Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
CCI4411215548122822811122e-155
CCA228441554812792805442e-68
PHYRA_81097111994239971613e-12
PHYRA_8109314759298971633e-12
PPTG_17130147593121001616e-12
PHYCA_55616414759301981591e-11
PHALS_0647514759223971561e-11
PHYSO_29328614759318971537e-11
PYU1_G00173214759294971474e-10
PITG_1845914759311851413e-09
HYAP_0710514759271661201e-06
PYVX_1919114759296641149e-06
PHYKE_839514758142065880.031
PYAP_177681475911280711.2
PYU1_G01430410912102544741.7
PHYRA_77344539580669713.5
PYVX_1768878972219782704.9
H257_1719012786668641688.8
PPTG_1955865021000165689.2
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= CCI44112

Length=228
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

CCI44112                                                              432        2e-155
CCA22844                                                              214        2e-68 
PHYRA_81097                                                           66.6       3e-12 
PHYRA_81093                                                           67.4       3e-12 
PPTG_17130                                                            66.6       6e-12 
PHYCA_556164                                                          65.9       1e-11 
PHALS_06475                                                           64.7       1e-11 
PHYSO_293286                                                          63.5       7e-11 
PYU1_G001732                                                          61.2       4e-10 
PITG_18459                                                            58.9       3e-09 
HYAP_07105                                                            50.8       1e-06 
PYVX_19191                                                            48.5       9e-06 
PHYKE_8395                                                            38.5       0.031 
PYAP_17768                                                            32.0       1.2   
PYU1_G014304                                                          33.1       1.7   
PHYRA_77344                                                           32.0       3.5   
PYVX_17688                                                            31.6       4.9   
H257_17190                                                            30.8       8.8   
PPTG_19558                                                            30.8       9.2   

>CCI44112
Length=228

 Score = 432 bits (1112),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 228/228 (100%), Positives = 228/228 (100%), Gaps = 0/228 (0%)

Query  1    MTKTLSDSSVFVAYQRQAESGTSSNEEENPVHTklkpkprkknrkkkASEKTLLKELAMC  60
            MTKTLSDSSVFVAYQRQAESGTSSNEEENPVHTKLKPKPRKKNRKKKASEKTLLKELAMC
Sbjct  1    MTKTLSDSSVFVAYQRQAESGTSSNEEENPVHTKLKPKPRKKNRKKKASEKTLLKELAMC  60

Query  61   KMDNKKGTKNTAVRKPSKEPDATNVTANTADYIAPKIQDSHRIQAKMATSFAKAEKTELA  120
            KMDNKKGTKNTAVRKPSKEPDATNVTANTADYIAPKIQDSHRIQAKMATSFAKAEKTELA
Sbjct  61   KMDNKKGTKNTAVRKPSKEPDATNVTANTADYIAPKIQDSHRIQAKMATSFAKAEKTELA  120

Query  121  PSPPQDLEASSVSAHMSELLLTKKQNAQLLENQQILIEANAKINEQYRQSQETIANLRDE  180
            PSPPQDLEASSVSAHMSELLLTKKQNAQLLENQQILIEANAKINEQYRQSQETIANLRDE
Sbjct  121  PSPPQDLEASSVSAHMSELLLTKKQNAQLLENQQILIEANAKINEQYRQSQETIANLRDE  180

Query  181  LIFLRQMCLSSQNEVSLLKAASSTPSVTNTDSHGNSRKIPCRPPPGIL  228
            LIFLRQMCLSSQNEVSLLKAASSTPSVTNTDSHGNSRKIPCRPPPGIL
Sbjct  181  LIFLRQMCLSSQNEVSLLKAASSTPSVTNTDSHGNSRKIPCRPPPGIL  228

>CCA22844
Length=279

 Score = 214 bits (544),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 149/280 (53%), Positives = 180/280 (64%), Gaps = 53/280 (19%)

Query  1    MTKTLSDSSVFVAYQRQAESGTSSNEEENPVHTklkpkprkknrkkkASEKTLLKELAMC  60
            M K+ SD+SVFVAYQRQA+S TSSNEE+NP  T+ K KPRKKNRKKK SE++LLKELAMC
Sbjct  1    MAKSASDASVFVAYQRQADSETSSNEEDNPSSTQSKQKPRKKNRKKKGSERSLLKELAMC  60

Query  61   KMDNKKGTK-----NTAVRKPSKEPDATNVTANTADYIAPKIQDSHR-------------  102
            K+D KKG K      T   KP K+P A +    TA+ +  K +DSHR             
Sbjct  61   KIDKKKGGKNQNKATTVNSKPPKQP-AVSTPVVTAEIVQSKQRDSHRNQVSELQSVVLML  119

Query  103  --------------IQAKMATSFAKAEKTELAPSPPQDLEASSVSAHMSELLLTKKQNAQ  148
                          ++ K+  ++ K + T+ A +P Q LEASSVSA MSELLLTKKQNAQ
Sbjct  120  FPDRNCAVLCCLMNMKTKLTPAYQKTDNTKPAFTPTQGLEASSVSALMSELLLTKKQNAQ  179

Query  149  LLENQQILIEANAKINEQYRQSQ------------------ETIANLRDELIFLRQMCLS  190
            LLENQQ LI ANAKIN+QY+QSQ                  ETIA LR+ELIFL ++C+S
Sbjct  180  LLENQQRLIAANAKINDQYQQSQGIQKCEVGYLRVYIYNYVETIAQLRNELIFLHEVCMS  239

Query  191  SQNEVSLLKAASSTPSV--TNTDSHGNSRKIPCRPPPGIL  228
            SQNEVSLLKAA+S  S+   N + H  SRK+ CRPPPGIL
Sbjct  240  SQNEVSLLKAAASISSLPTHNANPHRESRKVGCRPPPGIL  279

>PHYRA_81097
Length=239

 Score = 66.6 bits (161),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 58/97 (60%), Gaps = 10/97 (10%)

Query  131  SVSAHMSELLLTKKQNAQLLENQQILIEANAKINEQYRQSQETIANLRDELIFLRQMCLS  190
            +V+  M +LLL+ +QN+QLL  Q  L  AN  + +Q ++S E I  L++E+   RQMCL+
Sbjct  152  AVTEVMDQLLLSTQQNSQLLMVQDQLGHANRNLQDQLQRSGEIINGLQNEVAMFRQMCLN  211

Query  191  SQNEVSLLKAASSTPSVTNTDSHGNSRKIPCRPPPGI  227
             Q EVSLL++++        D  GN      RPPPG+
Sbjct  212  LQAEVSLLRSSAG------PDVGGNHH----RPPPGM  238

>PHYRA_81093
Length=298

 Score = 67.4 bits (163),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 59/97 (61%), Gaps = 10/97 (10%)

Query  131  SVSAHMSELLLTKKQNAQLLENQQILIEANAKINEQYRQSQETIANLRDELIFLRQMCLS  190
            +V+  M +LLL+ +QN+QLL  Q  L  AN  + +Q ++S E I  L++E+   RQMCL+
Sbjct  211  AVTEVMDQLLLSTQQNSQLLMVQDQLGHANRNLQDQLQRSGEIINGLQNEVAMFRQMCLN  270

Query  191  SQNEVSLLKAASSTPSVTNTDSHGNSRKIPCRPPPGI  227
             Q EVSLL+ +S+ P V      GN      RPPPG+
Sbjct  271  LQAEVSLLR-SSAGPDVG-----GNHH----RPPPGM  297

>PPTG_17130
Length=312

 Score = 66.6 bits (161),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 63/100 (63%), Gaps = 7/100 (7%)

Query  131  SVSAHMSELLLTKKQNAQLLENQQILIEANAKINEQYRQSQETIANLRDELIFLRQMCLS  190
            +V+  M +LL   +QNAQLL  Q+ L  AN  + +Q ++S E I  L++E+   RQMCL+
Sbjct  216  AVTEVMDQLLRYTQQNAQLLMVQEQLGHANRNLQDQLQRSAEIINGLQNEVTMFRQMCLN  275

Query  191  SQNEVSLLKAASSTPSVTNTDSHGNSRKIP---CRPPPGI  227
             Q EVSLL++++   +V+ T   GN+ + P    RPPPG+
Sbjct  276  LQAEVSLLRSST---TVSTTPDAGNNPQ-PQHHHRPPPGM  311

>PHYCA_556164
Length=301

 Score = 65.9 bits (159),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 61/98 (62%), Gaps = 6/98 (6%)

Query  131  SVSAHMSELLLTKKQNAQLLENQQILIEANAKINEQYRQSQETIANLRDELIFLRQMCLS  190
            +V+  M +LL   +QNAQLL  Q+ L  AN  + +Q ++S E I  L++E+   RQMCL+
Sbjct  208  AVTEVMDQLLRYTQQNAQLLMVQEQLGHANRNLQDQLQRSAEMINGLQNEVTMFRQMCLN  267

Query  191  SQNEVSLLKAASSTPSVTNTDSHGNSR-KIPCRPPPGI  227
             Q EVSLL+++++ P     D+  N + +   RPPPG+
Sbjct  268  LQAEVSLLRSSTTAP-----DAGSNPQPQHHHRPPPGM  300

>PHALS_06475
Length=223

 Score = 64.7 bits (156),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 58/97 (60%), Gaps = 2/97 (2%)

Query  131  SVSAHMSELLLTKKQNAQLLENQQILIEANAKINEQYRQSQETIANLRDELIFLRQMCLS  190
            SV+  M +LL   +QN QLL  Q+ L  AN  + +Q ++S E I+ L++E+   RQMCL+
Sbjct  128  SVTEVMDQLLRYTQQNTQLLAVQEQLGHANRNLQDQLQRSAEIISGLQNEVTIFRQMCLN  187

Query  191  SQNEVSLLKAASSTPSVTNTDSHGNSRKIPCRPPPGI  227
             Q EVSLL+  S+T      D+  N +    RPPPG+
Sbjct  188  LQAEVSLLR--SNTAVQIAPDASSNPQLQYHRPPPGM  222

>PHYSO_293286
Length=318

 Score = 63.5 bits (153),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 55/97 (57%), Gaps = 0/97 (0%)

Query  131  SVSAHMSELLLTKKQNAQLLENQQILIEANAKINEQYRQSQETIANLRDELIFLRQMCLS  190
            +V+  M +LL   +QNAQLL  Q+ L  AN  + +Q ++S E I  L++E+   RQMCL+
Sbjct  221  AVTEVMDQLLRYTQQNAQLLMVQEQLGHANRSLQDQLQRSAEIINGLQNEVTMFRQMCLN  280

Query  191  SQNEVSLLKAASSTPSVTNTDSHGNSRKIPCRPPPGI  227
             Q EVSLL++    P    + S     +   R PPG+
Sbjct  281  LQAEVSLLRSNVPAPDAAGSSSSNPQPQHHHRAPPGM  317

>PYU1_G001732
Length=294

 Score = 61.2 bits (147),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 58/97 (60%), Gaps = 1/97 (1%)

Query  131  SVSAHMSELLLTKKQNAQLLENQQILIEANAKINEQYRQSQETIANLRDELIFLRQMCLS  190
            +VS  M +L L   QN QL   Q+ L  AN ++ E+ ++  E I +L++E+   RQMCL+
Sbjct  199  AVSEMMDQLYLFGHQNTQLRIVQEQLTVANHQMQERLQRDAEIINSLQNEVTMFRQMCLN  258

Query  191  SQNEVSLLKAASSTPSVTNTDSHGNSRKIPCRPPPGI  227
             Q EVS+ + +SST + ++  S  +  K   RPPPG+
Sbjct  259  LQAEVSMYR-SSSTGAQSSLSSSDDINKTAHRPPPGM  294

>PITG_18459
Length=311

 Score = 58.9 bits (141),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 51/85 (60%), Gaps = 2/85 (2%)

Query  131  SVSAHMSELLLTKKQNAQLLENQQILIEANAKINEQYRQSQETIANLRDELIFLRQMCLS  190
            +V+  M +LL   +QNAQLL  Q+ L  AN  + +Q + S E I  L++E+   RQMCL+
Sbjct  216  AVTEVMDQLLRYTQQNAQLLMVQEQLGHANRNLQDQLQSSAEIINGLQNEVTMFRQMCLN  275

Query  191  SQNEVSLLKAASSTPSVTNTDSHGN  215
             Q EVSLL+  SST   T  D+  N
Sbjct  276  LQAEVSLLR--SSTTVSTAPDAGSN  298

>HYAP_07105
Length=271

 Score = 50.8 bits (120),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 41/66 (62%), Gaps = 0/66 (0%)

Query  131  SVSAHMSELLLTKKQNAQLLENQQILIEANAKINEQYRQSQETIANLRDELIFLRQMCLS  190
            +V+  M +LL   +QN+QLL  Q+ L  AN  + +Q ++  E I  L++E+   RQMCL+
Sbjct  204  AVTEVMDQLLRYTQQNSQLLLVQEQLGHANRSLQDQLQRRDEIITGLQNEVTMFRQMCLN  263

Query  191  SQNEVS  196
             Q EVS
Sbjct  264  LQAEVS  269

>PYVX_19191
Length=296

 Score = 48.5 bits (114),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 38/64 (59%), Gaps = 0/64 (0%)

Query  131  SVSAHMSELLLTKKQNAQLLENQQILIEANAKINEQYRQSQETIANLRDELIFLRQMCLS  190
            +VS  M +LL   +QNA LL  Q+ +  AN  + EQ ++  E I  L++E+   RQ+CLS
Sbjct  233  AVSEVMDQLLRFGQQNAHLLGLQEQMARANHSLQEQLQRDAEIIRGLQNEVTMFRQLCLS  292

Query  191  SQNE  194
             Q E
Sbjct  293  LQAE  296

>PHYKE_8395
Length=1420

 Score = 38.5 bits (88),  Expect = 0.031, Method: Compositional matrix adjust.
 Identities = 22/65 (34%), Positives = 38/65 (58%), Gaps = 7/65 (11%)

Query  131  SVSAHMSELLLTKKQNAQLLENQQILIEANAKINEQYRQSQETIANLRDELIFLRQMCLS  190
            +V+  M +LL   +Q +QLL  Q+       ++ +Q ++S E I  L++E+   RQMCL+
Sbjct  617  AVTDVMDQLLHYGQQTSQLLMVQE-------QLGDQLQRSAEIINGLQNEVTMFRQMCLN  669

Query  191  SQNEV  195
             Q E+
Sbjct  670  LQAEL  674

>PYAP_17768
Length=112

 Score = 32.0 bits (71),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 23/80 (29%), Positives = 39/80 (49%), Gaps = 18/80 (23%)

Query  131  SVSAHMSELLLTKKQNAQL---------------LENQQILIEANAKINEQYRQSQETIA  175
            +V+  M +L+  ++ NAQL                 N+Q+   AN  + E  ++    + 
Sbjct  24   AVAEMMDQLVRFQQHNAQLTVSSFPCFRFIEFSYFCNRQL---ANRSLQEDLQRGAAMVN  80

Query  176  NLRDELIFLRQMCLSSQNEV  195
            +L++E+   RQMCLS Q EV
Sbjct  81   SLQNEVAMFRQMCLSLQGEV  100

>PYU1_G014304
Length=1025

 Score = 33.1 bits (74),  Expect = 1.7, Method: Composition-based stats.
 Identities = 15/44 (34%), Positives = 28/44 (64%), Gaps = 0/44 (0%)

Query  155   ILIEANAKINEQYRQSQETIANLRDELIFLRQMCLSSQNEVSLL  198
             +++EA  ++N+Q R  ++ +A+LR EL  LRQ+    Q ++  L
Sbjct  964   VIVEAIKEVNKQVRTCEDDMASLRMELHELRQLLFMQQQQIDEL  1007

>PHYRA_77344
Length=806

 Score = 32.0 bits (71),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 0/69 (0%)

Query  131  SVSAHMSELLLTKKQNAQLLENQQILIEANAKINEQYRQSQETIANLRDELIFLRQMCLS  190
            S + H  E    +++ A L E Q  L +A AK NE+ RQ+       ++EL  LRQ+  S
Sbjct  690  SKAEHRREASALRQELASLQEQQTCLSQATAKSNEEARQATAKQGAQQEELASLRQLLRS  749

Query  191  SQNEVSLLK  199
             Q   S  +
Sbjct  750  QQTSFSQFR  758

>PYVX_17688
Length=2197

 Score = 31.6 bits (70),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 45/82 (55%), Gaps = 10/82 (12%)

Query  148  QLLENQQILIEANAKINEQYRQSQETI--------ANLRDELIFLRQMC-LSSQNEVSLL  198
            Q  E  ++++E +AK+++     ++ +         +  DE  F+ ++  +S++NEV L 
Sbjct  240  QTNEQPELVVEESAKVSDDVSHMEDEVPCDQVNESVHADDEPAFVEEVAPVSTKNEV-LA  298

Query  199  KAASSTPSVTNTDSHGNSRKIP  220
             A + TP+  + ++H ++R +P
Sbjct  299  VAEAETPASASDEAHSSARDLP  320

>H257_17190
Length=686

 Score = 30.8 bits (68),  Expect = 8.8, Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 28/41 (68%), Gaps = 1/41 (2%)

Query  141  LTKKQNAQLLENQQILIEAN-AKINEQYRQSQETIANLRDE  180
            L ++Q+A+ L  Q+ LI+   AKI+   R S++ +A+LRDE
Sbjct  292  LEQEQSARKLRQQEALIQDKVAKIDADLRASKQVVADLRDE  332

>PPTG_19558
Length=1000

 Score = 30.8 bits (68),  Expect = 9.2, Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 71/165 (43%), Gaps = 38/165 (23%)

Query  51   KTLLKELAMCKMDNKKGTKNTAVRKPSKEPDATNVTANTADYIAPKIQDS-HRIQAKMAT  109
            +TL +E+ + +   +   K+ A R    E   T+     ADY   ++++  +R++ ++  
Sbjct  405  QTLRQEITLLR--GRLADKDLAARSLENELVRTDEKQKQADYDIRQLKEQIYRLETELDQ  462

Query  110  SFAK-----------AEKTELAPSPPQDLEASSVSAH------MSELLLTKKQNAQLLEN  152
            S +K           AE+ +       D E S+ SAH       SEL   KK+NA L   
Sbjct  463  SRSKYQQLQQCRTSLAEQLDFGFKELLDDEESAASAHEELEKLRSELSRIKKENAALETE  522

Query  153  QQILIEA---------------NAKINEQYRQ---SQETIANLRD  179
            +Q  +E                N KI+E YRQ    +E I +L++
Sbjct  523  RQTFMEEQERVDCINRESSMRQNEKIDELYRQLMEKEEIITSLKN  567

Lambda      K        H        a         alpha
   0.306    0.119    0.316    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 11574829044

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40