPRQIPSSANSSLERKSSFQELSVDLIRKQLHSVKEKYK  144
            V HYGR    G  F       P  Q P +A+      + FQ  SVD   + ++S+  K +
Sbjct  34   VMHYGR--SKGCSFATEKCIDPVTQAPIAADHFCTSSTDFQGCSVDATSRAVYSLNTKSQ  91

Query  145  CLPTKQHSELISPKRPTQGLLTSKPSKKRYNASLRSLPTVQRGEAGDFS-SASRDQIGEA  203
             +PT+                   P K   N      P V    AGD S SA+  Q+GE 
Sbjct  92   TIPTEYQ------------YFPGNPRKGGTNTFADYCPLVVGYTAGDCSLSANLLQLGET  139

Query  204  S  204
            +
Sbjct  140  N  140

>PYVX_21884
Length=1447

 Score = 37.4 bits (85),  Expect = 0.71, Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 36/63 (57%), Gaps = 3/63 (5%)

Query  436   RTKRATIALQSFIRMAMHRKRFLVMRYKYWKVTAIQRNWR---RFSAHKATKLKIEAKRE  492
             + K+A+I L +FIR  + RK+F  ++ +  K  A+ R W+   +F   K   + +++KR 
Sbjct  1060  KLKQASIVLAAFIRQVLQRKKFKGLKQRVVKFQALARGWKLRHQFMLLKTAVIYVQSKRR  1119

Query  493   HQE  495
              Q+
Sbjct  1120  QQQ  1122

>PYIR_18874
Length=1920

 Score = 37.4 bits (85),  Expect = 0.72, Method: Compositional matrix adjust.
 Identities = 19/62 (31%), Positives = 37/62 (60%), Gaps = 3/62 (5%)

Query  436   RTKRATIALQSFIRMAMHRKRFLVMRYKYWKVTAIQRNWR---RFSAHKATKLKIEAKRE  492
             R K A+I L +F+R  + RK+F +++ +  K+ A+ R W+   +F + +   + I++KR 
Sbjct  1050  RRKTASIVLAAFVRQVIQRKKFKMLKQRVVKLQALVRKWKVREQFVSLRKLVVYIQSKRR  1109

Query  493   HQ  494
              Q
Sbjct  1110  QQ  1111

>PYU1_G012237
Length=1481

 Score = 37.0 bits (84),  Expect = 0.81, Method: Compositional matrix adjust.
 Identities = 15/40 (38%), Positives = 23/40 (58%), Gaps = 0/40 (0%)

Query  436  RTKRATIALQSFIRMAMHRKRFLVMRYKYWKVTAIQRNWR  475
            + +R  I LQ   R  + RK++  M+ + W V  +QRNWR
Sbjct  729  KQQRCAIQLQRLWRARLARKKYKGMKREDWAVRLVQRNWR  768

>PYAP_14441
Length=1271

 Score = 37.0 bits (84),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 22/74 (30%), Positives = 35/74 (47%), Gaps = 3/74 (4%)

Query  436  RTKRATIALQSFIRMAMHRKRFLVMRYKYWKVTAIQRNWRRFSAHKATKLKIE---AKRE  492
            + +R  + LQ   R  M RK++  M+ + W V  +QRNWR        K +++   A RE
Sbjct  524  KRERCAVQLQRNWRAKMARKKYKGMQKEDWAVRLVQRNWRGKMGRNTYKQRMQQYLAARE  583

Query  493  HQEMVFTDSMRSFC  506
             Q ++     R F 
Sbjct  584  IQRIMRGALARRFV  597

>SDRG_12523
Length=1200

 Score = 36.6 bits (83),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 27/114 (24%), Positives = 52/114 (46%), Gaps = 12/114 (11%)

Query  435  ERTKRATIALQSFIRMAMHRKRFLVMRYKYWKVTAIQRNWRRFSAHKATKLKIEAKREHQ  494
            +R + A + LQ+ +R  +  KR+  +   Y  + A+Q  WR     KA ++    +R H+
Sbjct  771  KRKRMAIVKLQAVVRCVLAMKRYHAL---YNGMLALQARWRGV---KARRIFAVMQRRHK  824

Query  495  EMVFTDSMRSFCSNWDKIRMQRRTIIHIPSISIDSRQRMKTEQFSIQQNLQLQR  548
             ++    +R F      +R++R       + +I +  RM  E+ + Q  L   R
Sbjct  825  ALIVLSHVRGFAVRQRFLRLKR------AATTIQAAMRMHLERKNFQTKLAEHR  872

>PYAP_14743
Length=947

 Score = 36.6 bits (83),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 39/64 (61%), Gaps = 6/64 (9%)

Query  436  RTKRATIALQSFIRMAMHRKRFLVMRYKYWKVTAIQRNWRRFS-AHKATKLKIEAKREHQ  494
            R +RAT  +QS  RM +HR+R+L  +++YW+    Q  ++ +S +H+ TK   +A+R  +
Sbjct  292  RRERATATIQSMWRMVLHRRRYL--KWRYWRTRKKQDVFQIWSLSHRITK---QAQRSAK  346

Query  495  EMVF  498
               F
Sbjct  347  RRCF  350

>PYIR_20202
Length=1555

 Score = 36.6 bits (83),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 3/38 (8%)

Query  440   ATIALQSFIRMAMHRKRFLVMRYKYWKVTAIQRNWRRF  477
             A I +QS +RMA+ RK +   R++   +  IQR W+R+
Sbjct  1370  AAIKIQSVLRMALERKEY---RFQRHAIVNIQRGWKRY  1404

>PYVX_16759
Length=1555

 Score = 36.6 bits (83),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 23/39 (59%), Gaps = 3/39 (8%)

Query  439   RATIALQSFIRMAMHRKRFLVMRYKYWKVTAIQRNWRRF  477
             RA I LQSF RM + RK FL  R     +  IQR +R++
Sbjct  1366  RAAIVLQSFGRMVLERKEFLFQRR---AIVKIQRRYRKY  1401

>PITG_09119
Length=446

 Score = 35.8 bits (81),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 35/127 (28%), Positives = 48/127 (38%), Gaps = 19/127 (15%)

Query  81   KVDLLYKGVAHYGRKTQTGLPFVA----SPPRQIPSSANSSLERKSSFQELSVDLIRKQL  136
            +V+     V HYGR    G  F       P  Q P +A+      + FQ  SVD   + +
Sbjct  242  RVNASMSEVMHYGRSK--GCSFATEKCIDPVTQAPIAADHFCTSSTDFQGCSVDATSRAV  299

Query  137  HSVKEKYKCLPTKQHSELISPKRPTQGLLTSKPSKKRYNASLRSLPTVQRGEAGDFS-SA  195
             S+  K + +PT+                   P K   N      P V    AGD S SA
Sbjct  300  CSLNTKSQAIPTEYQ------------YFPGNPRKGGTNTFADYCPLVVGNTAGDCSLSA  347

Query  196  SRDQIGE  202
            +  Q+GE
Sbjct  348  NLLQLGE  354

>SPRG_20988
Length=1141

 Score = 36.2 bits (82),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 28/113 (25%), Positives = 50/113 (44%), Gaps = 12/113 (11%)

Query  436  RTKRATIALQSFIRMAMHRKRFLVMRYKYWKVTAIQRNWRRFSAHKATKLKIEAKREHQE  495
            R + A + LQ+ +R  +  KR+  +   Y  + A Q  WR     KA ++    +R H+ 
Sbjct  707  RQRAAIVKLQAVVRCVLAMKRYHAL---YNGMLAFQARWRGV---KARRVFAVMQRRHKA  760

Query  496  MVFTDSMRSFCSNWDKIRMQRRTIIHIPSISIDSRQRMKTEQFSIQQNLQLQR  548
            +V    +R F      +R++R       + +I +  RM  E+ + Q  L   R
Sbjct  761  LVVLSHVRGFAVRQRFLRLKR------AATTIQAAMRMHLERKNFQTKLAEHR  807

>PYIR_21228
Length=2185

 Score = 35.8 bits (81),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 23/40 (58%), Gaps = 0/40 (0%)

Query  436   RTKRATIALQSFIRMAMHRKRFLVMRYKYWKVTAIQRNWR  475
             + +R  +ALQ   R  + RK++  M+ + W V  +Q NWR
Sbjct  1413  KRERCAVALQRLWRAKLARKKYKGMKKEDWAVRLLQCNWR  1452

>PITG_13065
Length=1883

 Score = 35.4 bits (80),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 23/34 (68%), Gaps = 4/34 (12%)

Query  433   GAERTK----RATIALQSFIRMAMHRKRFLVMRY  462
              AER +    R T++LQS+ RM +HR+RFL  RY
Sbjct  1028  AAERERKTRERTTLSLQSWQRMHVHRRRFLTQRY  1061

 Score = 33.9 bits (76),  Expect = 7.4, Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 23/40 (58%), Gaps = 0/40 (0%)

Query  436   RTKRATIALQSFIRMAMHRKRFLVMRYKYWKVTAIQRNWR  475
             R K+A I L +F+R  + R+RF  ++    K  A+ R W+
Sbjct  1081  REKKAAIVLAAFVRQVLQRRRFKKLKASIVKTQAMVRKWK  1120

>CCI49191
Length=1433

 Score = 35.4 bits (80),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 51/116 (44%), Gaps = 14/116 (12%)

Query  439   RATIALQSFIRMAMHRKRFLVMRYKYWKVTA--IQRNWRRFSAHKATKLKIEAKREHQEM  496
             +  + LQ+F R+ + R+R    R   W   A  IQR WRR++  +   +      +   +
Sbjct  895   KCILTLQNFFRVCIARRRVQRHRATVWNAAAARIQRCWRRYAVERHATVI-----QQSVI  949

Query  497   VFTDSMRSFCSNWDKIRMQRRTIIHIPSISID------SRQRMKTEQFSIQQNLQL  546
             V     RSF S  + +R +R+ +    ++ I         QR   +QF   + +QL
Sbjct  950   VIQAHFRSFHSR-NTLRKRRQILYEKSALKIQRFYRECHSQRFHAQQFFAARLIQL  1004

>PHYCA_527389
Length=367

 Score = 34.7 bits (78),  Expect = 3.0, Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 34/61 (56%), Gaps = 6/61 (10%)

Query  944   LHLPQEVPLVGVQNDPPSSLSATDLMIREARLSGIVSNVLPPTPTRTYALIEYVCNPCVA  1003
             L +P E P++    DPPS +  T L + +  L+ +V++ LPPTP    A++E V  P   
Sbjct  97    LIIPDEPPVI----DPPSGVRNTTLPLVKLLLAPLVTSTLPPTP--LLAVVELVAPPLTN  150

Query  1004  T  1004
             T
Sbjct  151   T  151

>PPTG_02017
Length=169

 Score = 33.9 bits (76),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 34/74 (46%), Gaps = 10/74 (14%)

Query  912  TGLQPFLTNTAASFALFQLLSRGGSYNSMTGSLHLPQEVPLVGVQNDPPSSLSATDLMIR  971
            T L+P + + A S           SY+ M+GS   PQ  PLV   + P   L +TD+ I 
Sbjct  89   TSLEPIVDSVAQSPT--------DSYSQMSGSYCCPQYTPLVSTSSFP--MLGSTDMDIL  138

Query  972  EARLSGIVSNVLPP  985
            E  L  +    LPP
Sbjct  139  ELLLLDMQPQTLPP  152

>PHYRA_84534
Length=1368

 Score = 35.0 bits (79),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 25/44 (57%), Gaps = 3/44 (7%)

Query  438  KRATIALQSFIRMAMHRKRFLVMRYKYWKVTAIQRNWRRFSAHK  481
            ++  I LQ  +R  + R+RFL    K   + AIQ+ WRR+  HK
Sbjct  801  RKYAIVLQKNVRCWLMRRRFL---RKKQHIVAIQKYWRRYVVHK  841

>SPRG_14408
Length=1205

 Score = 35.0 bits (79),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 31/142 (22%), Positives = 63/142 (44%), Gaps = 17/142 (12%)

Query  407  TKDLISCIRNEDEVKMLLSKPGQRFQGAERTKRATIALQSFIRMAMHRKRFLVMRYKYWK  466
            T+  +  +R +   +M L++   R     R + A + LQ+ +R  +  KR+  +   Y  
Sbjct  747  TRLTVHALRIQRFARMCLARLHYR-----RQRAAIVKLQAVVRCVLAMKRYHAL---YNG  798

Query  467  VTAIQRNWRRFSAHKATKLKIEAKREHQEMVFTDSMRSFCSNWDKIRMQRRTIIHIPSIS  526
            + A+Q  WR     KA ++    +R H+ ++    +R F      +R++R       + +
Sbjct  799  MLALQARWRGV---KARRVFAVMQRRHKALIVLSHVRGFAVRQRFVRLKR------AATT  849

Query  527  IDSRQRMKTEQFSIQQNLQLQR  548
            I +  RM  E+ + +  L   R
Sbjct  850  IQAAMRMHLERKNFRTKLAEHR  871

>PHALS_09403
Length=1313

 Score = 34.7 bits (78),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 21/64 (33%), Positives = 36/64 (56%), Gaps = 3/64 (5%)

Query  97   QTGLPFVASPPRQIPSSANSSL--ERKSSFQELSVDLIRKQLHSVKEKYKCLPTKQHSEL  154
            QT  PF++S PR   S+   S+  E+++SF EL+ + I   + S++   + L T    +L
Sbjct  663  QTSFPFLSSSPRTRRSTFEESMEVEKQTSFHELTSN-IETVVTSIRTSIETLKTPSSGKL  721

Query  155  ISPK  158
            I P+
Sbjct  722  IVPE  725

>PYIR_14902
Length=1364

 Score = 34.3 bits (77),  Expect = 5.3, Method: Compositional matrix adjust.
 Identities = 19/68 (28%), Positives = 36/68 (53%), Gaps = 1/68 (1%)

Query  5    EQKHHTEDIGRILLQTQQELREIRAEISGRKQTTETYIADATPFEDY-PAPIVSVNPSKD  63
            E +H + D GR+L     E        S   ++ ++ ++D TP E+  PA  ++ +P+K 
Sbjct  310  EWQHRSRDYGRVLRLLSPEQEPFAQRGSHEAESRKSIVSDGTPPEELVPAAALTHDPAKS  369

Query  64   LETLQNIL  71
            L++L  +L
Sbjct  370  LQSLTEVL  377

>PHYSO_258136
Length=286

 Score = 33.5 bits (75),  Expect = 5.9, Method: Composition-based stats.
 Identities = 41/171 (24%), Positives = 69/171 (40%), Gaps = 22/171 (13%)

Query  398  AQADNVPLTTKDLISCIRNEDEVKMLLSKPGQRFQGAERTKRATIALQSFIRMAMHRKRF  457
            A    VP   + +   ++NED+  +  S  G  FQ  +  +  T  L+ +          
Sbjct  5    ASDATVPRFVRAVYDMLQNEDQRILSWSADGSHFQVYDVPRLETKVLRKY----------  54

Query  458  LVMRYKYWKVTAIQRNWRRFSAHKATKLKIE-AKREHQEMVFTDSMRSFCSNWDKIRMQR  516
                +K+ K T+ QR    F  HK TK +   A   H  +V     R   S    ++ +R
Sbjct  55   ----FKHGKFTSFQRQLNNFGFHKWTKTRASVATFSHDVLV-----RCHVSELAVLQQRR  105

Query  517  RTIIH-IPSISIDSRQRMKTEQFSIQQNLQLQRLCAVIDENVELIYICPFE  566
            R     +PS       R +T   + +Q +  + +CAV D+  E+ + C  E
Sbjct  106  RDPRPCLPSGPGAFWLRRETSSAAKKQKMSPRDVCAV-DDLAEISFDCVLE  155

>PYAR_13630
Length=467

 Score = 33.9 bits (76),  Expect = 6.7, Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 3/64 (5%)

Query  821  VCVSSTHEIHSLETDTKIDDRVRKFGLDKASAAKMRTFGVTFPQTLIDHEVLKDASLAIG  880
            +C +  H  HSL    ++ +R+R  G+   SAA++R   +   +    H+V+  A    G
Sbjct  21   LCAAGRHRFHSLGVSAELVERLRAMGISTPSAAQLRAIPLVLQR---QHDVVVAAETGGG  77

Query  881  QALA  884
            + LA
Sbjct  78   KTLA  81

>PYAR_17112
Length=672

 Score = 33.9 bits (76),  Expect = 7.2, Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (58%), Gaps = 3/38 (8%)

Query  442  IALQSFIRMAMHRKRFLVMRYKYWKVTAIQRNWRRFSA  479
            I LQS+ RM++ RK +   R    K   IQR WRR+ +
Sbjct  155  IVLQSYARMSIERKEYYFQRRAIRK---IQRAWRRYKS  189

>PHYCA_53999
Length=947

 Score = 33.9 bits (76),  Expect = 7.3, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 25/44 (57%), Gaps = 3/44 (7%)

Query  438  KRATIALQSFIRMAMHRKRFLVMRYKYWKVTAIQRNWRRFSAHK  481
            ++  I LQ  +R  + R+RFL  + +   +  IQ+ WRR+  HK
Sbjct  698  RKYAIVLQKNVRCWLMRRRFLRQKQQ---IVVIQKYWRRYVVHK  738

>PYU1_G000322
Length=1912

 Score = 33.9 bits (76),  Expect = 7.5, Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 25/39 (64%), Gaps = 0/39 (0%)

Query  438   KRATIALQSFIRMAMHRKRFLVMRYKYWKVTAIQRNWRR  476
             K A+I L +F+R    RK+F +++ +  K+ A+ R W++
Sbjct  1051  KHASIVLAAFVRQVFQRKKFKMLKQRVVKLQALVRKWKQ  1089

>HYAP_06762
Length=1736

 Score = 33.9 bits (76),  Expect = 8.1, Method: Compositional matrix adjust.
 Identities = 28/101 (28%), Positives = 43/101 (43%), Gaps = 5/101 (5%)

Query  107   PRQIPSSANSSLERKSSFQELSVDLIRKQLHSVKEKYKCLPTKQ---HSELISPKRPTQG  163
             P  IPS   +  ++ SS   L+  L+R    + + +   LP      + +  S      G
Sbjct  1489  PGLIPSGNATGTDKSSSTSSLNQQLLRSNFGAAQCRDTTLPVDNVYPNGKSTSGPGNIDG  1548

Query  164   LLTSKPSKKRY--NASLRSLPTVQRGEAGDFSSASRDQIGE  202
               +++PS   +  N SL  LPT   G  G F   S DQ G+
Sbjct  1549  TTSTRPSAPSHYLNGSLGPLPTFDYGIDGPFGLGSLDQRGQ  1589

>SDRG_03848
Length=1788

 Score = 33.9 bits (76),  Expect = 8.3, Method: Compositional matrix adjust.
 Identities = 16/58 (28%), Positives = 33/58 (57%), Gaps = 3/58 (5%)

Query  436  RTKRATIALQSFIRMAMHRKRFLVMRYKYWKVTAIQRNW---RRFSAHKATKLKIEAK  490
            + ++  IALQ+ +RM   R RF+++R +   + +  R W   RRF   +   ++++A+
Sbjct  781  KQRKGIIALQALVRMHQARTRFVILRRRITCLNSHVRKWLARRRFLGIRKAIIRVQAR  838

>PHALS_12170
Length=1816

 Score = 33.9 bits (76),  Expect = 8.8, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 23/34 (68%), Gaps = 4/34 (12%)

Query  433   GAERTK----RATIALQSFIRMAMHRKRFLVMRY  462
              AER +    R+T+ LQS+ RM  HR+RFL+ R+
Sbjct  1012  AAERERKLRDRSTLQLQSWHRMVKHRRRFLLQRF  1045

Lambda      K        H        a         alpha
   0.320    0.134    0.383    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 93303276825

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40