Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
CCI44820147551231236432e-87
CCA17542147551201204991e-65
PHYCA_11834147551341243464e-42
PHYSO_321155147551361243257e-39
PHALS_06479147551361253241e-38
PHYRA_95903147551341243187e-38
PYVX_18180147551351263143e-37
PPTG_17126147551361243143e-37
PITG_18455147551321233082e-36
PYAP_17747147551341243083e-36
PHYKE_8392147551381263074e-36
PYU1_G001736147551231213012e-35
PYIW_19970147551301182971e-34
PYIR_13454147551291222935e-34
SDRG_01782147551231172734e-31
SPRG_06335147551231172726e-31
HYAP_07103147551641542703e-30
H257_06293147551231172412e-26
H310_09224147551231192343e-25
HYAP_084991114710865880.001
HYAP_085006526017265880.003
PHYKE_58411114712160780.047
H310_07567111479849730.15
PYU1_G0059631114710345730.17
PYIW_147431114710559710.34
PHALS_1156411147107110700.43
PHYSO_3150171114710965690.73
PITG_137391114710565680.79
PYAP_21260263214036681.1
CCI4749065267870651.6
PHYRA_816751114710645661.8
PYIR_151861114710959661.9
CCA175211114710434652.3
PPTG_092521114710565652.7
H257_1840614700460755663.4
H257_07358111479849633.5
H310_0186314700464555646.5
PYIW_270858474136548639.7
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= CCI44820

Length=123
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

CCI44820                                                              252        2e-87
CCA17542                                                              196        1e-65
PHYCA_11834                                                           137        4e-42
PHYSO_321155                                                          129        7e-39
PHALS_06479                                                           129        1e-38
PHYRA_95903                                                           127        7e-38
PYVX_18180                                                            125        3e-37
PPTG_17126                                                            125        3e-37
PITG_18455                                                            123        2e-36
PYAP_17747                                                            123        3e-36
PHYKE_8392                                                            122        4e-36
PYU1_G001736                                                          120        2e-35
PYIW_19970                                                            119        1e-34
PYIR_13454                                                            117        5e-34
SDRG_01782                                                            109        4e-31
SPRG_06335                                                            109        6e-31
HYAP_07103                                                            108        3e-30
H257_06293                                                            97.4       2e-26
H310_09224                                                            94.7       3e-25
HYAP_08499                                                            38.5       0.001
HYAP_08500                                                            38.5       0.003
PHYKE_5841                                                            34.7       0.047
H310_07567                                                            32.7       0.15 
PYU1_G005963                                                          32.7       0.17 
PYIW_14743                                                            32.0       0.34 
PHALS_11564                                                           31.6       0.43 
PHYSO_315017                                                          31.2       0.73 
PITG_13739                                                            30.8       0.79 
PYAP_21260                                                            30.8       1.1  
CCI47490                                                              29.6       1.6  
PHYRA_81675                                                           30.0       1.8  
PYIR_15186                                                            30.0       1.9  
CCA17521                                                              29.6       2.3  
PPTG_09252                                                            29.6       2.7  
H257_18406                                                            30.0       3.4  
H257_07358                                                            28.9       3.5  
H310_01863                                                            29.3       6.5  
PYIW_27085                                                            28.9       9.7  

>CCI44820
Length=123

 Score = 252 bits (643),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%)

Query  1    MTAVNETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTI  60
            MTAVNETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTI
Sbjct  1    MTAVNETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTI  60

Query  61   GYLKIVTPHKRSDSGVKHFVYKDGERIEKSLQAGEKAKFKVQDMEEGLKRHNQLIRRQYF  120
            GYLKIVTPHKRSDSGVKHFVYKDGERIEKSLQAGEKAKFKVQDMEEGLKRHNQLIRRQYF
Sbjct  61   GYLKIVTPHKRSDSGVKHFVYKDGERIEKSLQAGEKAKFKVQDMEEGLKRHNQLIRRQYF  120

Query  121  MDR  123
            MDR
Sbjct  121  MDR  123

>CCA17542
Length=120

 Score = 196 bits (499),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 111/120 (93%), Gaps = 0/120 (0%)

Query  4    VNETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTIGYL  63
            +++TR I+K++++LAKSLP EKQA TLLNIR EFRKHRDI DP QL+QLLERAQSTIGYL
Sbjct  1    MSDTRSIYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTIGYL  60

Query  64   KIVTPHKRSDSGVKHFVYKDGERIEKSLQAGEKAKFKVQDMEEGLKRHNQLIRRQYFMDR  123
            KIVTPHKRSDSGVK F++KDGERIE++L+A E+A+FKVQD+ EGLKRH+QL+RRQ+FMDR
Sbjct  61   KIVTPHKRSDSGVKRFMFKDGERIEENLKASERARFKVQDIGEGLKRHHQLLRRQHFMDR  120

>PHYCA_11834
Length=134

 Score = 137 bits (346),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 93/124 (75%), Gaps = 3/124 (2%)

Query  3    AVNETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTIGY  62
            A  E R ++KK+++LA+SLP  K+  ++  IR EFR H D+ DP ++++LL+RAQS++GY
Sbjct  2    AARELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGY  61

Query  63   LKIVTPHKRSDSGVKHFVYKDGERIEKSLQAG---EKAKFKVQDMEEGLKRHNQLIRRQY  119
            LKIVTP   S++GV+ F+Y+DG+R+      G   E A++K QDME GLKRH+QL+RRQY
Sbjct  62   LKIVTPRAESNTGVQRFIYRDGKRVNAEELEGKGEENARWKTQDMEAGLKRHHQLLRRQY  121

Query  120  FMDR  123
            FMDR
Sbjct  122  FMDR  125

>PHYSO_321155
Length=136

 Score = 129 bits (325),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 91/124 (73%), Gaps = 3/124 (2%)

Query  3    AVNETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTIGY  62
            A  E R ++KK+++LA+SLP  K+  +L  IR EFR H D+ DP  ++ L++RAQS++ Y
Sbjct  4    AARELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSSLSY  63

Query  63   LKIVTPHKRSDSGVKHFVYKDGERI---EKSLQAGEKAKFKVQDMEEGLKRHNQLIRRQY  119
            LKIVTP   S++GV+ F+Y++G+R+   E   +  E A++K QD+E GLKRH+QL+RRQY
Sbjct  64   LKIVTPRGESNTGVQRFIYRNGQRVNAAEFEAKGEENARYKTQDIEAGLKRHHQLLRRQY  123

Query  120  FMDR  123
            FMDR
Sbjct  124  FMDR  127

>PHALS_06479
Length=136

 Score = 129 bits (324),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 91/125 (73%), Gaps = 3/125 (2%)

Query  2    TAVNETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTIG  61
             A  E R ++KK+++LA++LP  K+  ++  IR EFR H D+ DP ++++ ++RAQS++ 
Sbjct  3    NATRELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLS  62

Query  62   YLKIVTPHKRSDSGVKHFVYKDGERIEKS---LQAGEKAKFKVQDMEEGLKRHNQLIRRQ  118
            YLKI+TP   S++GV+ F+Y++G+R+  +    +  E A++K QDME G KRH+QL+RRQ
Sbjct  63   YLKIITPRTESNTGVQRFIYRNGQRVNAADFEKKGNENARWKTQDMEAGYKRHHQLLRRQ  122

Query  119  YFMDR  123
            YFMDR
Sbjct  123  YFMDR  127

>PHYRA_95903
Length=134

 Score = 127 bits (318),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 91/124 (73%), Gaps = 3/124 (2%)

Query  3    AVNETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTIGY  62
            A  E R ++KK+++LA+SLP  K+  +L  IR EFR H ++ DP +++ L++RAQS++GY
Sbjct  2    AARELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLGY  61

Query  63   LKIVTPHKRSDSGVKHFVYKDGERI---EKSLQAGEKAKFKVQDMEEGLKRHNQLIRRQY  119
            LKIVTP   S+ G++ ++Y++G+R+   E      E A++K QD+E GLKRH+QL+RRQ+
Sbjct  62   LKIVTPRAESNKGIQRYIYRNGQRVNADEVEAHGEENARYKTQDIEGGLKRHHQLLRRQH  121

Query  120  FMDR  123
            FMDR
Sbjct  122  FMDR  125

>PYVX_18180
Length=135

 Score = 125 bits (314),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 89/126 (71%), Gaps = 3/126 (2%)

Query  1    MTAVNETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTI  60
            M +  E R ++KK+++LA+SLP  K+A T+  IR EFR H ++ D  ++A+LL+RAQS +
Sbjct  1    MASPAELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQL  60

Query  61   GYLKIVTPHKRSDSGVKHFVYKDGERI---EKSLQAGEKAKFKVQDMEEGLKRHNQLIRR  117
            GYLKIVTP   S SGVK ++Y++G+R+          + A++K  DME  LKRH+QL+RR
Sbjct  61   GYLKIVTPRGPSASGVKRYIYRNGQRVDADAAEAAGEDGARYKTPDMEGALKRHHQLLRR  120

Query  118  QYFMDR  123
            Q+FMDR
Sbjct  121  QHFMDR  126

>PPTG_17126
Length=136

 Score = 125 bits (314),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 92/124 (74%), Gaps = 3/124 (2%)

Query  3    AVNETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTIGY  62
            A+ E R ++KK+++LA+SLP  K+  ++  IR +FR H D+ DP +++ L++RAQS++ Y
Sbjct  4    AMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLSY  63

Query  63   LKIVTPHKRSDSGVKHFVYKDGERI---EKSLQAGEKAKFKVQDMEEGLKRHNQLIRRQY  119
            LKIVTP   S+ GV+ ++Y++G+R+   E   +  E A++K QDME GL+RH+QL+RRQY
Sbjct  64   LKIVTPRAESNMGVQRYIYRNGQRVNADEFEEKGEENARWKTQDMEGGLRRHHQLLRRQY  123

Query  120  FMDR  123
            F+DR
Sbjct  124  FLDR  127

>PITG_18455
Length=132

 Score = 123 bits (308),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 93/123 (76%), Gaps = 3/123 (2%)

Query  4    VNETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTIGYL  63
            ++E R ++KK+++LA+SLP  K+  ++  IR +FR H D  DP +++ L++RAQS++ YL
Sbjct  1    MSELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYL  60

Query  64   KIVTPHKRSDSGVKHFVYKDGERI---EKSLQAGEKAKFKVQDMEEGLKRHNQLIRRQYF  120
            KIVTP   S++GV+ ++Y++G+R+   E   +  E A++K+QDME GLKRH+QL++RQYF
Sbjct  61   KIVTPRAESNTGVQRYIYRNGQRVNAAEFEEKGVENARWKMQDMEGGLKRHHQLLQRQYF  120

Query  121  MDR  123
            M+R
Sbjct  121  MNR  123

>PYAP_17747
Length=134

 Score = 123 bits (308),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 93/124 (75%), Gaps = 3/124 (2%)

Query  3    AVNETRRIFKKMVKLAKSLPVE-KQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTIG  61
            A +E R ++K++++LAKSLP E K+  T+  IR+EFR  +D  DP ++A L++RAQ+ IG
Sbjct  2    ATSELRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIG  61

Query  62   YLKIVTPHKRSDSGVKHFVYKDGERIEKS-LQAGEK-AKFKVQDMEEGLKRHNQLIRRQY  119
            YLKIVTP   +D+GVK FVY +G+R++ S +Q  E+ A++K  D E  ++RHNQL+RRQ+
Sbjct  62   YLKIVTPRSTADAGVKSFVYVNGKRVDSSDVQTREEGARYKTIDFEGNMRRHNQLLRRQH  121

Query  120  FMDR  123
            FMDR
Sbjct  122  FMDR  125

>PHYKE_8392
Length=138

 Score = 122 bits (307),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 60/126 (48%), Positives = 92/126 (73%), Gaps = 5/126 (4%)

Query  3    AVNETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTIGY  62
            A  E R ++KK++++A++LP  K+  +L  IR EFR H D+ DP ++++LL+ AQS++ Y
Sbjct  4    AARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEVSKLLQLAQSSLSY  63

Query  63   LKIVTP--HKRSDSGVKHFVYKDGERI---EKSLQAGEKAKFKVQDMEEGLKRHNQLIRR  117
            LKIVTP     S+SGV+ ++Y++G+R+   E   +  E A++K QDME GLKRH+QL+RR
Sbjct  64   LKIVTPRDETESNSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQLMRR  123

Query  118  QYFMDR  123
            Q+FMDR
Sbjct  124  QHFMDR  129

>PYU1_G001736
Length=123

 Score = 120 bits (301),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 88/121 (73%), Gaps = 0/121 (0%)

Query  3    AVNETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTIGY  62
            A ++ R ++KK++KLA++LP +K+  T+  IR EFR H   +DP ++A LL RAQS+IGY
Sbjct  2    ASSDLRPMYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGY  61

Query  63   LKIVTPHKRSDSGVKHFVYKDGERIEKSLQAGEKAKFKVQDMEEGLKRHNQLIRRQYFMD  122
            LKIVTP   SD+GVK++VY  G+R+E +  A + A++K  D    ++RH QL+RRQ+FMD
Sbjct  62   LKIVTPRATSDAGVKNYVYIKGKRVEAAGAAEDGARYKTADYNAQMQRHVQLLRRQHFMD  121

Query  123  R  123
            R
Sbjct  122  R  122

>PYIW_19970
Length=130

 Score = 119 bits (297),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 86/118 (73%), Gaps = 0/118 (0%)

Query  6    ETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTIGYLKI  65
            + R ++KK+++LAK+LP  K+  T   IR+EFR  +++ DP +L  LL RAQS+I YLKI
Sbjct  12   DLRPVYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKI  71

Query  66   VTPHKRSDSGVKHFVYKDGERIEKSLQAGEKAKFKVQDMEEGLKRHNQLIRRQYFMDR  123
            VTP K SD+GVK+++YK+G+R+E +    + AK+++ D    + RH +L+RRQ+FMDR
Sbjct  72   VTPRKSSDAGVKNYIYKNGQRVEAAAVMEDGAKYQLPDYNGQMLRHQKLLRRQHFMDR  129

>PYIR_13454
Length=129

 Score = 117 bits (293),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 90/122 (74%), Gaps = 0/122 (0%)

Query  2    TAVNETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTIG  61
             A+ + R ++KK++KLAK+LP  K+  TL  IR+EFR  +D+ DP +L  LL RAQS+IG
Sbjct  7    AALGDLRPVYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSIG  66

Query  62   YLKIVTPHKRSDSGVKHFVYKDGERIEKSLQAGEKAKFKVQDMEEGLKRHNQLIRRQYFM  121
            YLKIVTP K SD+GVK+++YK+G+R+E +    + AK+ + D    ++RH +L+RRQ+FM
Sbjct  67   YLKIVTPRKSSDAGVKNYIYKNGQRVEATSVLEDGAKYSIPDYNAQMQRHQKLLRRQHFM  126

Query  122  DR  123
            DR
Sbjct  127  DR  128

>SDRG_01782
Length=123

 Score = 109 bits (273),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 76/117 (65%), Gaps = 1/117 (1%)

Query  8    RRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTIGYLKIVT  67
            R  +KK++KLAKS+P E++A TL  +R EFR H     P +L QLL +AQS I YLKIVT
Sbjct  6    RAAYKKLLKLAKSVPQEQRAQTLEKVRHEFRAHEGAATPEELDQLLRKAQSKISYLKIVT  65

Query  68   PHKRSDSGV-KHFVYKDGERIEKSLQAGEKAKFKVQDMEEGLKRHNQLIRRQYFMDR  123
            P K S S    HFVYK+G+RI+    + + A  K  D    + +H QL+RRQ+FMDR
Sbjct  66   PKKSSSSTQGSHFVYKNGQRIDGRELSADSATIKTHDYNAMMTKHVQLVRRQHFMDR  122

>SPRG_06335
Length=123

 Score = 109 bits (272),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 75/117 (64%), Gaps = 1/117 (1%)

Query  8    RRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTIGYLKIVT  67
            R  +KK++KLAKS+P E++A TL  +R EFR H     P +L QLL +AQS I YLKIVT
Sbjct  6    RAAYKKLLKLAKSVPQEQRAQTLEKVRTEFRAHTGAATPEELDQLLRKAQSKISYLKIVT  65

Query  68   PHKRSDSGV-KHFVYKDGERIEKSLQAGEKAKFKVQDMEEGLKRHNQLIRRQYFMDR  123
            P K    G   HFVYK+G+RI+    + + A  K  D    + +H QL+RRQ+FMDR
Sbjct  66   PKKSPSPGQGNHFVYKNGQRIDGRELSADSATIKTADYNAMMTKHVQLVRRQHFMDR  122

>HYAP_07103
Length=164

 Score = 108 bits (270),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 91/154 (59%), Gaps = 38/154 (25%)

Query  8    RRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTIGYLKIVT  67
            R ++KK+++LA+SLP  K+  +L  IR EFR H D+ DP +++ LL+RAQS+I +LKIVT
Sbjct  2    RPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKIVT  61

Query  68   PHKR-----------------------------------SDSGVKHFVYKDGERIEKS--  90
            P                                      SD+G++ FVY+DG+RI+ +  
Sbjct  62   PRAESGGFMASLAFSIMCLTLSLFSVLLLLLHHYFSCFFSDTGIQRFVYRDGKRIDAAEL  121

Query  91   -LQAGEKAKFKVQDMEEGLKRHNQLIRRQYFMDR  123
              +  E A++K QD+E G+KRH+QL+RRQ+FMDR
Sbjct  122  KKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDR  155

>H257_06293
Length=123

 Score = 97.4 bits (241),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 76/117 (65%), Gaps = 1/117 (1%)

Query  8    RRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTIGYLKIVT  67
            R  +KK++KLA+SLP +++   L  IR +FR    I    +L +L+ +AQS I YLKIVT
Sbjct  6    RTAYKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEELDKLVMKAQSKISYLKIVT  65

Query  68   PHKRSDSGVKHFVYKDGERIE-KSLQAGEKAKFKVQDMEEGLKRHNQLIRRQYFMDR  123
            P +   SG + F+YKDG+R++ +SL  G     K  D+   ++RH +LIRRQ+FMDR
Sbjct  66   PKRTPQSGPQRFIYKDGKRLDSQSLDDGGNRTIKTTDVNAMMERHVKLIRRQHFMDR  122

>H310_09224
Length=123

 Score = 94.7 bits (234),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 73/119 (61%), Gaps = 1/119 (1%)

Query  6    ETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTIGYLKI  65
              R  +KK++KLA+SLP E++   L  +R EFR H  I    QL +++ +AQS I YLKI
Sbjct  4    SVRTAYKKLIKLAQSLPAEQKPVALDKVRHEFRSHGVITSSDQLDKIVMKAQSKISYLKI  63

Query  66   VTPHKRSDSGVKHFVYKDGERIEK-SLQAGEKAKFKVQDMEEGLKRHNQLIRRQYFMDR  123
            VTP +   +  + ++YKDG+R++   +     A  K  D    ++RH +L+RRQ+FMDR
Sbjct  64   VTPKRAPQTSPQRYIYKDGKRLDPGCIDQSTNATIKTVDFNAMMERHVKLVRRQHFMDR  122

>HYAP_08499
Length=108

 Score = 38.5 bits (88),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 39/65 (60%), Gaps = 0/65 (0%)

Query  1   MTAVNETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTI  60
           M   NE  R++++++KLA+  P  K+   + +I++EFR +R++ D  ++ + L   Q+ I
Sbjct  1   MAEANEVLRMYRRILKLAQRYPSIKRQSIICDIKSEFRANRNLSDAQKVRKELAVVQAGI  60

Query  61  GYLKI  65
             L +
Sbjct  61  KELSM  65

>HYAP_08500
Length=172

 Score = 38.5 bits (88),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 39/65 (60%), Gaps = 0/65 (0%)

Query  1    MTAVNETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTI  60
            M   NE  R++++++KLA+  P  K+   + +I++EFR +R++ D  ++ + L   Q+ I
Sbjct  65   MAEANEVLRMYRRILKLAQRYPSIKRQSIICDIKSEFRANRNLSDAQKVRKELAVVQAGI  124

Query  61   GYLKI  65
              L +
Sbjct  125  KELSM  129

>PHYKE_5841
Length=121

 Score = 34.7 bits (78),  Expect = 0.047, Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 35/60 (58%), Gaps = 0/60 (0%)

Query  1   MTAVNETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTI  60
           M  V E  R++++++KLA+  P  K+   + +I+ EF  H+ + D  ++ + L  A++ I
Sbjct  1   MAEVKEVTRMYRRILKLAQRYPSVKRDSIIRDIKTEFHAHKGLTDAQKIREELASARAGI  60

>H310_07567
Length=98

 Score = 32.7 bits (73),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 14/49 (29%), Positives = 32/49 (65%), Gaps = 0/49 (0%)

Query  1   MTAVNETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQL  49
           M+A     +I++++++LAK  P  K+   + +I+AEF  ++ + DP+++
Sbjct  1   MSASPTVPQIYRRVLQLAKKFPSIKRDQLVEDIKAEFHDNKVLTDPVKI  49

>PYU1_G005963
Length=103

 Score = 32.7 bits (73),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 28/45 (62%), Gaps = 0/45 (0%)

Query  1   MTAVNETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRD  45
           MT   E  RI+++++KLA   P  K+   + +I+ EFR+++ + D
Sbjct  1   MTEAKEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTD  45

>PYIW_14743
Length=105

 Score = 32.0 bits (71),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 34/59 (58%), Gaps = 3/59 (5%)

Query  1   MTAVNETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQST  59
           M    E  R++++++KLA   P  K++  +  I+ EF +++ + D    A++L++ QS 
Sbjct  1   MAEAKEVVRLYRRILKLAAQYPSIKRSAIIREIKIEFHQNKTLTDS---AKILDKVQSA  56

>PHALS_11564
Length=107

 Score = 31.6 bits (70),  Expect = 0.43, Method: Compositional matrix adjust.
 Identities = 25/110 (23%), Positives = 52/110 (47%), Gaps = 3/110 (3%)

Query  1    MTAVNETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTI  60
            M    +  R++++++KLA+  P  K+   + +I+ EF  +  I D  ++ + +  A + I
Sbjct  1    MAETKQVLRVYRRLLKLAQHYPSIKREAIIRDIKEEFHANAIITDAQKICEAMASAHAGI  60

Query  61   GYLKIVTPHKRSDSGVKHFVYKDGERIEKSLQAGEKAKFKVQDMEEGLKR  110
              L +      S       V +D   I+  L+ G + K  V+D  + +K+
Sbjct  61   KELSMYASLHPSQPNWSVEVGRDA--IQSQLREGSQVKV-VRDGNKAVKK  107

>PHYSO_315017
Length=109

 Score = 31.2 bits (69),  Expect = 0.73, Method: Compositional matrix adjust.
 Identities = 16/65 (25%), Positives = 36/65 (55%), Gaps = 0/65 (0%)

Query  1   MTAVNETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTI  60
           M    E  R++++++KLA+  P  K+   + +I+ EF  ++D+ D  ++ + L   ++ I
Sbjct  1   MAETKEVLRMYRRILKLAQRYPSVKRESIIRDIKTEFHANKDLTDAQKIREELASVRAGI  60

Query  61  GYLKI  65
             L +
Sbjct  61  KELSM  65

>PITG_13739
Length=105

 Score = 30.8 bits (68),  Expect = 0.79, Method: Compositional matrix adjust.
 Identities = 16/65 (25%), Positives = 36/65 (55%), Gaps = 0/65 (0%)

Query  1   MTAVNETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTI  60
           M    E  R++++++KLA+  P  K+   + +I+ EF  ++D+ D  ++ + L   ++ I
Sbjct  1   MAETREVLRMYRRILKLAQRYPSIKRESIIRDIKTEFHANKDLTDAQKIREELASVRAGI  60

Query  61  GYLKI  65
             L +
Sbjct  61  TELSM  65

>PYAP_21260
Length=140

 Score = 30.8 bits (68),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 25/36 (69%), Gaps = 1/36 (3%)

Query  21  LPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERA  56
           +P+E  A   L+I+A FRKH D++DP  L  L+++A
Sbjct  40  IPMEP-AEARLSIQALFRKHADVKDPRVLDMLIKKA  74

>CCI47490
Length=78

 Score = 29.6 bits (65),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 37/70 (53%), Gaps = 1/70 (1%)

Query  1   MTAVNETRRIFKKMVKLAKSLPVEKQAGTLLN-IRAEFRKHRDIRDPIQLAQLLERAQST  59
           M AVNE+ R++  + + A  +P + +   +   +RAE+  HR+  +P +L  L   A + 
Sbjct  1   MNAVNESMRLYCAIHRAAAKMPTKDRINFIRRRLRAEYDTHREETNPDRLRFLHALAATQ  60

Query  60  IGYLKIVTPH  69
           +  ++I   H
Sbjct  61  LETIQIQAKH  70

>PHYRA_81675
Length=106

 Score = 30.0 bits (66),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 13/45 (29%), Positives = 27/45 (60%), Gaps = 0/45 (0%)

Query  1   MTAVNETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRD  45
           M    E  R++++++KLA+  P  K+A  + +I+ EF  ++ + D
Sbjct  1   MAETKEVVRMYRRILKLAQRYPSIKRASIIRDIKTEFHANKHLTD  45

>PYIR_15186
Length=109

 Score = 30.0 bits (66),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 32/59 (54%), Gaps = 3/59 (5%)

Query  1   MTAVNETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQST  59
           M    E  R++++++KLA   P  K+   +  I+ EF  ++ + D    A++L++ QS 
Sbjct  1   MAEAKEVVRVYRRILKLAAQYPSIKRNAIIREIKLEFHANKHLTDN---AKILDKVQSA  56

>CCA17521
Length=104

 Score = 29.6 bits (65),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 24/34 (71%), Gaps = 0/34 (0%)

Query  10  IFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDI  43
           +++++++LA+  P  K+   + +IR EFR+ RDI
Sbjct  9   LYRRILRLARRYPSIKRDAIINDIRMEFRESRDI  42

>PPTG_09252
Length=105

 Score = 29.6 bits (65),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 15/65 (23%), Positives = 36/65 (55%), Gaps = 0/65 (0%)

Query  1   MTAVNETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTI  60
           M    E  R++++++KLA+  P  K+   + +I+ EF  ++++ D  ++ + L   ++ I
Sbjct  1   MAETKEVLRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGI  60

Query  61  GYLKI  65
             L +
Sbjct  61  TELSM  65

>H257_18406
Length=607

 Score = 30.0 bits (66),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 28/55 (51%), Gaps = 0/55 (0%)

Query  57   QSTIGYLKIVTPHKRSDSGVKHFVYKDGERIEKSLQAGEKAKFKVQDMEEGLKRH  111
            +ST+  + +    K+S +G      K+  +I KSL A       + D+ +GLKRH
Sbjct  295  KSTLHLVDLAGSEKQSATGATGTRLKEASQINKSLSALSNVITGLVDVSKGLKRH  349

>H257_07358
Length=98

 Score = 28.9 bits (63),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 12/49 (24%), Positives = 30/49 (61%), Gaps = 0/49 (0%)

Query  1   MTAVNETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQL  49
           M++     +I++++++LA   P  KQ   + +I+ EF +++ + DP ++
Sbjct  1   MSSSPTVPQIYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDPAKI  49

>H310_01863
Length=645

 Score = 29.3 bits (64),  Expect = 6.5, Method: Composition-based stats.
 Identities = 17/55 (31%), Positives = 28/55 (51%), Gaps = 0/55 (0%)

Query  57   QSTIGYLKIVTPHKRSDSGVKHFVYKDGERIEKSLQAGEKAKFKVQDMEEGLKRH  111
            +ST+  + +    K+S +G      K+  +I KSL A       + D+ +GLKRH
Sbjct  330  KSTLHLVDLAGSEKQSATGTTGTRLKEASQINKSLSALSNVITGLVDVSKGLKRH  384

>PYIW_27085
Length=365

 Score = 28.9 bits (63),  Expect = 9.7, Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 24/48 (50%), Gaps = 2/48 (4%)

Query  62   YLKIVTPHKRSDSGVK--HFVYKDGERIEKSLQAGEKAKFKVQDMEEG  107
            +   +   +R+ S +K   F +  G   + S+Q GE  +F+VQ   EG
Sbjct  301  FEATIADQERASSSLKFASFAFPSGPTTDNSVQFGEFGEFEVQSSSEG  348

Lambda      K        H        a         alpha
   0.321    0.135    0.370    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3408016320

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40