Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
CCI441111475857657630070.0
CCA228431475858657820340.0
PYU1_G001733147587325339962e-125
PYIR_13418147587475369832e-123
PYIW_19969147587335289789e-123
PITG_18458147587475169083e-112
PPTG_17129147587455318988e-111
PHYKE_83951475814205449311e-110
PYAP_17763147587945328941e-109
PHALS_06476147587264918812e-108
PHYCA_511415147587445288795e-108
HYAP_07104147587215738662e-106
PHYSO_348903147587665468599e-105
PHYRA_81098147587415168552e-104
PYAR_13571147586665088031e-97
PYVX_23590147586894146471e-74
SPRG_06355147587135595666e-63
SDRG_01763147587365795553e-61
SPRG_126211382110033112282e-18
H310_082921382110073531962e-14
PYIR_141071382111764031925e-14
SDRG_045751382110033131908e-14
H257_0193413355510223521811e-12
H257_117731382110263691739e-12
PYU1_G002110138219993781684e-11
PYAP_222301382111164171675e-11
PYVX_215131382114463501523e-09
PITG_172501382110463911514e-09
PYIW_157171382111214221506e-09
PHYSO_4705331382110844041489e-09
PPTG_113651382111063981481e-08
PYAR_14788138217953671344e-07
SPRG_1050492891634188960.016
SDRG_0580592891657188860.22
PHYRA_7766813821400179800.88
PHALS_0673412937166297801.3
H310_1101715021213463741.7
PPTG_036021911538242762.8
PHALS_057958016105162772.9
PYAR_140853018779103763.2
PPTG_030939744104747763.4
PITG_2208717046136592737.7
PHYSO_3383306427788254737.8
PHYRA_8403498944151728.3
CCI42032337064452728.9
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= CCI44111

Length=576
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

CCI44111                                                              1162       0.0   
CCA22843                                                              788        0.0   
PYU1_G001733                                                          388        2e-125
PYIR_13418                                                            383        2e-123
PYIW_19969                                                            381        9e-123
PITG_18458                                                            354        3e-112
PPTG_17129                                                            350        8e-111
PHYKE_8395                                                            363        1e-110
PYAP_17763                                                            348        1e-109
PHALS_06476                                                           343        2e-108
PHYCA_511415                                                          343        5e-108
HYAP_07104                                                            338        2e-106
PHYSO_348903                                                          335        9e-105
PHYRA_81098                                                           333        2e-104
PYAR_13571                                                            313        1e-97 
PYVX_23590                                                            253        1e-74 
SPRG_06355                                                            222        6e-63 
SDRG_01763                                                            218        3e-61 
SPRG_12621                                                            92.4       2e-18 
H310_08292                                                            80.1       2e-14 
PYIR_14107                                                            78.6       5e-14 
SDRG_04575                                                            77.8       8e-14 
H257_01934                                                            74.3       1e-12 
H257_11773                                                            71.2       9e-12 
PYU1_G002110                                                          69.3       4e-11 
PYAP_22230                                                            68.9       5e-11 
PYVX_21513                                                            63.2       3e-09 
PITG_17250                                                            62.8       4e-09 
PYIW_15717                                                            62.4       6e-09 
PHYSO_470533                                                          61.6       9e-09 
PPTG_11365                                                            61.6       1e-08 
PYAR_14788                                                            56.2       4e-07 
SPRG_10504                                                            41.6       0.016 
SDRG_05805                                                            37.7       0.22  
PHYRA_77668                                                           35.4       0.88  
PHALS_06734                                                           35.4       1.3   
H310_11017                                                            33.1       1.7   
PPTG_03602                                                            33.9       2.8   
PHALS_05795                                                           34.3       2.9   
PYAR_14085                                                            33.9       3.2   
PPTG_03093                                                            33.9       3.4   
PITG_22087                                                            32.7       7.7   
PHYSO_338330                                                          32.7       7.8   
PHYRA_84034                                                           32.3       8.3   
CCI42032                                                              32.3       8.9   

>CCI44111
Length=576

 Score = 1162 bits (3007),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 576/576 (100%), Positives = 576/576 (100%), Gaps = 0/576 (0%)

Query  1    MSLPSEADDDFADDVHSFNPVSDESSLQSGSVHKSHRKFRPERTESESTQKQIEAFRDEI  60
            MSLPSEADDDFADDVHSFNPVSDESSLQSGSVHKSHRKFRPERTESESTQKQIEAFRDEI
Sbjct  1    MSLPSEADDDFADDVHSFNPVSDESSLQSGSVHKSHRKFRPERTESESTQKQIEAFRDEI  60

Query  61   KGMRKEIQNVRQELIEAIQCTRYDILKEIVTLKGQVATMSIKIDSPINAKINKLNHTTAN  120
            KGMRKEIQNVRQELIEAIQCTRYDILKEIVTLKGQVATMSIKIDSPINAKINKLNHTTAN
Sbjct  61   KGMRKEIQNVRQELIEAIQCTRYDILKEIVTLKGQVATMSIKIDSPINAKINKLNHTTAN  120

Query  121  GSACSEGADDNEILSNFVTPDRSTVLSDCSHITRLVSQSSILRESGLPTLMTMDEANLSK  180
            GSACSEGADDNEILSNFVTPDRSTVLSDCSHITRLVSQSSILRESGLPTLMTMDEANLSK
Sbjct  121  GSACSEGADDNEILSNFVTPDRSTVLSDCSHITRLVSQSSILRESGLPTLMTMDEANLSK  180

Query  181  PLSKDEIDEMFPLIDCSGDVESNALKLASGTRGWALDHITKWIQSNFENGNERVLTIVGE  240
            PLSKDEIDEMFPLIDCSGDVESNALKLASGTRGWALDHITKWIQSNFENGNERVLTIVGE
Sbjct  181  PLSKDEIDEMFPLIDCSGDVESNALKLASGTRGWALDHITKWIQSNFENGNERVLTIVGE  240

Query  241  GGAGKSTLAGYVCQKFAANLHAYHFFQFDRKlgsssrdvvlslvsQFASKLQLYKRQLTR  300
            GGAGKSTLAGYVCQKFAANLHAYHFFQFDRKLGSSSRDVVLSLVSQFASKLQLYKRQLTR
Sbjct  241  GGAGKSTLAGYVCQKFAANLHAYHFFQFDRKLGSSSRDVVLSLVSQFASKLQLYKRQLTR  300

Query  301  LNLRYILAESNPLVMATKLLIDPLRAIPESDSTFGFVLFDGIDQCLVKNQSNDLLELLSH  360
            LNLRYILAESNPLVMATKLLIDPLRAIPESDSTFGFVLFDGIDQCLVKNQSNDLLELLSH
Sbjct  301  LNLRYILAESNPLVMATKLLIDPLRAIPESDSTFGFVLFDGIDQCLVKNQSNDLLELLSH  360

Query  361  ITERFPSWIGFVVTSKAFPAFAARLKTNSVIHLDGSNVHFLQDSRILMENLLLYFEPKHT  420
            ITERFPSWIGFVVTSKAFPAFAARLKTNSVIHLDGSNVHFLQDSRILMENLLLYFEPKHT
Sbjct  361  ITERFPSWIGFVVTSKAFPAFAARLKTNSVIHLDGSNVHFLQDSRILMENLLLYFEPKHT  420

Query  421  NEACDILMRKSGGNSLYLQFINRALSHPILHGEQTFLSLDVLDELPESVDEIIFTIFDDK  480
            NEACDILMRKSGGNSLYLQFINRALSHPILHGEQTFLSLDVLDELPESVDEIIFTIFDDK
Sbjct  421  NEACDILMRKSGGNSLYLQFINRALSHPILHGEQTFLSLDVLDELPESVDEIIFTIFDDK  480

Query  481  FGQGHQRVWKNAKPILEVIVAAAAGPYPLVGESQIKQQFELRENEWRMINRAFTDIIHCG  540
            FGQGHQRVWKNAKPILEVIVAAAAGPYPLVGESQIKQQFELRENEWRMINRAFTDIIHCG
Sbjct  481  FGQGHQRVWKNAKPILEVIVAAAAGPYPLVGESQIKQQFELRENEWRMINRAFTDIIHCG  540

Query  541  TDGYRIINSSLYDWLVVEKRSQHFHLNPQAVFKFLR  576
            TDGYRIINSSLYDWLVVEKRSQHFHLNPQAVFKFLR
Sbjct  541  TDGYRIINSSLYDWLVVEKRSQHFHLNPQAVFKFLR  576

>CCA22843
Length=586

 Score = 788 bits (2034),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/578 (68%), Positives = 472/578 (82%), Gaps = 4/578 (1%)

Query  1    MSLPSEADDDFADDVHSFNPVSDESSLQSGSVHKSHRKFRPERTESESTQKQIEAFRDEI  60
            MSLPSE DD   D  +S+NP  D+  +QSG+V +S+RK + ERTESEST+ Q EA R+EI
Sbjct  9    MSLPSEVDDAIDDSFYSYNPAIDDC-VQSGTVRRSYRKIKLERTESESTKNQFEAVRNEI  67

Query  61   KGMRKEIQNVRQELIEAIQCTRYDILKEIVTLKGQVATMS---IKIDSPINAKINKLNHT  117
            + MR EIQ+VRQEL+EAIQ TRYD++KEI+ L+G+V  +     KID   +      NHT
Sbjct  68   QDMRNEIQSVRQELLEAIQSTRYDLVKEIIALQGKVTGIGNGLTKIDVKSSPTGTNENHT  127

Query  118  TANGSACSEGADDNEILSNFVTPDRSTVLSDCSHITRLVSQSSILRESGLPTLMTMDEAN  177
            TAN +A SE A+D+EI+S F+TP+RST+++DCS+ +  V++    ++S   T + +DE+ 
Sbjct  128  TANKTAFSESAEDDEIISRFITPERSTIVADCSYKSGFVTERLNTKDSSFSTSVPLDESQ  187

Query  178  LSKPLSKDEIDEMFPLIDCSGDVESNALKLASGTRGWALDHITKWIQSNFENGNERVLTI  237
            LSKPL KDE DEMFP IDC  D++SNALKLA GTR WALD + +WI+SNF++ N+ +LTI
Sbjct  188  LSKPLDKDEFDEMFPCIDCFSDLKSNALKLARGTRVWALDRVKEWIESNFKSENDHILTI  247

Query  238  VGEGGAGKSTLAGYVCQKFAANLHAYHFFQFDRKlgsssrdvvlslvsQFASKLQLYKRQ  297
            +GEGG+GKSTLAGY+CQKF A LHAYHF QFDRK  SSSRDVVLSLVSQFASK  LYKRQ
Sbjct  248  IGEGGSGKSTLAGYICQKFDAKLHAYHFCQFDRKSRSSSRDVVLSLVSQFASKNPLYKRQ  307

Query  298  LTRLNLRYILAESNPLVMATKLLIDPLRAIPESDSTFGFVLFDGIDQCLVKNQSNDLLEL  357
            LT LNLRYIL ESNPLVMA KLLI+PLRAIP S+ST GFVLFDGIDQCLV+N+SNDLL+L
Sbjct  308  LTCLNLRYILKESNPLVMANKLLIEPLRAIPVSNSTRGFVLFDGIDQCLVENESNDLLDL  367

Query  358  LSHITERFPSWIGFVVTSKAFPAFAARLKTNSVIHLDGSNVHFLQDSRILMENLLLYFEP  417
            +SHIT+RFPS IGFVVTSKA PAF A+ K+ S+IHL   N  F+ DSRILMEN +L FEP
Sbjct  368  ISHITQRFPSCIGFVVTSKASPAFDAKFKSKSIIHLHERNGKFMNDSRILMENSILNFEP  427

Query  418  KHTNEACDILMRKSGGNSLYLQFINRALSHPILHGEQTFLSLDVLDELPESVDEIIFTIF  477
            KHTNEACDILMRKSGGN LYLQF  RALSHPILHGE+TFLSLDVLDELP+SVD+I FTIF
Sbjct  428  KHTNEACDILMRKSGGNGLYLQFTERALSHPILHGERTFLSLDVLDELPDSVDDIFFTIF  487

Query  478  DDKFGQGHQRVWKNAKPILEVIVAAAAGPYPLVGESQIKQQFELRENEWRMINRAFTDII  537
            +DKFGQGHQRVWKN KPILE IVAAAAG +PLVGE QIKQ+F+L + EWRM+ R+FTDII
Sbjct  488  EDKFGQGHQRVWKNVKPILEAIVAAAAGSHPLVGERQIKQRFQLGKEEWRMMKRSFTDII  547

Query  538  HCGTDGYRIINSSLYDWLVVEKRSQHFHLNPQAVFKFL  575
             CGT+GYRII SSL+ WL+VE RSQHF+++P+A  KFL
Sbjct  548  CCGTEGYRIITSSLFAWLIVENRSQHFYIDPKAGIKFL  585

>PYU1_G001733
Length=732

 Score = 388 bits (996),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 218/533 (41%), Positives = 324/533 (61%), Gaps = 18/533 (3%)

Query  52   QIEAFRDEIKGMRKEIQNVRQELIEAIQCTRYDILKEIVTLKGQVATMSIKIDSPINAKI  111
            + +A R E+  M++E+Q +R+E++  +  TRYD+LKEI  LKG +  +   ++S      
Sbjct  151  EADALRAELVEMKQEMQTIRREMMNEMHVTRYDVLKEITMLKGTIIQLVAALES------  204

Query  112  NKLNHTTANGSA-----CSEGADDNEILSNFVTPDRSTVLSDCSHITRLVSQSSILR--E  164
              +    A G A      S    D    +  V   ++T   D      + +  +I+R   
Sbjct  205  KGVRTLDAGGVAEPQPELSPAQLDTITRTTAVHTSKAT--KDRLAAREVTAIPTIIRGTN  262

Query  165  SGLPTLMTMDEANLSKPLSKDEIDEMFPLIDCSGDVESNALKLASGTRGWALDHITKWIQ  224
            S L  L  + +  LS PL + +ID+MFPL+D S D++ +A K    +R WA +    W+ 
Sbjct  263  SRLTQLAPVADDALSTPLLQHQIDDMFPLVDFSADLQLHAQKFDPTSREWAFERFQDWVD  322

Query  225  SNFENGNERVLTIVGEGGAGKSTLAGYVCQKFAANLHAYHFFQFDRKlgsssrdvvlslv  284
            S F  G + +L +VG+GG+GKSTL G +C +F  N+ A H  +FDRK  SS R+V+LSLV
Sbjct  323  SRFNVGGDNLLALVGDGGSGKSTLVGALCDRFHDNIVALHLCKFDRKSKSSPRNVLLSLV  382

Query  285  sQFASKLQLYKRQLTRLNLRYILAESNPLVMATKLLIDPLRAIPESDSTFGFVLFDGIDQ  344
            +Q  + L L+K QL RLNL+Y+L E++PLV+A K+L+DPL A+ E   T   +L DGIDQ
Sbjct  383  NQLIANLPLFKNQLARLNLKYVLEETDPLVLARKVLVDPLCAL-EEPLTAKVLLVDGIDQ  441

Query  345  CLVKNQSNDLLELLSHITERFPSWIGFVVTSKAFPAFAARLKTNSVIHLDGSNVHFLQDS  404
            C  K++ NDLL+ L+ I   FP+W+G  +TSK  P   A+L   S++     N +++ D+
Sbjct  442  CKSKDR-NDLLDFLAAIIPEFPTWLGIFITSKPSPELPAKLAITSLLDFSPKNANYMNDT  500

Query  405  RILMENLLLYFEPKHTNEACDILMRKSGGNSLYLQFINRALSHPILHGEQTFLSLDVLDE  464
             IL+ +++  F  K  +EA DIL RKSGGN  +L F  +ALSHP +  E  ++ LDVL +
Sbjct  501  IILINDIIGNFSDKDVSEARDILKRKSGGNFTFLDFTKQALSHPGMEEENGYVPLDVLHD  560

Query  465  LPESVDEIIFTIFDDKFGQGHQRVWKNAKPILEVIVAAAAGPYPLVGESQIKQQFELREN  524
            LPES+ EI   IF+DKFG+GH R+WK  +P+L++IV AA+GPY L+ E Q ++QF L  +
Sbjct  561  LPESIYEIYDEIFEDKFGKGHNRLWKKVQPLLDLIVTAASGPYALITEEQAQEQFSLSRD  620

Query  525  EWRMINRAFTDIIHCGTDGYRIINSSLYDWLVVEKRS-QHFHLNPQAVFKFLR  576
            + RMI RAFTDII      YR+  S++Y+WLV  +RS + F++N  A    LR
Sbjct  621  DIRMIRRAFTDIIDVRHGTYRMETSAMYEWLVDPQRSGEQFYVNISASMDILR  673

>PYIR_13418
Length=747

 Score = 383 bits (983),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 214/536 (40%), Positives = 320/536 (60%), Gaps = 25/536 (5%)

Query  53   IEAFRDEIKGMRKEIQNVRQELIEAIQCTRYDILKEIVTLKGQVATMSIKIDSPINAKIN  112
            I+A R E+  M+ E+Q +R+E++  +  TRYD+LKEI  LKG +  +   ++S       
Sbjct  169  IDALRAELSEMKLEVQAIRREMMNEMHVTRYDVLKEITMLKGTIIQLVTALES------K  222

Query  113  KLNHTTANGSACSEGADDNEILSNFVTPDRSTVLSDCSHITRLVSQSSILRESGLPTLM-  171
             +    A+G+A    A          T  R+T L    + ++   +    RE   P L+ 
Sbjct  223  GVRSLDASGAAVGAEAQPELSSDELDTISRTTAL----YTSKATKERRATREDSAPVLVR  278

Query  172  ----------TMDEANLSKPLSKDEIDEMFPLIDCSGDVESNALKLASGTRGWALDHITK  221
                        D+A LS PL + +IDEMFPL++CS ++++ A      +R WA++   +
Sbjct  279  ASSRLTQLAPVADDA-LSTPLLQHQIDEMFPLVECSTELQAFAQNYDPSSREWAIERFQE  337

Query  222  WIQSNFENGNERVLTIVGEGGAGKSTLAGYVCQKFAANLHAYHFFQFDRKlgsssrdvvl  281
            W+ S F  G + +L +VG+GG+GKSTL G +C KF  N+ A H   FDRK  SS R+V+L
Sbjct  338  WVDSRFNVGVDNLLALVGDGGSGKSTLTGALCDKFHDNVVAMHLCVFDRKSKSSPRNVLL  397

Query  282  slvsQFASKLQLYKRQLTRLNLRYILAESNPLVMATKLLIDPLRAIPESDSTFGFVLFDG  341
            SLV+Q  S L L+K QL RLNL+Y+L E++PLV+A K+L+DPL A+ E  +   FV FDG
Sbjct  398  SLVNQLISNLPLFKNQLARLNLKYVLEETDPLVLARKVLVDPLCALEEPLTAKVFV-FDG  456

Query  342  IDQCLVKNQSNDLLELLSHITERFPSWIGFVVTSKAFPAFAARLKTNSVIHLDGSNVHFL  401
            IDQC  K + NDLL+ L+ I    P+W+G  +TSK  P   A+L   S++     N +++
Sbjct  457  IDQCKSKGR-NDLLDFLAVIIPELPTWVGVFITSKPSPELPAKLAITSLLDFSAKNTNYM  515

Query  402  QDSRILMENLLLYFEPKHTNEACDILMRKSGGNSLYLQFINRALSHPILHGEQTFLSLDV  461
             D+ IL+ +++  F  K   +A +IL RKSGGN  +L F  +ALSHP +  +  ++ LDV
Sbjct  516  NDTIILINDIIGNFSDKDVPQAREILKRKSGGNFTFLDFTKQALSHPGMEEDNGYIPLDV  575

Query  462  LDELPESVDEIIFTIFDDKFGQGHQRVWKNAKPILEVIVAAAAGPYPLVGESQIKQQFEL  521
            L +LPES+ EI   IF+DKFG+G  R+WK  +P+LE+IV AA+GPY L+ E+Q ++QF L
Sbjct  576  LHDLPESIYEIYEEIFEDKFGKGRSRIWKKVQPLLELIVTAASGPYALITENQAQEQFSL  635

Query  522  RENEWRMINRAFTDIIHCGTDGYRIINSSLYDWLVVEKRS-QHFHLNPQAVFKFLR  576
             + + R I RAF DII      YRI  S+L++WLV  +R+ + F+++       LR
Sbjct  636  SKEDIRTIRRAFVDIIAVNHGTYRIETSALFEWLVDPQRAGEQFYVDVSGGMNLLR  691

>PYIW_19969
Length=733

 Score = 381 bits (978),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 215/528 (41%), Positives = 324/528 (61%), Gaps = 24/528 (5%)

Query  52   QIEAFRDEIKGMRKEIQNVRQELIEAIQCTRYDILKEIVTLKGQVATMSIKIDSP--INA  109
            Q++A R E+  M+ E+Q +R+E++  +  TRYD+LKE+  LKG +  +   +++      
Sbjct  171  QLDALRTELSEMKLEVQAIRREMMNEMHVTRYDVLKEVTMLKGTILQLVTALETKGLSTD  230

Query  110  KINKLNHTTANGSACSEGADDNEILSNFVTPDRSTVLSDCSHITRLVSQSSILRESGLPT  169
            +IN ++ TTA             + ++  T DR     D S    LV  SS L +     
Sbjct  231  EINTISRTTA-------------LFTSKATKDRRAT-RDESSSPMLVRASSRLTQ-----  271

Query  170  LMTMDEANLSKPLSKDEIDEMFPLIDCSGDVESNALKLASGTRGWALDHITKWIQSNFEN  229
            L  + +  LS PL + +IDEMFPLI+CS ++ + +    S +R WA++   +WI S F  
Sbjct  272  LAPVADEALSTPLLQHQIDEMFPLIECSDELVALSRTYDSSSREWAVERFQEWIDSRFNV  331

Query  230  GNERVLTIVGEGGAGKSTLAGYVCQKFAANLHAYHFFQFDRKlgsssrdvvlslvsQFAS  289
            G + +L +VGEGG+GKSTLAG +  KF  N+ A H   FDRK  SS R+V+LSLV+Q  S
Sbjct  332  GVDNLLALVGEGGSGKSTLAGALSDKFHDNIVAIHLCTFDRKSKSSPRNVLLSLVNQMIS  391

Query  290  KLQLYKRQLTRLNLRYILAESNPLVMATKLLIDPLRAIPESDSTFGFVLFDGIDQCLVKN  349
             L L+K QL RLNL+Y+L ES+P+V+A KLL+DPL A+ E  +   F++ DG+DQC  + 
Sbjct  392  NLPLFKNQLARLNLKYVLEESDPVVLARKLLVDPLCALEEPMTAKVFMI-DGLDQCKSRG  450

Query  350  QSNDLLELLSHITERFPSWIGFVVTSKAFPAFAARLKTNSVIHLDGSNVHFLQDSRILME  409
            + NDLL+ L+ I    P+WIG  +TSK  P   ARL  +S++     N +++ D+ I++ 
Sbjct  451  R-NDLLDFLAVIIPELPTWIGVFITSKPSPELPARLAISSLLDFSAKNTNYMNDTVIMIN  509

Query  410  NLLLYFEPKHTNEACDILMRKSGGNSLYLQFINRALSHPILHGEQTFLSLDVLDELPESV  469
            +++  F  K   +A +IL RKSGGN  +L F  +ALSHP +  +  ++ LDVL +LPES+
Sbjct  510  DIIGSFSDKDVPQAREILKRKSGGNFTFLDFTKQALSHPGMEEDNGYIPLDVLHDLPESI  569

Query  470  DEIIFTIFDDKFGQGHQRVWKNAKPILEVIVAAAAGPYPLVGESQIKQQFELRENEWRMI  529
             EI   IF+DKFG+G  R+WK  +P+LE+IV AA+GPY L+ E+Q ++QF L + + R I
Sbjct  570  YEIYEEIFEDKFGKGRNRIWKKVQPLLELIVTAASGPYALITETQAQEQFALSKEDIRTI  629

Query  530  NRAFTDIIHCGTDGYRIINSSLYDWLVVEKRS-QHFHLNPQAVFKFLR  576
             R+F DII      YRI NS+L++WLV  +R+ + F+++       LR
Sbjct  630  RRSFVDIIDVRHGTYRIENSALFEWLVDPQRAGEQFYVDVSGGMSALR  677

>PITG_18458
Length=747

 Score = 354 bits (908),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 200/516 (39%), Positives = 300/516 (58%), Gaps = 9/516 (2%)

Query  52   QIEAFRDEIKGMRKEIQNVRQELIEAIQCTRYDILKEIVTLKGQVA--TMSIKIDSPINA  109
            ++E  R E+  +++E++ +R+E++  +  TRYD+LKE+  LKG +A  T +  I     +
Sbjct  151  ELERLRSEVLEVKEEVKAIRREVMNELHVTRYDVLKELALLKGAIAQLTATQHIAPASVS  210

Query  110  KINKLNHTTANGSACSEGADDNEILSNFVTPDRSTVLSDCSHITRLVSQSSILRESGLPT  169
                 +    +    +         ++  T DR        H T   +  + +R   L  
Sbjct  211  STESSSSDPLSPDERAALTRQTSTKTSQATRDRLAASRTNIHKTPPPAARASVR---LTQ  267

Query  170  LMTMDEANLSKPLSKDEIDEMFPLIDCSGDVESNALKLASGTRGWALDHITKWIQSNFEN  229
            L  + +  LS PL+  +I+EMFPLID + ++ ++A  L  GTR WAL  + +W+ + +  
Sbjct  268  LAPVADNALSTPLNPQQINEMFPLIDSTSELAAHARGLTPGTRTWALTRVEEWLDARYNL  327

Query  230  GNERVLTIVGEGGAGKSTLAGYVCQKFAANLHAYHFFQFDRKlgsssrdvvlslvsQFAS  289
            GN+ +L +VGEGG GKST  G V Q+F  NL A H  QFDRK  SS R+V+LS+V Q   
Sbjct  328  GNDTLLAVVGEGGTGKSTFCGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVD  387

Query  290  KLQLYKRQLTRLNLRYILAESNPLVMATKLLIDPLRAIPESDSTFGFVLFDGIDQCLV-K  348
             L  +K QL RLNL+Y+L E++P ++A K+L+DPL A+ E      F+L DGIDQC V  
Sbjct  388  SLPSFKNQLARLNLKYVLEEADPFLLAGKVLVDPLNAV-EEPMHATFILVDGIDQCAVGS  446

Query  349  NQSNDLLELLSHITERFPSWIGFVVTSKAFPAFAARLKTNSVIHLDGSNVHFLQDSRILM  408
            N  N+LLEL + +  + PSW+GF+V+SK     A RL  +SV+     N  F+ D+  L+
Sbjct  447  NGRNELLELFAQVIPQLPSWVGFLVSSKPSSKLAKRLPVSSVLDFSAKNGAFVADASSLV  506

Query  409  ENLLLYFEPKHTNEACDILMRKSGGNSLYLQFINRALSHPILHG--EQTFLSLDVLDELP  466
            +++   F      EA  +L +KSGGN  YL+F  +ALSHP +    ++  + L+VL ELP
Sbjct  507  DDIARNFSDDDAAEAKKVLKKKSGGNFAYLEFTKQALSHPGIAAASKEGAVPLEVLHELP  566

Query  467  ESVDEIIFTIFDDKFGQGHQRVWKNAKPILEVIVAAAAGPYPLVGESQIKQQFELRENEW  526
            E++ +I   IF+DKFGQG  RVW  AKP+L+++V AAAGPY  V E Q K+ F L   + 
Sbjct  567  ETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAAAGPYSPVTEEQAKEHFNLTTEDL  626

Query  527  RMINRAFTDIIHCGTDGYRIINSSLYDWLVVEKRSQ  562
            RM+ R+F D++      YRI +S+L  WL    RS+
Sbjct  627  RMLRRSFVDLVSVKHGSYRIESSALCAWLSDPARSE  662

>PPTG_17129
Length=745

 Score = 350 bits (898),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 202/531 (38%), Positives = 307/531 (58%), Gaps = 10/531 (2%)

Query  52   QIEAFRDEIKGMRKEIQNVRQELIEAIQCTRYDILKEIVTLKGQVATMSIKIDSPINAKI  111
            ++E  R E+  +++E++ +R+E++  +  TRYD+LKE+  LKG +A ++    S   +  
Sbjct  155  ELERLRSEVLEVKEEVKAIRREVMNELHVTRYDVLKELALLKGAIAQLTATQHSAPPSVS  214

Query  112  NKLNHTTANGSACSEGA--DDNEILSNFVTPDRSTVLSDCSHITRLVSQSSILRESGLPT  169
            +  + ++   SA    A        ++  T DR        H T   +  + +R   L  
Sbjct  215  STESSSSDPLSAEERAALTRQTSTKTSQATRDRLAASRTNIHKTPPPAARASVR---LTQ  271

Query  170  LMTMDEANLSKPLSKDEIDEMFPLIDCSGDVESNALKLASGTRGWALDHITKWIQSNFEN  229
            L  + +  LS PLS  +I+EMFPLID + ++ ++A  L  GTR WAL  + +W+ + F  
Sbjct  272  LAPVADNALSTPLSPQQINEMFPLIDFTSELAAHARGLTPGTRTWALTRVEEWLDARFNV  331

Query  230  GNERVLTIVGEGGAGKSTLAGYVCQKFAANLHAYHFFQFDRKlgsssrdvvlslvsQFAS  289
            GN+ +L +VGEGG GKS   G V Q+F  NL A H  QFDRK  SS R+V+LS+V Q   
Sbjct  332  GNDTLLAVVGEGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVD  391

Query  290  KLQLYKRQLTRLNLRYILAESNPLVMATKLLIDPLRAIPESDSTFGFVLFDGIDQCLVK-  348
             L  +K QL RLNL+Y+L E++P ++A K+L+DPL A+ E      F+L DGIDQC    
Sbjct  392  NLPSFKNQLARLNLKYVLEEADPFLLAGKVLVDPLNAMEEPMHA-TFMLVDGIDQCAAGL  450

Query  349  NQSNDLLELLSHITERFPSWIGFVVTSKAFPAFAARLKTNSVIHLDGSNVHFLQDSRILM  408
            N  N+LLE  + +  + PSW+GF+++SK     A RL  +SV+     N  F+ D   ++
Sbjct  451  NGRNELLEFFAQVIPQLPSWVGFLISSKPSSKLAKRLPVSSVLDFSAKNGAFVADVSSIV  510

Query  409  ENLLLYFEPKHTNEACDILMRKSGGNSLYLQFINRALSHPILHG--EQTFLSLDVLDELP  466
            +++   F    T EA  +L +KSGGN  YL+F  +ALSHP +    ++  + L+VL ELP
Sbjct  511  DDIARNFSDDDTAEAKKVLKKKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLEVLHELP  570

Query  467  ESVDEIIFTIFDDKFGQGHQRVWKNAKPILEVIVAAAAGPYPLVGESQIKQQFELRENEW  526
            E++ +I   IF+DKFGQG  RVW  AKP+L++IV AAAGPY  + E Q K+ F+    + 
Sbjct  571  ETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLIVGAAAGPYSPMTEEQAKEHFKFTAEDL  630

Query  527  RMINRAFTDIIHCGTDGYRIINSSLYDWLVVEKRS-QHFHLNPQAVFKFLR  576
            RM+ R+F D++      YRI +S+L  WL    RS + F+ +     + LR
Sbjct  631  RMLRRSFVDLVAVKHGAYRIESSALCAWLSDPARSEEQFYFSIDDALQALR  681

>PHYKE_8395
Length=1420

 Score = 363 bits (931),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 210/544 (39%), Positives = 312/544 (57%), Gaps = 18/544 (3%)

Query  43    RTESEST--QKQIEAFRDEIKGMRKEIQNVRQELIEAIQCTRYDILKEIVTLKGQVATMS  100
             RT SE T    ++   R E++ ++ E+Q +R+E++  +  TRYD+LKE+  LKG VA +S
Sbjct  811   RTISEDTYNNNEVSRLRAELQEVKAEVQTIRREVMNELHMTRYDVLKELTLLKGAVAQLS  870

Query  101   IKIDSPINAKINKLNHTTANGSACSEGADDNEILSNFVTPDRSTVLSDCSHITRL----V  156
                     A+       + + S+    A+D   L+   +   S    D    +R+    V
Sbjct  871   A-------AQTTGSVSPSTSSSSDPLSAEDRAALTRVPSKLTSKTTKDRLAKSRVNIHTV  923

Query  157   SQSSILRESGLPTLMTMDEANLSKPLSKDEIDEMFPLIDCSGDVESNALKLASGTRGWAL  216
                +      L  L  + +  LS PL+  +I+EMFPLID + ++ ++A  L  GTR WAL
Sbjct  924   PPPAARASVRLTQLAPVADNALSTPLNPQQINEMFPLIDFTSELAAHARGLVPGTRTWAL  983

Query  217   DHITKWIQSNFENGNERVLTIVGEGGAGKSTLAGYVCQKFAANLHAYHFFQFDRKlgsss  276
               + +W+ + F  GN+ VL +VG+GG GKS   G V Q+F  NL A H  QFDRK  S+ 
Sbjct  984   TRVEEWLDARFNVGNDTVLAVVGDGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSTP  1043

Query  277   rdvvlslvsQFASKLQLYKRQLTRLNLRYILAESNPLVMATKLLIDPLRAIPESDSTFGF  336
             R+V+LS V Q    L  +K QL RLNL+Y+L ES+P ++A K+ +DPL A+ E      F
Sbjct  1044  RNVLLSFVHQLVDNLPPFKNQLARLNLKYVLEESDPFLLAAKVFVDPLNAVEEPIHA-TF  1102

Query  337   VLFDGIDQCLV-KNQSNDLLELLSHITERFPSWIGFVVTSKAFPAFAARLKTNSVIHLDG  395
             +L +G+DQC    N  N+LLE LS I  + PSW+GF+++SK F  FA RL  +SV+    
Sbjct  1103  MLVEGLDQCSAGPNGRNELLEFLSQIIPQLPSWVGFMISSKPFSKFAKRLPVSSVLDFSA  1162

Query  396   SNVHFLQDSRILMENLLLYFEPKHTNEACDILMRKSGGNSLYLQFINRALSHP--ILHGE  453
              N  F+ D   L++++   F  + + EA  +L RKSGGN  YL+F  +ALSHP   +  +
Sbjct  1163  KNGAFVSDVSSLVDDIARNFSDEDSAEAKRVLKRKSGGNFAYLEFTKQALSHPGMAMASK  1222

Query  454   QTFLSLDVLDELPESVDEIIFTIFDDKFGQGHQRVWKNAKPILEVIVAAAAGPYPLVGES  513
             +  + L+VLD+LP+S+ +I   IF+DKFGQG  R+W  AKP+L++IV AAAGPY  V E 
Sbjct  1223  EGAVPLEVLDDLPQSLFDIYTEIFEDKFGQGRARIWAKAKPLLQLIVGAAAGPYSPVTEG  1282

Query  514   QIKQQFELRENEWRMINRAFTDIIHCGTDGYRIINSSLYDWLVVEKRS-QHFHLNPQAVF  572
             Q K+ F     + RM+ R+F D++      YR+ +S+L  WL    RS + F+L+     
Sbjct  1283  QAKEHFGFTTEDLRMLRRSFVDLVEVKHGAYRLESSALCSWLSDPARSEEQFYLSVDDAL  1342

Query  573   KFLR  576
               LR
Sbjct  1343  TALR  1346

>PYAP_17763
Length=794

 Score = 348 bits (894),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 201/532 (38%), Positives = 303/532 (57%), Gaps = 16/532 (3%)

Query  56   FRDEIKGMRKEIQNVRQELIEAIQCTRYDILKEIVTLKGQVATM--------SIKIDSPI  107
             R E++ M++E+Q +++E++  +  TRYD+LKE+  LKG +  +         +  D+  
Sbjct  183  LRAELREMKQEMQAIKREMMNEMHLTRYDVLKEVTMLKGTIMQLVSVIQQSGGVHFDTAT  242

Query  108  NAKINKLNHTTANGSACSEGADDNEILSNFVTPDRSTVLSDCSHITRLVSQSSILRE--S  165
             A +       AN  +  E     E LS   T   S V  +    TR      +LR   S
Sbjct  243  AAAMGIDVPPQANELSPEE----KEALSRKTTTVVSKVTKERITTTREDQIPPVLRSTSS  298

Query  166  GLPTLMTMDEANLSKPLSKDEIDEMFPLIDCSGDVESNALKLASGTRGWALDHITKWIQS  225
             L  L  +D++ LS PL +++ID+MFPLID S +V+  +    +G+R W  D + +W+ S
Sbjct  299  RLTQLAPVDDSALSTPLHQEQIDDMFPLIDFSAEVQIQSRIRETGSREWVFDRVQEWLDS  358

Query  226  NFENGNERVLTIVGEGGAGKSTLAGYVCQKFAANLHAYHFFQFDRKlgsssrdvvlslvs  285
             F  G + VL +VG+ G+GK+  A  VC K+   + A HF +FDRK  SS R+V+LSLV+
Sbjct  359  RFNVGADVVLAMVGDAGSGKTVAAASVCDKYEDQVVAKHFCKFDRKAKSSPRNVLLSLVN  418

Query  286  QFASKLQLYKRQLTRLNLRYILAESNPLVMATKLLIDPLRAIPESDSTFGFVLFDGIDQC  345
            Q  S L ++K QL RLNL+Y+L E++   ++ K+LIDPL A+ E   T  FV+FD IDQC
Sbjct  419  QLTSSLPMFKSQLARLNLKYVLEETDVPALSRKVLIDPLNAL-EEPLTPKFVVFDAIDQC  477

Query  346  LVKNQSNDLLELLSHITERFPSWIGFVVTSKAFPAFAARLKTNSVIHLDGSNVHFLQDSR  405
                  NDL + LS I    P W+GF+V+SK  P FA  +  +SV+     N +++ D+ 
Sbjct  478  RTGVGYNDLQDFLSAIIPECPKWLGFLVSSKPSPEFAVSVPVSSVLDFSAQNANYMNDTV  537

Query  406  ILMENLLLYFEPKHTNEACDILMRKSGGNSLYLQFINRALSHPILHGEQTFLSLDVLDEL  465
             L+ ++   F      EA  IL  KSGGN  YL+F  +ALS+P +     F+ +DVL +L
Sbjct  538  FLINDIAAVFHDNDQAEAKQILKTKSGGNYSYLEFTKQALSNPGMEEASGFVPVDVLHDL  597

Query  466  PESVDEIIFTIFDDKFGQGHQRVWKNAKPILEVIVAAAAGPYPLVGESQIKQQFELRENE  525
            P+S+ EI   IF+DKFG+G  RVW+ A P+L++I  AA+GPY  + E  I       ++E
Sbjct  598  PQSLYEIYEEIFEDKFGKGRTRVWRKALPVLQLIFTAASGPYAQITEQNIMDSLSYTKDE  657

Query  526  WRMINRAFTDIIHCGTDGYRIINSSLYDWLVVEKR-SQHFHLNPQAVFKFLR  576
             RM+ RAF DII      Y I++S++YDWL  ++R  + + ++     K LR
Sbjct  658  VRMLRRAFIDIISIRHGTYAIVSSAVYDWLTDQQRKGEQYFIDVNLYVKVLR  709

>PHALS_06476
Length=726

 Score = 343 bits (881),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 196/491 (40%), Positives = 291/491 (59%), Gaps = 10/491 (2%)

Query  53   IEAFRDEIKGMRKEIQNVRQELIEAIQCTRYDILKEIVTLKGQVATMSIKIDSPINAKIN  112
            +E    E+  ++ E++ +R+E++  +  TRYD+LKE+  LKG +A ++       ++ ++
Sbjct  154  LERLHSEVLKIKSEVKTIRREVMNELHVTRYDVLKELTLLKGAIAQLASTKSLNSSSSVS  213

Query  113  KLNHTTANGSACSEGA---DDNEILSNFVTPDRSTVLSDCSHITRLVSQSSILRESGLPT  169
              + ++++  +  E A         ++  T DR   L+     T      +I   + L  
Sbjct  214  STDSSSSDPLSSDERAALTRQTPTKTSQATRDR---LAAPRINTNKAPPRAIRASARLTQ  270

Query  170  LMTMDEANLSKPLSKDEIDEMFPLIDCSGDVESNALKLASGTRGWALDHITKWIQSNFEN  229
            L  + +  LS PL+  +I+E FPLID + ++ ++A  L  G+R WAL  I +W+ + F  
Sbjct  271  LAPVADDALSTPLNSQQINESFPLIDFTSELAAHARSLTPGSRSWALTRIQEWLDARFHM  330

Query  230  GNERVLTIVGEGGAGKSTLAGYVCQKFAANLHAYHFFQFDRKlgsssrdvvlslvsQFAS  289
            GN+ +L +VGEGG+GKS   G V Q+F  NL A H  QFDRK  S  R+V+LS+V Q   
Sbjct  331  GNDTLLAVVGEGGSGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSRPRNVLLSMVHQLVD  390

Query  290  KLQLYKRQLTRLNLRYILAESNPLVMATKLLIDPLRAIPESDSTFGFVLFDGIDQCLV-K  348
             L L+K QL RLNLRY+L E++P ++A K+LIDPL A+ E   +  F+L DGIDQC    
Sbjct  391  NLPLFKNQLARLNLRYVLEETDPFLLANKVLIDPLNALEEPTHS-TFILIDGIDQCATGS  449

Query  349  NQSNDLLELLSHITERFPSWIGFVVTSKAFPAFAARLKTNSVIHLDGSNVHFLQDSRILM  408
            N  N+LLE +S I    PSW+GF+V+SK     A  L  +SV+     N  F+ D+  L+
Sbjct  450  NGRNELLEFISQIISLLPSWVGFLVSSKPSSKLAKCLPVSSVLDFSAKNGAFVADASSLV  509

Query  409  ENLLLYFEPKHTNEACDILMRKSGGNSLYLQFINRALSHPILHGEQT--FLSLDVLDELP  466
            E++  YF      EA  +L +KSGGN  YL+F  +ALSHP +    T   + L VL ELP
Sbjct  510  EDISQYFSDDDAVEAKRMLTKKSGGNFAYLEFTKQALSHPGMAVTSTNGVVPLSVLRELP  569

Query  467  ESVDEIIFTIFDDKFGQGHQRVWKNAKPILEVIVAAAAGPYPLVGESQIKQQFELRENEW  526
            E++ +I   IF+DKFGQGH R W  AKP+L++IV AAAGPY LV E Q K+Q +L  ++ 
Sbjct  570  ETLYDIYAEIFEDKFGQGHARAWGKAKPLLQLIVGAAAGPYSLVTEEQAKKQLDLNADDL  629

Query  527  RMINRAFTDII  537
            RM+ R+F DI+
Sbjct  630  RMLRRSFVDIV  640

>PHYCA_511415
Length=744

 Score = 343 bits (879),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 199/528 (38%), Positives = 300/528 (57%), Gaps = 34/528 (6%)

Query  52   QIEAFRDEIKGMRKEIQNVRQELIEAIQCTRYDILKEIVTLKGQVATMSIK---------  102
            ++E  R E+  +++E++ +R+E++  +  TRYD+LKE+  LKG +A ++           
Sbjct  153  ELERLRSEVLEVKEEVKAIRREVMNELHVTRYDVLKELTLLKGAIAQLTAAQHSSPSVSS  212

Query  103  ----IDSPINAKINK-LNHTTANGSACSEGADDNEILSNFVTPDRSTVLSDCSHITRLVS  157
                   P++A+    L   T+  ++ +             T DR        H T   +
Sbjct  213  TESSSSDPLSAEERAALTRQTSTKTSAA-------------TRDRLAASRLNVHKTPPPA  259

Query  158  QSSILRESGLPTLMTMDEANLSKPLSKDEIDEMFPLIDCSGDVESNALKLASGTRGWALD  217
              + +R   L  L  + +  LS PLS  +I+EMFPLID + D+ ++A  L  G+R WAL 
Sbjct  260  ARASVR---LTQLAPVADNALSTPLSSQQINEMFPLIDFTSDLAAHARGLTPGSRTWALT  316

Query  218  HITKWIQSNFENGNERVLTIVGEGGAGKSTLAGYVCQKFAANLHAYHFFQFDRKlgsssr  277
             + +W+ + F  G + +L +VGEGG GKS   G V Q+F  NL A H  QFDRK  SS R
Sbjct  317  RVEEWLDARFNVGTDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQFDRKSKSSPR  376

Query  278  dvvlslvsQFASKLQLYKRQLTRLNLRYILAESNPLVMATKLLIDPLRAIPESDSTFGFV  337
            +V+LS+V Q    L L+K QL RLNL+Y+L E++P+++A K+L+DPL A+ E      F+
Sbjct  377  NVLLSMVHQLVDNLPLFKNQLARLNLKYVLEEADPILLAGKVLVDPLNAMEEPVHA-TFM  435

Query  338  LFDGIDQCLV-KNQSNDLLELLSHITERFPSWIGFVVTSKAFPAFAARLKTNSVIHLDGS  396
            L DGIDQC    N  N+LL+  + +  + PSWIGF+++SK     A RL  +SV+     
Sbjct  436  LVDGIDQCSAGPNGRNELLQFFAQVIPQLPSWIGFLMSSKPSSKLAKRLPVSSVLDFSAK  495

Query  397  NVHFLQDSRILMENLLLYFEPKHTNEACDILMRKSGGNSLYLQFINRALSHPILHG--EQ  454
            N  F+ D   L++++   F      EA  +L  KSGGN  YL+F  +ALSHP +    ++
Sbjct  496  NGAFVADVSSLVDDIARNFSDDDAAEAKKVLKHKSGGNFAYLEFTKQALSHPGMTATSKE  555

Query  455  TFLSLDVLDELPESVDEIIFTIFDDKFGQGHQRVWKNAKPILEVIVAAAAGPYPLVGESQ  514
              + L VL ELPE++ +I   IF+DKFGQG  RVW  AKP+L+++V AA+GPY  V E Q
Sbjct  556  GAVPLGVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAASGPYSPVTEEQ  615

Query  515  IKQQFELRENEWRMINRAFTDIIHCGTDGYRIINSSLYDWLVVEKRSQ  562
             K+ F+L   + RM+ R+F D++      YRI +S+L  WL    RS+
Sbjct  616  AKEHFKLTAEDLRMLRRSFVDLVAVKHGSYRIESSALCAWLSDPARSE  663

>HYAP_07104
Length=721

 Score = 338 bits (866),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 202/573 (35%), Positives = 319/573 (56%), Gaps = 17/573 (3%)

Query  10   DFADDVHSFNPVSDESSLQSGSVHKSHRKFRPERTESESTQKQIEAFRDEIKGMRKEIQN  69
            D A  + S N  S    L + +   SH    P      S++  +E  R E+  +++E+  
Sbjct  109  DHATSISSVNLTSTHHHLTTSTSMMSH----PRAVGGASSE--LEQLRFELIEVKQEVAA  162

Query  70   VRQELIEAIQCTRYDILKEIVTLKGQVATMSIKIDSPINAKINKLNHTTANG-SACSEGA  128
            +RQ ++  +  TRYD+LKE+  LKG +A ++     P  +    +  + +N  S+   GA
Sbjct  163  IRQHVVNELHVTRYDVLKELALLKGAIAQLTGTFPPPTTSVPLSIQRSVSNPLSSADRGA  222

Query  129  --DDNEILSNFVTPDRSTVLSDCSHITRLVSQSSILRES-GLPTLMTMDEANLSKPLSKD  185
                   +++  T DR       S +          R S  L  L  + ++ LS PLS  
Sbjct  223  LTRQTSTMTSSATRDRLA----ASRVNTYKPPPPAARASVRLTQLAPVADSALSTPLSSV  278

Query  186  EIDEMFPLIDCSGDVESNALKLASGTRGWALDHITKWIQSNFENGNERVLTIVGEGGAGK  245
            +++++FPLID + ++ ++A +L  G+R WAL    +W++S F+ G + +L +VGEGG+GK
Sbjct  279  QMNDLFPLIDFTTELAAHARRLTPGSRTWALTRAEEWLESRFKAGMDPLLAVVGEGGSGK  338

Query  246  STLAGYVCQKFAANLHAYHFFQFDRKlgsssrdvvlslvsQFASKLQLYKRQLTRLNLRY  305
            S   G V Q++   L A H  QFDRK  SS R+V+LS+V Q    L L+K QL RLNL+Y
Sbjct  339  SAFCGTVAQQYRGQLVAAHCCQFDRKGKSSPRNVLLSVVHQLVVNLPLFKNQLARLNLKY  398

Query  306  ILAESNPLVMATKLLIDPLRAIPESDSTFGFVLFDGIDQCLVKNQS-NDLLELLSHITER  364
            +L E++P+++A+K+L+DPL A+ E      F+L DGIDQC V     N+LLE L+ +  +
Sbjct  399  VLEEADPVLLASKVLVDPLNAL-EDPVDVAFMLVDGIDQCNVGPAGRNELLEFLAQLIPQ  457

Query  365  FPSWIGFVVTSKAFPAFAARLKTNSVIHLDGSNVHFLQDSRILMENLLLYFEPKHTNEAC  424
             PSW+G +V+SK     A RL  +SV+     N  F+ D   L++ +  +F+ +   EA 
Sbjct  458  LPSWLGVIVSSKPSSKLAKRLPVSSVLDFSAKNEAFVADVSSLVDEIACHFKHEDVEEAK  517

Query  425  DILMRKSGGNSLYLQFINRALSHPILHGEQTFLSLDVLDELPESVDEIIFTIFDDKFGQG  484
            ++L  KSGGN  YL+F  +ALS      ++  +++DVL ELPE++ +I   IF+DKFG G
Sbjct  518  EVLKHKSGGNFAYLEFTKQALSGMASVSKEGVVAIDVLRELPETLYDIYAEIFEDKFGHG  577

Query  485  HQRVWKNAKPILEVIVAAAAGPYPLVGESQIKQQFELRENEWRMINRAFTDIIHCGTDGY  544
              RVW  A+ +L++ + A AGPY  V E Q ++ F L   + R++ R+F D++      Y
Sbjct  578  RARVWSKAEQVLQLAIGATAGPYSPVTEEQAQEHFRLTTEDLRLLRRSFVDLVAVKHGIY  637

Query  545  RIINSSLYDWLVVEKRS-QHFHLNPQAVFKFLR  576
            RI NS+L  WL    R+ + F+ N     + LR
Sbjct  638  RIENSALCAWLCDPARAEEQFYFNIDDALQALR  670

>PHYSO_348903
Length=766

 Score = 335 bits (859),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 195/546 (36%), Positives = 309/546 (57%), Gaps = 36/546 (7%)

Query  50   QKQIEAFRDEIKGMRKEIQNVRQELIEAIQCTRYDILKEIVTLKGQVATMSIKIDSPINA  109
            + ++E  R E+  +++E++ +R+E++  +  TRYD+LKE+  LKG VA ++         
Sbjct  171  EGELERLRAEVLEVKEEVKAIRREVMNELHVTRYDVLKELALLKGAVAQLT---------  221

Query  110  KINKLNHTTANGSACSEGADDNEILSNFVTPDRSTVLSDCSHIT------RLVSQSSILR  163
                      + S  S  + D+  L      DR+ ++   S  T      RL +  + ++
Sbjct  222  -------AAQHSSPPSVSSTDSSSLDPLSADDRAKLVRQTSTKTSPATRERLAASRANVQ  274

Query  164  ESGLP---------TLMTMDEANLSKPLSKDEIDEMFPLIDCSGDVESNALKLASGTRGW  214
            ++  P          L  + +  LS PL+  +I+EMFPLID + ++ ++A  L  G+R W
Sbjct  275  KTPPPFARASVRLTQLAPVADDALSTPLTSQQINEMFPLIDFTSELAAHARGLTPGSRTW  334

Query  215  ALDHITKWIQSNFENGNERVLTIVGEGGAGKSTLAGYVCQKFAANLHAYHFFQFDRKlgs  274
            AL  + +W+ S F  G++ +L +VGEGG GKS   G V Q+F  N+ A H  QFDRK  S
Sbjct  335  ALTRVEEWLDSRFNTGSDILLAVVGEGGTGKSAFCGTVAQQFRGNMLAAHCCQFDRKSKS  394

Query  275  ssrdvvlslvsQFASKLQLYKRQLTRLNLRYILAESNPLVMATKLLIDPLRAIPESDSTF  334
            + R+V+LS+V Q       +K QL RLNL+Y+L E++P+++A K+L+DPL A+ E     
Sbjct  395  TPRNVLLSMVHQIVDNYPPFKNQLARLNLKYVLEEADPMLLAAKVLVDPLNAL-EEPVQA  453

Query  335  GFVLFDGIDQCLVKNQS-NDLLELLSHITERFPSWIGFVVTSKAFPAFAARLKTNSVIHL  393
             F++ DGIDQC    Q  N+LLE  + I  + P+W+GF+++SK     A RL  +SV+  
Sbjct  454  AFMMVDGIDQCAAGAQGRNELLEFFAQIIPQLPTWVGFLLSSKPSSKLAKRLPVSSVLDF  513

Query  394  DGSNVHFLQDSRILMENLLLYFEPKHTNEACDILMRKSGGNSLYLQFINRALSHPILHG-  452
               N  F+ D   L+E++   F      +A  +L +KSGGN  YL+F  +ALSHP +   
Sbjct  514  SAENDAFVADVAPLVEDIARNFSDDDFVKAKSMLKQKSGGNFAYLEFTKQALSHPGMAAA  573

Query  453  -EQTFLSLDVLDELPESVDEIIFTIFDDKFGQGHQRVWKNAKPILEVIVAAAAGPYPLVG  511
             ++  + L VL++LPE++ +I   IF+DKFGQG  RVW  AKP+L+++V AA+GPY  V 
Sbjct  574  SKEGAVPLGVLNDLPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAASGPYSPVT  633

Query  512  ESQIKQQFELRENEWRMINRAFTDIIHCGTDGYRIINSSLYDWLVVEKRS-QHFHLNPQA  570
            E Q ++ F L   + RM+ R+F D++      YRI +S+L  WL    RS + F+ +   
Sbjct  634  EEQAREHFNLTAEDLRMLRRSFVDLVAVRHGSYRIESSALCAWLSDPARSEEQFYFSIDD  693

Query  571  VFKFLR  576
              + LR
Sbjct  694  ALQALR  699

>PHYRA_81098
Length=741

 Score = 333 bits (855),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 198/516 (38%), Positives = 302/516 (59%), Gaps = 8/516 (2%)

Query  52   QIEAFRDEIKGMRKEIQNVRQELIEAIQCTRYDILKEIVTLKGQVATMSIKID-SPINAK  110
            ++E  R E+  +++E++ +R+E++  +  TRYD+LKE+  LKG +A ++     SP  + 
Sbjct  145  ELERLRSEVVEVKEEVKAIRREVMNELHVTRYDVLKELALLKGAIAQLAATQHLSPAASV  204

Query  111  INKLNHTTANGSACSEGADDNEILSNFVTPDRSTVLSDCSHITRLVSQSSILRES-GLPT  169
             +  + ++   SA    A   +  +   +  R  + +  ++I +    ++  R S  L  
Sbjct  205  SSTESSSSDPLSADERAALTRQTSTKTSSATRERLAASRANIHKTPPPAA--RASVRLTQ  262

Query  170  LMTMDEANLSKPLSKDEIDEMFPLIDCSGDVESNALKLASGTRGWALDHITKWIQSNFEN  229
            L  + +  LS PL+  +I++MFPLID + ++ ++A  L  G+R WAL  + +W+ + F  
Sbjct  263  LAPVADNALSTPLTPQQINDMFPLIDFTSELAAHARSLTPGSRTWALTRVEEWLDARFNV  322

Query  230  GNERVLTIVGEGGAGKSTLAGYVCQKFAANLHAYHFFQFDRKlgsssrdvvlslvsQFAS  289
            G++ +L +VGEGG GKS   G V Q+F  NL A H  QFDRK  SS R+V+LS+V Q   
Sbjct  323  GHDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVD  382

Query  290  KLQLYKRQLTRLNLRYILAESNPLVMATKLLIDPLRAIPESDSTFGFVLFDGIDQCLVKN  349
             L  +K QL RLNL+Y+L E++P V+A K+L+DPL A+ E      F+L DGIDQC    
Sbjct  383  SLPPFKNQLARLNLKYVLEEADPFVLAGKVLVDPLNAM-EEPMHATFMLVDGIDQCSAGP  441

Query  350  QS-NDLLELLSHITERFPSWIGFVVTSKAFPAFAARLKTNSVIHLDGSNVHFLQDSRILM  408
            +  N+LLE  + +    PSW+GF+V+SK     A RL  +SV+     N  F+ D   L+
Sbjct  442  RGRNELLEFFAQVIPLLPSWVGFMVSSKPSSKLAKRLPVSSVLDFSAKNGAFVSDVSSLV  501

Query  409  ENLLLYFEPKHTNEACDILMRKSGGNSLYLQFINRALSHPILHG--EQTFLSLDVLDELP  466
            E++   F      EA  +L +KSGGN  YL+F  +ALSHP +    ++  + L VL ELP
Sbjct  502  EDVARNFSDNDAAEAKKVLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLSVLHELP  561

Query  467  ESVDEIIFTIFDDKFGQGHQRVWKNAKPILEVIVAAAAGPYPLVGESQIKQQFELRENEW  526
            E++ +I   IF+DKFGQG  RVW  AKP+L++IV AAAGPY LV E Q K+ F L   + 
Sbjct  562  ETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLIVGAAAGPYSLVTEEQAKKHFNLTAEDL  621

Query  527  RMINRAFTDIIHCGTDGYRIINSSLYDWLVVEKRSQ  562
            RM+  +F D++      YRI +S+L  WL    RS+
Sbjct  622  RMLRHSFVDLVAVRHGAYRIESSALCGWLSDPARSE  657

>PYAR_13571
Length=666

 Score = 313 bits (803),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 178/508 (35%), Positives = 289/508 (57%), Gaps = 48/508 (9%)

Query  70   VRQELIEAIQCTRYDILKEIVTLKGQVATMSIKIDSPINAKINKLNHTTANGSACSEGAD  129
            +R+E++  +  +RYD+LKE+  LKG                I +L  T A  +       
Sbjct  121  IRREMMNEMHTSRYDVLKEVTMLKG---------------TITQLIETMARRTTT-----  160

Query  130  DNEILSNFVTPDRSTVLSDCSHITRLVSQSSILRESGLPTLMTMDEANLSKPLSKDEIDE  189
                +++  T +R T   D   +  L+  +S+     L  L  +D++ LS PL++++IDE
Sbjct  161  ----VASKSTKERITTTRD-DMVPPLLRATSVR----LTQLAPVDDSALSTPLTQEQIDE  211

Query  190  MFPLIDCSGDVESNALKLASGTRGWALDHITKWIQSNFENGNERVLTIVGEGGAGKSTLA  249
            +FPL+D S +V+  A     GTR WA D + +W+ S F  G++ +L +VG+ G GK+   
Sbjct  212  LFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDVLLAMVGDAGTGKT---  268

Query  250  GYVCQKFAANLHAYHFFQFDRKlgsssrdvvlslvsQFASKLQLYKRQLTRLNLRYILAE  309
                          HF +F+RK  SS R+V+LS+V+Q  + L  +K QL RLNL+Y+L E
Sbjct  269  --------------HFCKFERKGKSSPRNVLLSVVNQLTATLPTFKSQLARLNLKYVLEE  314

Query  310  SNPLVMATKLLIDPLRAIPESDSTFGFVLFDGIDQCLVKNQSNDLLELLSHITERFPSWI  369
            ++ L +A K+L+DPL ++ E   T  FVL DG+DQC V N  NDLL+ LS +    PSW+
Sbjct  315  TDVLALARKVLVDPLASL-EEPLTAKFVLLDGLDQCGVANGYNDLLDFLSVVVPECPSWL  373

Query  370  GFVVTSKAFPAFAARLKTNSVIHLDGSNVHFLQDSRILMENLLLYFEPKHTNEACDILMR  429
            GF++T+K  P FA ++   S++     N  ++ D+ +L+ +++  F  +   +A  IL  
Sbjct  374  GFLITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVAIFPTEDQADATQILKT  433

Query  430  KSGGNSLYLQFINRALSHPILHGEQTFLSLDVLDELPESVDEIIFTIFDDKFGQGHQRVW  489
            KS GN  YL+F  +A+S+P +   Q  + +DVL +LP+S+ EI   IF+DKFG+G  R+W
Sbjct  434  KSCGNYSYLEFTRQAMSNPGMEAPQGSVPVDVLHDLPQSLYEIYEEIFEDKFGKGRTRLW  493

Query  490  KNAKPILEVIVAAAAGPYPLVGESQIKQQFELRENEWRMINRAFTDIIHCGTDGYRIINS  549
            + A P+L++I  AA+GPY  + E  +       +++ RM+ RAF DII      Y I++S
Sbjct  494  RKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFIDIISIRHGTYHIVSS  553

Query  550  SLYDWLV-VEKRSQHFHLNPQAVFKFLR  576
            +L+DWL   +++ + +H++     K LR
Sbjct  554  ALFDWLTDPQRKGEPYHVDVTLHVKVLR  581

>PYVX_23590
Length=689

 Score = 253 bits (647),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 160/414 (39%), Positives = 223/414 (54%), Gaps = 52/414 (13%)

Query  168  PTLMTMDEANLSKPLSKDEIDEMFPLIDCSGDVESNALKLASGTRGWALDHITKWIQSNF  227
            PTL  +D+A LS PL  +++DE+FPL+D S D+ + A   A GTR WA   + +W+ S F
Sbjct  241  PTLAPVDDAALSAPLRPEQLDELFPLVDASTDIAAFARARAPGTRDWATARVQEWLDSRF  300

Query  228  ENGNERVLTIVGEGGAGKSTLAGYVCQKFAANLHAYHFFQFDRKlgsssrdvvlslvsQF  287
              G + +L +VG  G GKST  G VC     N+ A HF +FDRK  S+ R V+LSLV Q 
Sbjct  301  NVGQDTLLGVVGGPGTGKSTFCGSVCDMLQGNVLATHFCKFDRKAKSTPRVVLLSLVRQV  360

Query  288  ASKLQLYKRQLTRLNLRYILAESNPLVMATKLLIDPLRAIPESDSTFGFVLFDGIDQCLV  347
             + L  +KRQL RLNL+Y+L E +  V+A K+LIDPL A  E  +    VL DG+DQC  
Sbjct  361  VANLPPFKRQLARLNLKYVLEEPDVFVLAGKVLIDPLAACEEPITAKCLVL-DGLDQCKT  419

Query  348  KNQS---NDLLELLSHITERFPSWIGFVVTSKAFPAFAARLKTNSVIHLDGSNVHFLQDS  404
              +    N+LLE L+H+  + PSW+G +V+SK  P  A +LK  S++   G N  F+QD+
Sbjct  420  SRRGGVRNELLEFLAHVVPQLPSWLGVLVSSKPAPELATQLKFTSLLDFSGKNKLFVQDA  479

Query  405  RILMENLLLYFEPKHTNEACDILMRKSGGNSLYLQFINRALSHPIL-HGEQTFLSLDVLD  463
            R L++++   F   H  EA  +L  K+GGN  YL F  +ALS P L  GE   L LD+L 
Sbjct  480  RFLVDDIAANFADAHAAEARRLLETKAGGNFAYLDFTRQALSSPGLDDGE---LELDMLH  536

Query  464  ELPESVDEIIFTIFDDKFGQGHQRVWKNAKPILEVIVAAAAGPYPLVGESQIKQQFELRE  523
            +LPES+ EI   IF+D                                            
Sbjct  537  DLPESLYEIYLEIFEDN-------------------------------------------  553

Query  524  NEWRMINRAFTDIIHCGTDGYRIINSSLYDWLVVEKRS-QHFHLNPQAVFKFLR  576
            ++ R++ R+F DII      YRI +S+L++WL    RS + F  +  A    LR
Sbjct  554  DDMRLVKRSFVDIIAVRGGCYRIESSALFEWLSDPARSGESFFFDADAGVDELR  607

 Score = 42.7 bits (99),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 27/42 (64%), Gaps = 0/42 (0%)

Query  53   IEAFRDEIKGMRKEIQNVRQELIEAIQCTRYDILKEIVTLKG  94
            + A R E+  +R E Q +R+E++  +   RYD+LKE+  LKG
Sbjct  148  LAALRAELADVRAETQAIRREVMNELHVLRYDVLKEVTVLKG  189

>SPRG_06355
Length=713

 Score = 222 bits (566),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 163/559 (29%), Positives = 298/559 (53%), Gaps = 69/559 (12%)

Query  60   IKGMRKEIQNVRQELIEAIQCTRYDILKEIVTLKGQVATMSIKID-------SPI----N  108
            +  M++ +  +R++++  +  T+YD+LKE+  L+G V  +   +        +P+    +
Sbjct  146  VDEMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMHQQPRAAATPLLRTED  205

Query  109  AKINKLNHTTANGSACSEGA--DDNEIL------------SNFVTPDR--STVLSDC---  149
             K++ ++  T +  A SE +  ++ E+             S   +P +  STV+ +    
Sbjct  206  RKLSVMSDATVSSEADSESSTLEEPEVFEPNPKVPYLPAASRTPSPPKRESTVVRESIRA  265

Query  150  -SHITRLVSQ-----SSILRESGL----PTLMTMDEANLSKPLSKDEIDEMFPLIDCSGD  199
             S ++R  S+     S I RES       T   + +  L++P  ++ +++  P ++    
Sbjct  266  SSKLSRESSKLSRESSKISRESSKLFRESTRQPIKDQALTQPW-ENVLNQHLPFLNT---  321

Query  200  VESNALKLASGTRGWALDHITKWIQSNFENGNERVLTIVGEGGAGKSTLAGYVCQKFAAN  259
             +  A+++   TR WA++   KW Q        RVL +VG  GAGKSTL  ++   +   
Sbjct  322  -QRPAMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVSNYPEQ  380

Query  260  LHAYHFFQFDRKlgsssrdvvlslvsQFASKLQLYKRQLTRLNLRYILAESNPLVMATKL  319
            + A HF ++D +   ++  +++SL  Q + KL  +++QL RLNL Y++ E +P+V+ATKL
Sbjct  381  IMASHFVRYDER--HATSAILMSLAHQISCKLPDFQQQLVRLNLAYLIQEPDPVVLATKL  438

Query  320  LIDPLRAIPESDSTFGFVLFDGIDQCLVKNQSNDLLELLSHITERFPSWIGFVVTSKAFP  379
            LI+PLR++P    +   VL D +D+      +N L+ LL+ +   FPSW+ F+++S+   
Sbjct  439  LIEPLRSMPAPLESQVIVL-DAVDEDASTPGTN-LISLLADVALEFPSWVLFLLSSRPVD  496

Query  380  AFAARLKTNSVIHLDGSNVHFLQDSRILMENLLLYFEPKHTNEACDILM---RKSGGNSL  436
            +    L T+ V+H    +  F  D  I +++L+     KH  +  +IL     KS G+ L
Sbjct  497  SVLKALPTHDVLHFHMEHRPFAADCTIAVQSLM----DKHGLDDKNILFLLKAKSQGSFL  552

Query  437  YLQFINRALSHPILHGEQTFLSLDVLDELPESVDEIIFTIFDDKFGQGHQRVWKNAKPIL  496
            YLQF+++A +  ++H E   +   ++ ELP+++ EI   +F++K+G+G +RVW+  +P+L
Sbjct  553  YLQFVDQAFA--MIHSE---IDAGMILELPKTLYEIYDQVFEEKYGKGRRRVWQKVQPVL  607

Query  497  EVIVAAAAGPY-----PLVGESQIKQQFELRENEWRMINRAFTDIIHCG--TDGYRIINS  549
            E IV AA   +     P V ES ++  F+L + +  +I R+F DI+     T  YR+ + 
Sbjct  608  EAIVGAATLSHEKNACPFVTESDVQHIFKLGQPDLALIARSFEDIVAVDEETGVYRLQSK  667

Query  550  SLYDWLVVEKRSQHF-HLN  567
             L+D+LV   RSQ   H+N
Sbjct  668  GLFDYLVDTSRSQEVAHIN  686

>SDRG_01763
Length=736

 Score = 218 bits (555),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 159/579 (27%), Positives = 295/579 (51%), Gaps = 83/579 (14%)

Query  60   IKGMRKEIQNVRQELIEAIQCTRYDILKEIVTLKGQVATM---------SIKIDSPI---  107
            +  M++ +  +R++++  +  T+YD+LKE+  L+G V  +            + +P+   
Sbjct  159  VDEMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMHQQSTPRAVATPLLRT  218

Query  108  -NAKINKLNHTTANGSACSEGADDNE--------------ILSNFVTPDR--STVLSDCS  150
             + K++ ++  T +  A SE +   E                S   +P +  STV  + +
Sbjct  219  EDRKLSVMSDATVSSEADSEDSTHEEPEVFEPNPKVPYLPAASRTPSPPKRESTVFREST  278

Query  151  HITRLVSQ--SSILRESGLPTLMTMDEANLSKPLSK---------------------DEI  187
              +  +S+  S + RES   + ++ + + LS+  SK                     + +
Sbjct  279  RASSKLSRESSKLSRES---SKLSRESSKLSRESSKLLFRESTRQPIKDQALTQPWENVL  335

Query  188  DEMFPLIDCSGDVESNALKLASGTRGWALDHITKWIQSNFENGNERVLTIVGEGGAGKST  247
            ++  P ++     +  A+++   TR WA++   KW Q        RVL +VG  GAGKST
Sbjct  336  NQHLPFLNT----QRPAMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKST  391

Query  248  LAGYVCQKFAANLHAYHFFQFDRKlgsssrdvvlslvsQFASKLQLYKRQLTRLNLRYIL  307
            L  ++   +   + A HF ++D +   +   +++SL  Q + KL  Y++QL RLNL Y++
Sbjct  392  LLSHLVSNYPEQIMASHFVRYDER--HAPSAILMSLAHQISCKLPDYQQQLVRLNLPYLI  449

Query  308  AESNPLVMATKLLIDPLRAIPESDSTFGFVLFDGIDQCLVKNQSNDLLELLSHITERFPS  367
             E +P+V+ATKLLI+PLR++P    +   ++ D +D+  V     +L+ LL+ +   FPS
Sbjct  450  QEPDPIVLATKLLIEPLRSMPAPLES-QVIVLDAVDED-VSTPGANLISLLADVALEFPS  507

Query  368  WIGFVVTSKAFPAFAARLKTNSVIHLDGSNVHFLQDSRILMENLLLYFEPKHTNEACDIL  427
            W+ F+++S+   +    L  + V+H    +  F  D  I +++++     KH  +  +IL
Sbjct  508  WVLFLLSSRLVESVLKALPAHDVLHFHMEHRPFAADCTIAVQSVM----DKHGLDDKNIL  563

Query  428  M---RKSGGNSLYLQFINRALSHPILHGEQTFLSLDVLDELPESVDEIIFTIFDDKFGQG  484
                 KS G+ LYLQF+++A S  ++H E   +   ++ ELP+++ EI   +F++K+G+G
Sbjct  564  FLLKAKSQGSFLYLQFVDQAFS--MIHSE---IDAGMILELPKTLHEIYDQVFEEKYGKG  618

Query  485  HQRVWKNAKPILEVIVAAAAGPY-----PLVGESQIKQQFELRENEWRMINRAFTDIIHC  539
             +RVW+  + +LE IV AA   +     P V ES ++  F+L + +  +I R+F DI+  
Sbjct  619  RRRVWQKVQAVLEAIVGAATISHEKNACPFVTESDVQHIFKLGQPDLALIARSFEDIVTV  678

Query  540  GTDG--YRIINSSLYDWLVVEKRSQHF-HLNPQAVFKFL  575
              D   YR+ +  L+D+LV   RSQ   H+N +    +L
Sbjct  679  DEDTGVYRLQSKGLFDYLVDTARSQEVTHINVERGIHYL  717

>SPRG_12621
Length=1003

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 88/311 (28%), Positives = 144/311 (46%), Gaps = 25/311 (8%)

Query  201  ESNALKLASGTRGWALDHITKWIQSNFENGNERVLTIVGEGGAGKSTLAGYVCQKFAANL  260
            ++N        R W LD + +W Q++     ++V  + G+ G GKS LA Y+ Q     +
Sbjct  450  QTNKYTQGFAGREWVLDQLDQWKQTH-----DQVFWVTGQIGTGKSALAAYIIQS-RPEV  503

Query  261  HAYHFFQFDRKlgsssrdvvlslvsQFASKLQLYKRQLTRLN-LRYILAESNPLVMATKL  319
             A+H    + +   S R  VLSL  Q  ++L  Y   L + + L  ++  S  + +   L
Sbjct  504  RAFHLVCKEDEQTQSHRRCVLSLAYQLTTQLPEYASFLQQGSPLEEVVPVSTVVELLDIL  563

Query  320  LIDPLRAIPESDSTFGFVLFDGIDQCLVKNQSND--LLELLSHITERFPSWIGFVVTSKA  377
            L+ PLRAI E  +T   +L DG+D  L   Q  D  L+  L  + ++ PSW+  ++TS+ 
Sbjct  564  LVAPLRAIAEPATTPLVILLDGLDS-LEDTQETDNCLVSALPALLQKLPSWVRVILTSRE  622

Query  378  FPAFAARLKTNSV-IHLDGSNVHFLQDSRILMENLLLYFEPKHT-----NEACDILMRKS  431
             P    +L+  +  I LD    H  QD    ++  LL + P  T           +  ++
Sbjct  623  DPVVMRKLQGFAPQIALDKCADHSRQDIMSYLQKALLPYLPSTTAGVVPEATLQFIAGRA  682

Query  432  GGNSLYLQFINRALSHPILHGEQTFLSLDVLDELPESVDEIIFTIFDDKFGQGHQRVWKN  491
             G  LY   I  ALS       Q  L+LD L+  P  +   +   F+ +F   H +  ++
Sbjct  683  EGLFLYASHIVHALS-------QHRLTLDNLEGFPTGMGGYLRQFFESQFTPEHYK--EH  733

Query  492  AKPILEVIVAA  502
             +P+LEV+ AA
Sbjct  734  IRPLLEVLCAA  744

>H310_08292
Length=1007

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 88/353 (25%), Positives = 152/353 (43%), Gaps = 28/353 (8%)

Query  212  RGWALDHITKWIQSNFENGNERVLTIVGEGGAGKSTLAGYVCQKFAANLHAYHFFQFDRK  271
            R W +D +T+W  S       +   + G+ G GK+ LA Y+ Q     + A+H    D +
Sbjct  455  REWVMDQLTQWKASA-----SQTFWVTGQIGTGKTALAAYIIQS-QPEVRAFHLVSKDDE  508

Query  272  lgsssrdvvlslvsQFASKLQLYKRQLTRLN-LRYILAESNPLVMATKLLIDPLRAIPES  330
               + R  +LSL  Q  ++L  Y   L +   L  I+A S+   + T LL+ PL AI + 
Sbjct  509  QTQNPRRCILSLAYQLTTQLPAYAAFLQQGEPLEEIVAVSSVTELVTTLLVVPLNAIAQP  568

Query  331  DSTFGFVLFDGIDQCL-VKNQSNDLLELLSHITERFPSWIGFVVTSKAFPAFAARLK-TN  388
             +    +L DG+D         N  +  L  +  + PSW+  + TS+  P+   +L+   
Sbjct  569  TTVPLVILLDGLDAFQDAAALDNCFVSSLVALVRKLPSWVRMIWTSREDPSVMRKLQGLV  628

Query  389  SVIHLDGSNVHFLQDS-RILMENLLLYFEPKHTN----EACDILMRKSGGNSLYLQFINR  443
              + LD        D  + L   L+ +  P        E    ++ +S G  LY   I  
Sbjct  629  PQVALDKCVDQSSADMLKYLQAALVPFVRPDEGAVVPLETLHAIVARSEGLFLYASHIVH  688

Query  444  ALSHPILHGEQTFLSLDVLDELPESVDEIIFTIFDDKFGQGHQRVWKNAKPILEVIVAAA  503
            AL        Q  L+LD L+  P  +   +   F+D+F   H     + +P+LEV+ AA 
Sbjct  689  AL-------HQKRLTLDKLESFPVGMGGYLRQFFEDQFSAHHYET--SIRPLLEVLCAAL  739

Query  504  AGPYPLVGESQIKQQFELRENEWRMINRAFTDIIHCG-TDGYRIINSSLYDWL  555
              P P+   + +    +      R    AF  +++   +D  +  ++S+++WL
Sbjct  740  E-PMPM---AMLHDVMKWDTYSHRDCLGAFKSLLYVSESDDIKPFHTSVFEWL  788

>PYIR_14107
Length=1176

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 103/403 (26%), Positives = 171/403 (42%), Gaps = 77/403 (19%)

Query  212  RGWALDHITKWIQSNFENGNERVLTIVGEGGAGKSTLAGYVCQKFAANLHAYHFFQFDRK  271
            R W    +  WI S       +V  + G+ G+GK+ LA  + Q     + A+HF   + +
Sbjct  550  REWLFMQLENWIASPTAT---QVFWVTGQIGSGKTALAARMVQVIP-EIAAFHFALQEDE  605

Query  272  lgsssrdvvlslvsQFASKLQLYKRQL-TRLNLRYILAESNPLVMATKLLIDPLRAIPES  330
               ++R  VLSL  Q  ++L  Y   L +R  L  I+  SN   + T+LL++PL  I   
Sbjct  606  QTQNARRCVLSLAYQLTTQLPQYALFLQSREPLEEIVPVSNFATLVTRLLVEPLNEIARP  665

Query  331  DSTFGFVLF-DGIDQ-------------------------------CLVKNQSND--LLE  356
             ST   VL  DG++                                C   + S D  L+ 
Sbjct  666  QSTKPLVLLIDGLEHLSSGKNSQLMTPGTSMGRPSFARSSGSNFGDCCNSSPSGDECLVS  725

Query  357  LLSHITERFPSWIGFVVTSKAFPAFAARLK--TNSVIHLDGSNVHFLQDSRILMENLL--  412
             L  +  R P+W+  V+ S+  PA  A+L+  T S++ LD       QD +  +EN+L  
Sbjct  726  ALPSLVARLPNWVRVVLLSRLDPAIVAKLQGYTPSIV-LDSLKSESQQDIKRYVENMLGE  784

Query  413  ---------LY----------FEPKHTNEACDILMRKSGGNSLYLQFINRALSHPILHGE  453
                     +Y          F  K + E  D+++++S G  LY   I +++       E
Sbjct  785  SPATTLRRGIYGSASSTGASVFSNKLSPEQVDLIVKRSEGLFLYAVNIVQSI-------E  837

Query  454  QTFLSLDVLDELPESVDEIIFTIFDDKFGQGHQRVWKNAKPILEVIVAAAAGPYPLVGES  513
            +  L++D L+ LP  +       FD  F +  Q+   + +P+LEV+ A+   P+ L    
Sbjct  838  EKRLAVDQLESLPIGMGGYFRQFFDGHFDE--QQYQDSIRPVLEVLCASFE-PFSLW---  891

Query  514  QIKQQFELRENEWRMINRAFTDIIHCGTDG-YRIINSSLYDWL  555
             I         + + I  +F  ++  G DG  R  +SS+ DW+
Sbjct  892  NIVSILNWDVYDQQKIALSFGSLLSIGADGNIRPFHSSMCDWV  934

>SDRG_04575
Length=1003

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 86/313 (27%), Positives = 141/313 (45%), Gaps = 40/313 (13%)

Query  212  RGWALDHITKWIQSNFENGNERVLTIVGEGGAGKSTLAGYVCQKFAANLHAYHFFQFDRK  271
            R W L  + +W Q++     ++V  I G+ G GKS LA Y+ Q     + A+H    + +
Sbjct  448  REWVLHQLDQWKQTH-----DQVFWITGQIGTGKSALAAYIIQS-RPEIRAFHLVCKEDE  501

Query  272  lgsssrdvvlslvsQFASKLQLYKRQLTRLN-LRYILAESNPLVMATKLLIDPLRAIPES  330
               S R  +LSL  Q  ++L  Y   L + + L  ++  S  + +   LL+ PL AI E 
Sbjct  502  QTQSHRRCILSLAYQLTTQLPEYASFLQQGSPLEEVVPVSTVVELLDILLVAPLSAIAEP  561

Query  331  DSTFGFVLFDGIDQCLVKNQSND--LLELLSHITERFPSWIGFVVTSKAFPAFAARLKT-  387
             +T   +L DG+D  L   Q  D  L+  L  + ++ PSW+  ++TS+  P    +L+  
Sbjct  562  ATTPLVILLDGLDS-LEDTQETDNCLVSALPGLLQKLPSWVRVILTSREDPVVMRKLQGF  620

Query  388  NSVIHLDGSNVHFLQDSRILMENLLLYFEP--KHTNEAC----------------DILMR  429
               I LD    +  QD    ++  L+ + P  +H                     D+L+R
Sbjct  621  TPQIALDKCVDNSRQDIMNYLQRALVPYLPSVRHRRRCSSLRGAPKVERDATTHRDLLLR  680

Query  430  KSGGNSLYLQFINRALSHPILHGEQTFLSLDVLDELPESVDEIIFTIFDDKFGQGHQRVW  489
               G  LY   I  ALS       Q  L+LD L+  P  +   +   F+ +F   H +  
Sbjct  681  I--GLFLYASHIVHALS-------QHRLTLDHLEGFPTGMGGYLRQFFESQFTPEHYK--  729

Query  490  KNAKPILEVIVAA  502
            ++ +P+LEV+ AA
Sbjct  730  EHIRPLLEVLCAA  742

>H257_01934
Length=1022

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 97/352 (28%), Positives = 155/352 (44%), Gaps = 25/352 (7%)

Query  212  RGWALDHITKWIQSNFENGNERVLTIVGEGGAGKSTLAGYVCQKFAANLHAYHFFQFDRK  271
            R W L    +W+ S   N   RV  + G  G+GK+ LA ++ Q     + A+H    + +
Sbjct  463  RAWVLHEFDEWVTSPPSNA-RRVFLLTGVIGSGKTALAAHIIQN-RPEVVAFHLASHEGE  520

Query  272  lgsssrdvvlslvsQFASKLQLYKRQLT--RLNLRYILAESNPLVMATKLLIDPLRAIPE  329
               + R  VL+LV Q  ++L  Y   L   +  L   +   N   +  +LLI PL  I  
Sbjct  521  QTQNGRRCVLNLVYQLTTQLPAYANVLKSQKEPLEETVFVGNLADLVQELLIAPLERIAT  580

Query  330  SDSTFGFVLFDGIDQCLVKNQSNDLLELLSHITERFPSWIGFVVTSKAFPAFAARLKTNS  389
              ST   +L DGI +C      N L+ +L+    R+P+W+ FV TS+  P   + L+   
Sbjct  581  PPSTM-VILIDGI-ECFPCADDN-LVAILTASLNRWPAWMRFVFTSREDPRVLSLLQAYM  637

Query  390  V--IHLDGSNVHFLQDSRILMENLL---LYFEPKHTNEACDILMRKSGGNSLYLQFINRA  444
            +  I LD +     +D R  ++  L       P       D+L+ ++ G  LY     R 
Sbjct  638  LPPIALDLACAQSKRDVRQYLDTALGSHFDISPPMPPHVIDLLVDRTQGLFLY----ARH  693

Query  445  LSHPILHGEQTFLSLDVLDELPESVDEIIFTIFDDKFGQGHQRVWKNAKPILEVIVAAAA  504
            L   I  G+    +LD LD +P ++   +   F  +F     +   + +P+LEV V AA 
Sbjct  694  LVDSISSGQ---WNLDNLDNVPTTMGGFLHQNFATQFPVV-DKYKVDVRPVLEV-VCAAH  748

Query  505  GPYPLVGESQIKQQFELRENEWRMINRAFTDIIHCGTDGYRI-INSSLYDWL  555
             P  L   S I   F++ + +   +   F  + H G  G  +  + SL DWL
Sbjct  749  EPLTLDALSAI-MHFDVYQAQ--KLQSDFGSLFHAGEGGVILPFHLSLLDWL  797

>H257_11773
Length=1026

 Score = 71.2 bits (173),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 91/369 (25%), Positives = 156/369 (42%), Gaps = 31/369 (8%)

Query  146  LSDCSHITRLVSQSSILRESG----LPTLMTMDEANLSKPLSKDEIDEMFPLIDCSGDVE  201
            LSDC  +T  ++ ++++ +      LP L+T    NL     +  +  +F       ++ 
Sbjct  404  LSDC--LTHQLTNNNVVNDVKYAVRLPQLVTALRGNLDHDGQQARLFSIFSPFSFQAEIS  461

Query  202  SNALKLASGTRGWALDHITKWIQSNFENGNERVLTIVGEGGAGKSTLAGYVCQKFAANLH  261
                  A   R W +D +T+W  S+      +   I G+ G GK+ +A  V Q     + 
Sbjct  462  KFTQGFAG--REWVMDQLTEWKASS-----SQTFWITGQIGTGKTAVAASVIQN-QPEVR  513

Query  262  AYHFFQFDRKlgsssrdvvlslvsQFASKLQLYKRQLTRLN--LRYILAESNPLVMATKL  319
            A+H    + +   + R  VLSL  Q  ++L  Y   L + +  L  I++ S    +   L
Sbjct  514  AFHLVSKEDEQTQNHRRCVLSLAYQLTTQLPDYAAFLQQGDQPLEEIVSVSCVAELVHSL  573

Query  320  LIDPLRAIPESDSTFGFVLFDGIDQCLVKNQ-SNDLLELLSHITERFPSWIGFVVTSKAF  378
            L+ PL AI +  +    +L DG+D     N   N  +  L+      P W+ +V+TS+  
Sbjct  574  LVVPLNAIAQPSTVPLVILIDGLDAFQDSNAVENCFVSSLAAAVRNLPPWVRWVLTSRED  633

Query  379  PAFAARLK-TNSVIHLDGSNVHFLQDSRILMENLLLYFEPKHTNEACDILMR----KSGG  433
            P+   +L+     + LD        D    ++  L+ F      +     +R    +S G
Sbjct  634  PSVMQKLQGLVPQVALDKCGHQTRDDMLKYLQLALVQFVANADKDVPAATLRFIVERSEG  693

Query  434  NSLYLQFINRALSHPILHGEQTFLSLDVLDELPESVDEIIFTIFDDKFGQGHQRVWKNAK  493
              LY   I  ALS       Q  L+LD L+  P  +   +   F+D+F   H     + +
Sbjct  694  LFLYASHIVNALS-------QKRLTLDKLESFPVGMGGYLRQYFEDQFTALHYET--SVR  744

Query  494  PILEVIVAA  502
            P+LEV+ AA
Sbjct  745  PLLEVLCAA  753

>PYU1_G002110
Length=999

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 93/378 (25%), Positives = 168/378 (44%), Gaps = 47/378 (12%)

Query  206  KLASG--TRGWALDHITKWIQSNFENGNERVLTIVGEGGAGKSTLAGYVCQKFAANLHAY  263
            KLAS    R W +  +TKWI S   +   ++  + G+ G+GK+ LA  + Q     + A+
Sbjct  424  KLASRFVGRKWLIAQLTKWIDSPTAS---QMFWVTGQIGSGKTALAARLVQTIP-EIKAF  479

Query  264  HFFQFDRKlgsssrdvvlslvsQFASKLQLYKRQL-TRLNLRYILAESNPLVMATKLLID  322
            HF   + +   ++R  VLSL  Q  ++L+ Y   L  R  L  ++  S    + T LLI 
Sbjct  480  HFAFEEDEQTQNARRCVLSLAYQLTTQLKDYAAFLQAREPLEELVPVSTFNELVTHLLIK  539

Query  323  PLRAIPE--SDSTFGFVLFDGIDQ------------CLVKNQS--NDLLELLSHITERFP  366
            PL  I +  S +T   +L DG++              +   QS    L+  L  +  + P
Sbjct  540  PLNEIAQLQSQNTPLVLLIDGLENLSDGKSDVSSLPVMTSRQSFAQCLVSALPSLVSQLP  599

Query  367  SWIGFVVTSKAFPAFAARLKT-------NSVIHLDGSNV-HFLQDSRILMENLLLYFEPK  418
             W+  +V S+  PA  A+L+         + +  +  ++  F++ S     +  L     
Sbjct  600  KWVRVIVLSRNDPAINAKLQNFTPNIVLEAYVKENKEDIKQFIEKSLCSSASTGLSSGKT  659

Query  419  HTNEACDILMRKSGGNSLYLQFINRALSHPILHGEQTFLSLDVLDELPESVDEIIFTIFD  478
               +  D+++ +S G  LY   + ++L       E+ + +  V   LP  ++  ++  F 
Sbjct  660  LPPDQIDLIVERSEGLFLYAANVVQSL-------EEKWFA--VGQSLPIGMNGYLYDFFV  710

Query  479  DKFGQGHQRVWKNAKPILEVIVAAAAGPYPLVGESQIKQQFELRENEWRMINRAFTDIIH  538
              FG    +  +  +P+LEV+ AA    +  +    I    +L+ NE + I  AF  ++ 
Sbjct  711  SHFGAKQYK--RLIRPVLEVLCAA----FEPLSLPTIASILKLQTNEQQEIATAFGSLLS  764

Query  539  CGTDG-YRIINSSLYDWL  555
             G DG  R  +SS+ +W+
Sbjct  765  IGADGSVRPFHSSVLNWV  782

>PYAP_22230
Length=1116

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 95/417 (23%), Positives = 170/417 (41%), Gaps = 89/417 (21%)

Query  212  RGWALDHITKWIQSNFENGNERVLTIVGEGGAGKSTLAGYVCQKFAANLHAYHFFQFDRK  271
            R W L+ I +WI +   +G+ +V  + G+ G+GK+++A  + Q     + A+HF   D  
Sbjct  496  RAWLLESIRQWINTPVTSGS-KVFWVTGQIGSGKTSVAARMVQ-LMPEIAAFHFALQDDD  553

Query  272  lgsssrdvvlslvsQFASKLQLYKRQL-TRLNLRYILAESNPLVMATKLLIDPLRAI--P  328
                +R  VLSL  Q  ++L  Y   L T   L  I+  S+   + T LL++PL AI  P
Sbjct  554  QTQLARRCVLSLAYQLTTQLPEYAVFLQTGDPLEEIVPVSSVQALLTHLLVNPLNAIARP  613

Query  329  ESDSTFGFVLFDGIDQCLVKNQ---------------------------------SND--  353
            +SD     +L DG++  +  N                                  S+D  
Sbjct  614  KSDKPV-VLLIDGLEHLVSTNDNVAGGPPALRPSLGRGTGSTNSTTASLCDESSGSSDEC  672

Query  354  LLELLSHITERFPSWIGFVVTSKAFPAFAARLKTNS-VIHLDGSNVHFLQDSRILMENLL  412
            L+ LL  +  R P W+  ++ S+  P+   +L+  +  I LD        D R  +E  L
Sbjct  673  LVSLLPSLISRLPLWVRVILLSREDPSILLKLQVYTPSIALDRHERENEADIREFVEMAL  732

Query  413  LYFEPKHTN---------------------------------EACDILMRKSGGNSLYLQ  439
               +P+ ++                                 E  +++ ++S G  LY  
Sbjct  733  CSPDPQSSHISRTVQVAPPIRHRSPSITALSVSDNTPRKISAEQVEVITKRSEGLFLYAA  792

Query  440  FINRALSHPILHGEQTFLSLDVLDELPESVDEIIFTIFDDKFGQGHQRVWKNAKPILEVI  499
             I +A+       E+  L++D L+ LP  +   +   F+  F     +     +P+LEV+
Sbjct  793  NIVQAI-------EEGRLAVDQLETLPVGLGGYLRQFFESHFDDATYKT--KIRPVLEVL  843

Query  500  VAAAAGPYPLVGESQIKQQFELRENEWRMINRAFTDIIHCGTDGY-RIINSSLYDWL  555
             AA    Y  +  + +   F     E + +  +F+ ++    D Y R  +SS+ +W+
Sbjct  844  CAA----YEPMTTAMLASIFHWSTYEQQEMASSFSALLFVSDDDYVRPFHSSVLEWV  896

>PYVX_21513
Length=1446

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 84/350 (24%), Positives = 139/350 (40%), Gaps = 76/350 (22%)

Query  212  RGWALDHITKWIQSNFENGNERVLTIVGEGGAGKSTLAGYVCQKFAANLHAYHFFQFDRK  271
            R W    + +WI  +    + RV  I G+ G+GK+++A  + Q F   + A+HF   +  
Sbjct  438  RDWLFKRVQQWINDSSSGTDHRVFWITGQIGSGKTSVAARMVQTF-PEIAAFHFALQEDD  496

Query  272  lgsssrdvvlslvsQFASKLQLYKRQL-TRLNLRYILAESNPLVMATKLLIDPLRAIPES  330
                +R  VLSL  Q  ++L  Y   L +R  L  I+  S    + T LL++PL  I   
Sbjct  497  QTHIARRCVLSLAYQLTTQLPEYGVFLQSREPLEEIVPVSTFHTLVTHLLVEPLNTIKRP  556

Query  331  DSTFGFVLFDGIDQCLVKNQS-----------------NDLLELLSHITERFPSWIGFVV  373
                  +L DG+ +C+V   +                   L+ +L  +  R PSW+  V+
Sbjct  557  AKPL-ILLIDGL-ECIVSGATLSAPGLSLGGPPPAVLDGCLVTMLPSLVARLPSWVRLVL  614

Query  374  TSKAFPAFAARLKT--NSVIHLDGSNVHFLQD----------------------------  403
             S+       RL+T   SV+ +D    HF Q+                            
Sbjct  615  LSREDHDVMTRLQTYIPSVV-ID----HFAQENECDIKKFVGSALAPKKSLADIVEAATA  669

Query  404  -----SRILMENLLLYF------EPKHTNEACDILMRKSGGNSLYLQFINRALSHPILHG  452
                 SR+      + F       P  T E  +++ R++ G  LY   I + +       
Sbjct  670  ETSGRSRLTTLARHVSFIRSPRNRPGATTEQIEMIARRAEGLFLYAANIVQGI-------  722

Query  453  EQTFLSLDVLDELPESVDEIIFTIFDDKFGQGHQRVWKNAKPILEVIVAA  502
            E+  ++L+ LD+LP  +   +   FD  F     +     +P LEV+ AA
Sbjct  723  EEGRVALNELDKLPTGMGGCLRQFFDSHFDDNTYKT--TIRPALEVLCAA  770

>PITG_17250
Length=1046

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 96/391 (25%), Positives = 162/391 (41%), Gaps = 60/391 (15%)

Query  212  RGWALDHITKWIQ----SNFENGNERVLTIVGEGGAGKSTLAGYVCQKFAANLHAYHFFQ  267
            R W      +W+Q    S  E  N+RV  ++G+ G+GKS++A  + Q     + A+HF  
Sbjct  450  REWLFQLFQRWVQGSAASTRELSNQRVFWVIGQIGSGKSSVAACMVQA-CPEIAAFHFAT  508

Query  268  FDRKlgsssrdvvlslvsQFASKLQLYKRQL-TRLNLRYILAESNPLVMATKLLIDPLRA  326
             + +   ++R  VLSL  Q  ++L  Y   L +   L  ++  ++ + + T LLI PL A
Sbjct  509  QEDEQTHNARRCVLSLAYQLTTQLPEYAHYLQSHEPLEEMVPVASFVELVTHLLIGPLNA  568

Query  327  IPESDSTFGFVLF-DGIDQCLVKN----------QSND---LLELLSHITERFPSWIGFV  372
            I         VL  DG++  L  +          +S D   L+ +L  +  R P W+  V
Sbjct  569  IARPSKYKSLVLLIDGVEWLLPASCTPVNGGSWRESKDEECLVSMLPMLVSRLPEWVRIV  628

Query  373  VTSKAFPAFAARLKT----NSVIHL-----DGSNVHFLQDSRILMENLLLYFEPKHTN--  421
            + S+  P   ++L      + +I       D     F+  S   +    + FE       
Sbjct  629  LLSREEPPVLSKLHAFDPPDVIIEQFKLQNDQDIRRFISSSLSKLNLSDVDFEQASAQIG  688

Query  422  -----------EACDILMRKSGGNSLYLQFINRALSHPILHGEQTFLSLDVLDELPESVD  470
                       +  +++ R+S G  LY   + +A+S       +  L L  L ELP  + 
Sbjct  689  SGSDTGEFGMEQVVELIARRSEGLFLYAVNVVQAIS-------EGRLRLHELAELPVGMG  741

Query  471  EIIFTIFDDKFGQGHQRVWKNAKPILEVIVAAAAGPYPLVGESQIKQQ--FELRENEWRM  528
              +   F   F   H       +P+LEV  AA   P PL   +++ +   +E R+    M
Sbjct  742  AYLHQFFASHFAD-HDVYKHRIRPVLEVCCAAYE-PLPLATLARVLEWDVYEQRDAA-AM  798

Query  529  INRAFTDIIHCGTDG----YRIINSSLYDWL  555
            +   F+  I  G D      R  +SS+ DW+
Sbjct  799  LGSLFS--IEAGHDPEAQLLRPFHSSVLDWV  827

>PYIW_15717
Length=1121

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 97/422 (23%), Positives = 171/422 (41%), Gaps = 95/422 (23%)

Query  212  RGWALDHITKWIQSNFENGNERVLTIVGEGGAGKSTLAGYVCQKFAANLHAYHFFQFDRK  271
            R W    +  WI S       +V  + G+ G+GK+ LA  + Q     + A+HF   + +
Sbjct  525  REWLFAQLESWIASP---SAAQVFWVTGQIGSGKTALAARMVQ-LIPEIAAFHFALQEDE  580

Query  272  lgsssrdvvlslvsQFASKLQLYKRQL-TRLNLRYILAESNPLVMATKLLIDPLRAI--P  328
               ++R  VLSL  Q  ++L  Y   L +R  L  I+  SN   + T+LL++PL  I  P
Sbjct  581  QTQNARRCVLSLAYQLTTQLPQYASFLQSREPLEEIVPVSNFNTLVTRLLVEPLNDIARP  640

Query  329  ESDSTFGFVLFDGIDQCLV-----------------------------KNQSND--LLEL  357
            ++ +    +L DG++  +                              ++ SND  L+  
Sbjct  641  QTATKPLVLLIDGLEHLVSDKNAQLMATSPMGRPSFGRSSGSNFANHGQSLSNDECLVSA  700

Query  358  LSHITERFPSWIGFVVTSKAFPAFAARLKTNSV-IHLDGSNVHFLQDSRILMENLL----  412
            L  +  R P W+  V+ S+  PA  A+L+ ++  + LD       QD +  +E +L    
Sbjct  701  LPSLVARLPKWVRVVLLSRKDPAIIAKLQGHTPNVVLDRFERENQQDIKSYVEKILGEPS  760

Query  413  -----LYFEP---------------------------------KHTNEACDILMRKSGGN  434
                 +Y  P                                 K + E  ++++++S G 
Sbjct  761  PQQVGVYGSPGQPPAPMLMPRNRSPSISTLPGSNAISAGVQTSKLSPEQVNLIVKRSEGL  820

Query  435  SLYLQFINRALSHPILHGEQTFLSLDVLDELPESVDEIIFTIFDDKFGQGHQRVWKNAKP  494
             LY   I +++       E+  L +  L+ LP  +       FD  F +  Q+   + +P
Sbjct  821  FLYAVNIVQSI-------EERRLPVSQLESLPIGMGGYFRQFFDSHFDE--QQYKDSIRP  871

Query  495  ILEVIVAAAAGPYPLVGESQIKQQFELRENEWRMINRAFTDIIHCGTDG-YRIINSSLYD  553
            +LEV+ A+   P+ L   + I       + E   I  +F  ++  G DG  R  +SS+ D
Sbjct  872  VLEVLCASFE-PFSLATIASILSWSVYDQQE---IAASFGSLLFVGADGNIRPFHSSVLD  927

Query  554  WL  555
            W+
Sbjct  928  WV  929

>PHYSO_470533
Length=1084

 Score = 61.6 bits (148),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 102/404 (25%), Positives = 172/404 (43%), Gaps = 78/404 (19%)

Query  212  RGWALDHITKWIQSNF---------ENGNERVLTIVGEGGAGKSTLAGYVCQKFAANLHA  262
            R W  +   +W+Q +          E  N RV  +VG+ G+GK+++A  + Q     + A
Sbjct  472  REWLFERFQQWVQGSTTLSTSTQTGELINRRVFWLVGQIGSGKTSVAAQMVQT-CPEIAA  530

Query  263  YHFFQFDRKlgsssrdvvlslvsQFASKLQLYKRQL-TRLNLRYILAESNPLVMATKLLI  321
            +HF + + +   ++R  VLSL  Q  ++L  Y   L +   L  ++  ++ + + ++LLI
Sbjct  531  FHFARQEDEQTHNARRCVLSLAYQLTTQLPEYAHYLQSHEPLEEMVPVASFVELVSQLLI  590

Query  322  DPLRAIPESDSTFGFVLF-DGIDQCLVKNQSND----------------LLELLSHITER  364
             PL AI    +    VL  DGI + L+ N S+                 L+ +L  +  R
Sbjct  591  GPLNAIARPTTYKSLVLLIDGI-EWLIPNSSSSAPSMPTLSGGSKDEECLVSMLPALASR  649

Query  365  FPSWIGFVVTSKAFPAFAARL---KTNSVI--HLDGSNVHFLQDSRILMENLLLYFEP--  417
             P W+  VV S+  P   ++L   +   VI  H    N H ++  R L  NL L   P  
Sbjct  650  LPDWVRVVVLSREDPPVLSKLHAFEPADVIIDHFQHENDHDIR--RYL--NLSLSKLPLS  705

Query  418  -----KHTNEACDI---------------LMRKSGGNSLYLQFINRALSHPILHGEQTFL  457
                 K + +A D+               + R+S G  LY   + +A++       +  L
Sbjct  706  EVDFAKASEQAVDVPANNHEFGLEQVVELIARRSEGLFLYAVNVVQAIT-------EGRL  758

Query  458  SLDVLDELPESVDEIIFTIFDDKFGQGHQRVWKNAKPILEVIVAAAAGPYPLVGESQIKQ  517
             L  L ELP  +   +   F   F   H    +  +P+LEV+ AA   P PL   +++ +
Sbjct  759  RLHELAELPVGMGAYLQQFFASHFSD-HDMYKQRVRPVLEVLCAAYE-PLPLATLARVLE  816

Query  518  Q--FELRENEWRMINRAFTDIIHCGTDG----YRIINSSLYDWL  555
               +E R+    ++   F   I  G D      R  +SS+ DW+
Sbjct  817  WDVYEQRDAS-SVLGSLFC--IEAGYDANSQLLRPFHSSVLDWI  857

>PPTG_11365
Length=1106

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 88/398 (22%), Positives = 160/398 (40%), Gaps = 67/398 (17%)

Query  212  RGWALDHITKWIQ------SNFENGNERVLTIVGEGGAGKSTLAGYVCQKFAANLHAYHF  265
            R W  +   +W+Q      S  E  N+RV  +VG+ G+GK+++A  + Q     + A+H 
Sbjct  503  REWLFEQFQRWVQGSAASSSTRELSNQRVFWVVGQIGSGKTSVAACMVQS-CPEIAAFHL  561

Query  266  FQFDRKlgsssrdvvlslvsQFASKLQLYKRQL-TRLNLRYILAESNPLVMATKLLIDPL  324
               + +   ++R  +LSL  Q  ++L  Y   L +   L  ++  ++ + + T LLI PL
Sbjct  562  ATQEDEQTHNARRCILSLAYQLTTQLPEYAHYLQSHEPLEEMVPVASFVELVTHLLIGPL  621

Query  325  RAIPESDSTFGFVLF-DGIDQCLVKNQSNDL-----------------LELLSHITERFP  366
             AI         VL  DG++  +  + S+ +                 + +L  +  R P
Sbjct  622  TAIARPSKYKSLVLLIDGVEWLIPASSSSQMPPFSGGSWRENKDEECFVSMLPMLVSRLP  681

Query  367  SWIGFVVTSKAFPAFAARLKT----------------NSVIHLDGSNVHFLQDSRILMEN  410
             W+  V+ S+  P   ++L+                   +      ++  LQ S +  E 
Sbjct  682  EWVRIVLLSREEPPVLSKLRAFDPPDVTIEQFKHENDQDIRRYINHSLSKLQLSEVEFEK  741

Query  411  LLLYFEPKHTN-------EACDILMRKSGGNSLYLQFINRALSHPILHGEQTFLSLDVLD  463
                      N       +  +++ R+S G  LY   + +A+S   LH       L  L 
Sbjct  742  AAAQIGTDSGNNHEFGMEQVVELIARRSEGLFLYAVNVVQAISEGRLH-------LHELA  794

Query  464  ELPESVDEIIFTIFDDKFGQGHQRVWKNAKPILEVIVAAAAGPYPLVGESQIKQQ--FEL  521
            ELP  +   +   F   F   H       +P+LEV  AA   P P+   +++ +   +E 
Sbjct  795  ELPVGMGAYLQQFFASHFAD-HDMYKHRVRPVLEVCCAAYE-PLPVATIARVLEWDVYEQ  852

Query  522  RENEWRMINRAFTDIIHCGTD----GYRIINSSLYDWL  555
            R+    ++   F+  I  G D      R  ++S+ DW+
Sbjct  853  RDAA-TVLGSLFS--IEAGNDPETQTLRPFHTSVLDWV  887

>PYAR_14788
Length=795

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 87/367 (24%), Positives = 150/367 (41%), Gaps = 62/367 (17%)

Query  233  RVLTIVGEGGAGKSTLAGYVCQKFAANLHAYHFFQFDRKlgsssrdvvlslvsQFASKLQ  292
            +V  + G+ GAGK+++A  + Q     + A+HF   +      +R  VLSL  Q  ++L 
Sbjct  417  KVFWVTGQIGAGKTSVAAKMVQTIP-EIAAFHFALQEDDQTQLARRCVLSLAYQLTTQLP  475

Query  293  LYKRQL-TRLNLRYILAESNPLVMATKLLIDPLRAI--PESDSTFGFVLFDGIDQCLVKN  349
             Y   L T   L  I+  S+   +   LLI PL AI  P+SD     +L DG++  L  N
Sbjct  476  AYAVFLQTGEPLEEIVPVSSVQSLIAHLLITPLNAIARPKSDKPL-ILLIDGLEH-LASN  533

Query  350  Q--SNDLLELLSHITERFPSWIGFVVTSKAFPAFAARLKTNS-VIHLDGSNVHFLQDSRI  406
               +   + LL  +  R PSW+  ++ S+       +L+  S  + LD       +D R 
Sbjct  534  TGGAGGGVSLLPSLIARLPSWVRVILLSREDHTIVMKLQDYSPSVSLDRREQENEEDIRG  593

Query  407  LMENLLLYFEPKH-------------------------------------TNEACDILMR  429
             +E  L    P H                                     ++E  +++ +
Sbjct  594  FVEAALC--SPSHSKHSATAGSTQRHRSPSITSSFAESAPAASSPSVCKISSEQVELITK  651

Query  430  KSGGNSLYLQFINRALSHPILHGEQTFLSLDVLDELPESVDEIIFTIFDDKFGQGHQRVW  489
            +S G  LY   I +++       E+  LS+D L  LP  +   +   F+  F     +  
Sbjct  652  RSEGLFLYAVNIVQSI-------EEGRLSVDQLASLPLGLGGYLRQFFESHFDDTTYKT-  703

Query  490  KNAKPILEVIVAAAAGPYPLVGESQIKQQFELRENEWRMINRAFTDIIHCGTDGY-RIIN  548
               +P+LEV+ AA    Y  +  + +   F     +   +  +F+ +     DGY R  +
Sbjct  704  -KIRPVLEVLCAA----YEPMTTAMLASIFHWSTYDQHEMTTSFSALFCISDDGYMRPFH  758

Query  549  SSLYDWL  555
            SS+ +W+
Sbjct  759  SSVLEWV  765

>SPRG_10504
Length=1634

 Score = 41.6 bits (96),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 87/188 (46%), Gaps = 22/188 (12%)

Query  43    RTESESTQKQIEAFRDEIKGMR---KEIQNVR--QELIEAIQCTRYDILKEIVTLKGQVA  97
             R +  +T K+++A   E   M     E++ ++  Q+ +EA Q     I+++IV LK Q  
Sbjct  1000  RKQPTTTMKELQALISEASAMAFVIPELERLKALQQDVEAKQVAAQGIMQQIVCLKMQQG  1059

Query  98    TMSIKIDSPINAKINKLNHTTANGSACSE---GADDNEILSNFVTPDRSTVLSDCSHITR  154
                  +D   N     L    A  SA  E    A D+      + P+RS ++SD +++  
Sbjct  1060  R---PLDEVANDWTTLLKDEAAPLSALVETIQAAVDSLNSLGVLVPERSLLMSDLAYVNW  1116

Query  155   LVSQSSILRESGLPTLMTMDEANLSKPLSKDEIDEMFP-LIDCSGDVESNALKLASGTRG  213
             L++ +++L  S      T +  N+  P     + EMFP ++D +    S A  L    +G
Sbjct  1117  LLAANTLLMRS------TTNVHNV--PPQDWTVFEMFPSMLDLNALWSSPARNLVH--QG  1166

Query  214   WALDHITK  221
             W LD +++
Sbjct  1167  WKLDKLSE  1174

>SDRG_05805
Length=1657

 Score = 37.7 bits (86),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 87/188 (46%), Gaps = 22/188 (12%)

Query  43    RTESESTQKQIEAFRDEIKGMR---KEIQNVR--QELIEAIQCTRYDILKEIVTLKGQVA  97
             R +  +T K+++A  +E   M     E++ ++  Q+ +EA Q     I+++IV LK Q  
Sbjct  1010  RKQPTTTMKELQALINEASTMSFVIPELERLKALQQDVEAKQVAAQGIMQQIVCLKMQQG  1069

Query  98    TMSIKIDSPINAKINKLNHTTANGSACSE---GADDNEILSNFVTPDRSTVLSDCSHITR  154
                  +D   +     L       SA  E    A D+      + P+RS ++SD +++  
Sbjct  1070  R---PLDEVADDWTTLLKDEAGPLSALVETIQAAVDSLHSLGVLVPERSLLMSDLAYVNW  1126

Query  155   LVSQSSILRESGLPTLMTMDEANLSKPLSKDEIDEMFP-LIDCSGDVESNALKLASGTRG  213
             L++ +++L  S      T +  N+  P     + EMFP ++D +    S A  L    +G
Sbjct  1127  LLAANTLLMRS------TTNVHNV--PPQDWTVFEMFPSMLDLNALWSSPARNLVH--QG  1176

Query  214   WALDHITK  221
             W LD +++
Sbjct  1177  WKLDKLSE  1184

>PHYRA_77668
Length=400

 Score = 35.4 bits (80),  Expect = 0.88, Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 72/179 (40%), Gaps = 35/179 (20%)

Query  357  LLSHITERFPSWIGFVVTSKAFPAFAARL---KTNSVIHLDGSNVHFLQDSRILMENLL-  412
            +L  +  R P W+  VV S+  P   ++L   +   VI LD   +   QD R  + + L 
Sbjct  1    MLPALVSRLPEWVRIVVLSREDPPVLSKLHAFEPPDVI-LDHFQLENDQDIRRYVRHSLA  59

Query  413  ------LYFEPKHT---------------NEACDILMRKSGGNSLYLQFINRALSHPILH  451
                  + FE   T               ++  +++ R+S G  LY   + +A++   LH
Sbjct  60   KLPFSDVDFEKASTQSTGVNPDNNCEFGMDQVVELIARRSEGLFLYAVNVVQAITEGRLH  119

Query  452  GEQTFLSLDVLDELPESVDEIIFTIFDDKFGQGHQRVWKNAKPILEVIVAAAAGPYPLV  510
                   L  L ELP  +   +   F   F   H+      +P+LEV+ AA   P PL 
Sbjct  120  -------LHELAELPVGMGAYLQQFFGSHFAD-HEMYRNRVRPVLEVLCAAYE-PLPLA  169

>PHALS_06734
Length=1662

 Score = 35.4 bits (80),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 28/97 (29%), Positives = 52/97 (54%), Gaps = 8/97 (8%)

Query  9     DDFADDVHSFNPVSD--ESSLQSGSVHKSHRKFRPERTESESTQKQIEAFRDEIKGMRKE  66
             +DF+D++ +        E  LQ     +++R+   +R ++E  + ++E  RDEIK +   
Sbjct  1358  NDFSDEMATLREEKRQLERQLQEVEKERANREVSLQR-KTEMKEHEMEELRDEIKTLTAA  1416

Query  67    IQNVRQELIEAIQCTRYDILKE----IVTLKGQVATM  99
             +  VR + I+AI+  +YD L E    I  L+G+ A +
Sbjct  1417  VAAVRAK-IKAIEIAKYDDLSELESKIENLEGRTAAL  1452

>H310_11017
Length=134

 Score = 33.1 bits (74),  Expect = 1.7, Method: Composition-based stats.
 Identities = 22/63 (35%), Positives = 33/63 (52%), Gaps = 4/63 (6%)

Query  42   ERTESESTQ---KQIEAFRDEIKGMRKEIQNVRQELIEAIQCTRYDILKEIVTLKGQVAT  98
            E  +  STQ     I+  R EI G+R+EI  +R+E+ + I   R DI   + T  G VA 
Sbjct  36   ETLDMASTQAILNAIDGLRREINGLRREIDGLRREMHQNISGLRQDI-DGVDTRLGAVAL  94

Query  99   MSI  101
            + +
Sbjct  95   LQV  97

>PPTG_03602
Length=382

 Score = 33.9 bits (76),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 0/42 (0%)

Query  466  PESVDEIIFTIFDDKFGQGHQRVWKNAKPILEVIVAAAAGPY  507
            P  +D +  +IF+  FGQ  QR  K    +LE IV+ A+ P+
Sbjct  112  PSDIDRVHNSIFNRLFGQNGQRATKTISKLLEGIVSRASMPH  153

>PHALS_05795
Length=1051

 Score = 34.3 bits (77),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 19/62 (31%), Positives = 34/62 (55%), Gaps = 1/62 (2%)

Query  37   RKFRPE-RTESESTQKQIEAFRDEIKGMRKEIQNVRQELIEAIQCTRYDILKEIVTLKGQ  95
            RK + + R +    QK +++  D I G  KEI  ++ + +EA+Q      + E+ TL G+
Sbjct  129  RKIQEQVREDVHGVQKALDSISDGINGGVKEIVKMQDKTVEALQYLEMKSVTELATLPGE  188

Query  96   VA  97
            +A
Sbjct  189  IA  190

>PYAR_14085
Length=779

 Score = 33.9 bits (76),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 50/103 (49%), Gaps = 9/103 (9%)

Query  38   KFRPERTESESTQKQIEAFRDEIKGMRKEIQNVRQELIEAIQCTRYDILKEIVTLKGQVA  97
            ++R ++ + E+ Q ++ A + +IK + K   + +     A+   R  +  +I TLK +  
Sbjct  369  EWRKKQGDVETLQMKVNALQAQIKELSKAKADFK-----AVSDERKALAAQIPTLKAEAD  423

Query  98   TMSIKIDSPINAKINKLNHTTANGSACSEGADDNEILSNFVTP  140
             +  K+DS    ++ K+ +T       S   DDN I+  + TP
Sbjct  424  ALKDKLDS----ELTKIANTVDPSVPVSNNEDDNLIVKEWGTP  462

>PPTG_03093
Length=1047

 Score = 33.9 bits (76),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 23/47 (49%), Gaps = 0/47 (0%)

Query  440  FINRALSHPILHGEQTFLSLDVLDELPESVDEIIFTIFDDKFGQGHQ  486
            F+ + L    LH    FL+  +    P S  E  F +F+DK G GHQ
Sbjct  381  FVKQVLFENKLHRNYRFLNTRITFRAPRSPGEFEFRVFEDKSGHGHQ  427

>PITG_22087
Length=1365

 Score = 32.7 bits (73),  Expect = 7.7, Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 37/92 (40%), Gaps = 11/92 (12%)

Query  330  SDSTFGFVLFDGIDQCLVKNQSNDLLELLSH--ITERFPSWIGFVVTSKAFPAFAA----  383
            SDS F   +F+G+D C   N +     L +    TE+F  W G V  + A+  F      
Sbjct  644  SDSKFDVCVFEGVDYCASFNMTMGEYSLTTFEVPTEKFWLWYGIVFMAAAYVLFMFMSYF  703

Query  384  -----RLKTNSVIHLDGSNVHFLQDSRILMEN  410
                 R ++   + LD  N +   D   LM  
Sbjct  704  ALEYHRFESPENVTLDSENKNTASDEYALMRT  735

>PHYSO_338330
Length=882

 Score = 32.7 bits (73),  Expect = 7.8, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 2/54 (4%)

Query  330  SDSTFGFVLFDGIDQCLVKNQSNDLLELLSH--ITERFPSWIGFVVTSKAFPAF  381
            SDS F   +FDG+D C   N +     L +    TE+F  W G V  + A+  F
Sbjct  160  SDSKFDTCVFDGVDYCATFNMTMGEYSLSTFEVPTEKFWLWYGIVFMAAAYVFF  213

>PHYRA_84034
Length=441

 Score = 32.3 bits (72),  Expect = 8.3, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 32/51 (63%), Gaps = 1/51 (2%)

Query  43   RTESESTQKQIEAFRDEIKGMRKEIQNVRQELIEAIQCTRYDILKEIVTLK  93
            R E E   +++E+ R E+KG+R EI+   Q L +A QC    +LK++ TL+
Sbjct  288  REELEFKNRELESCRTELKGLRTEIRQTAQSLDQA-QCGNDKLLKQLETLQ  337

>CCI42032
Length=644

 Score = 32.3 bits (72),  Expect = 8.9, Method: Compositional matrix adjust.
 Identities = 17/52 (33%), Positives = 28/52 (54%), Gaps = 5/52 (10%)

Query  217  DHITKWIQSNFE-NGN----ERVLTIVGEGGAGKSTLAGYVCQKFAANLHAY  263
            + + KWI+ N + N N    +R+L + G  G GKSTL   + +  A N+  +
Sbjct  175  NELYKWIEENTKINANCTQKKRLLILSGPSGCGKSTLVQCIARTLALNVRKW  226

Lambda      K        H        a         alpha
   0.319    0.135    0.392    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 44091356400

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40