Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
CCI4411316077223223212112e-170
PYIR_21527999463160760.72
PYIR_13641383954695760.82
PHYSO_4766343398123075732.2
HYAP_0454484097464806710.0
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= CCI44113

Length=232
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

CCI44113                                                              471        2e-170
PYIR_21527                                                            33.9       0.72  
PYIR_13641                                                            33.9       0.82  
PHYSO_476634                                                          32.7       2.2   
HYAP_04544                                                            30.4       10.0  

>CCI44113
Length=232

 Score = 471 bits (1211),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 232/232 (100%), Positives = 232/232 (100%), Gaps = 0/232 (0%)

Query  1    MQEKFPCVSRWMQQDNSCLKEKHSRVSKISAHLILLNDAEQNLVHIQDQVGADNLTRSIS  60
            MQEKFPCVSRWMQQDNSCLKEKHSRVSKISAHLILLNDAEQNLVHIQDQVGADNLTRSIS
Sbjct  1    MQEKFPCVSRWMQQDNSCLKEKHSRVSKISAHLILLNDAEQNLVHIQDQVGADNLTRSIS  60

Query  61   SFSLVVKHGVDNLVVDGDTFASSDSSSEKFVDCVAKVEGPADSFIIASTSFCKAISDRTA  120
            SFSLVVKHGVDNLVVDGDTFASSDSSSEKFVDCVAKVEGPADSFIIASTSFCKAISDRTA
Sbjct  61   SFSLVVKHGVDNLVVDGDTFASSDSSSEKFVDCVAKVEGPADSFIIASTSFCKAISDRTA  120

Query  121  LALSLQIRNNSSLIWSLFPSNHPQTRPRNSFGIPAKQSATTDFISLGIGRGKISSIQVSV  180
            LALSLQIRNNSSLIWSLFPSNHPQTRPRNSFGIPAKQSATTDFISLGIGRGKISSIQVSV
Sbjct  121  LALSLQIRNNSSLIWSLFPSNHPQTRPRNSFGIPAKQSATTDFISLGIGRGKISSIQVSV  180

Query  181  KDLLILLNLTRFRSSFRVFDNLFRCFRVSPLMTVDHVCALSKEILELFTMHV  232
            KDLLILLNLTRFRSSFRVFDNLFRCFRVSPLMTVDHVCALSKEILELFTMHV
Sbjct  181  KDLLILLNLTRFRSSFRVFDNLFRCFRVSPLMTVDHVCALSKEILELFTMHV  232

>PYIR_21527
Length=463

 Score = 33.9 bits (76),  Expect = 0.72, Method: Compositional matrix adjust.
 Identities = 43/160 (27%), Positives = 62/160 (39%), Gaps = 31/160 (19%)

Query  11   WMQQDNSCLKEKHSRVSKISAHLI-----LLNDAEQNLVHIQDQVGADNLTRSISSFSLV  65
            WMQQD     EK ++ +K    L+     ++ND   +L    DQ     L  S++ F   
Sbjct  20   WMQQDT----EKQTKENKAMQELLHGVISIVNDVVADLTPPSDQHDGVRLAASVNRFIPD  75

Query  66   VKH-------GVDNLVVDGDTF------ASSDSSSEKF-------VDCVAKVEGPADSFI  105
            VKH        VD LV + +T       A+ DS  E          DC AKV    D   
Sbjct  76   VKHWKELSIDKVDKLVSEWETVLLSWREAALDSKKEVRESCGLFQEDCDAKVRQICDLHE  135

Query  106  IASTSFCKAISDRTALALSLQI--RNNSSLIWSLFPSNHP  143
            +   +  K I D T      Q+   + +  IW+    + P
Sbjct  136  LERAALTKKILDLTTFTEQQQMLCEDYAGGIWNAAARSQP  175

>PYIR_13641
Length=546

 Score = 33.9 bits (76),  Expect = 0.82, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 44/95 (46%), Gaps = 7/95 (7%)

Query  32   HLILLNDAEQNLVHIQDQVGADNLTRSISSFSLVVKHGVDNLVVDGDTFASSDSSSEKFV  91
            H +L  DAE+ L  I  Q GA+    S  S      H VD   V+GD      S S+K+V
Sbjct  323  HPLLPEDAEKGLARISLQAGAET---SYVSHPTTPGH-VDATAVNGDV-KPQQSFSDKYV  377

Query  92   DCVAKVEGPADSFIIASTSFCKAISDRTALALSLQ  126
              +  VE  A  +I A   F  A +D   LA++ +
Sbjct  378  KSLKYVEPVA--WITAVGDFFHAFTDGVVLAVAFK  410

>PHYSO_476634
Length=1230

 Score = 32.7 bits (73),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 34/75 (45%), Gaps = 5/75 (7%)

Query  58    SISSFSLVVKHGVDNLVVDGDTFASSDSSSEKFVDCVAKVEGPADSFIIASTSFCKAISD  117
             SIS  SL  KHG      D   F  S + SE F  C  K +GP     I S +   A S 
Sbjct  998   SISQVSLQDKHGGVFCPSDTVGFLLSVAPSELFFACPQKSDGP-----IRSLARLTAGSA  1052

Query  118   RTALALSLQIRNNSS  132
             RTAL  S   RN +S
Sbjct  1053  RTALPRSPTSRNEAS  1067

>HYAP_04544
Length=464

 Score = 30.4 bits (67),  Expect = 10.0, Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 38/80 (48%), Gaps = 4/80 (5%)

Query  19   LKEKHSRVSKISAHLILLNDAEQNLVHIQDQVGADNLTRSISSFSLVVKHGVDNLVVDGD  78
            + ++ + +++   H  L  D+E   VH  D+V  DN  + I  +  V +        DG+
Sbjct  55   MGQQFTNLTRHIRHFRLATDSETMQVHRMDEVVIDNHEKGIPVWGGVHR----ETAPDGN  110

Query  79   TFASSDSSSEKFVDCVAKVE  98
               S+  +S+ F D +AK E
Sbjct  111  VHYSTPLTSKTFDDFMAKYE  130

Lambda      K        H        a         alpha
   0.322    0.133    0.385    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 11973961080

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40