Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
CCA2284515548243143121920.0
CCA228471476036434416380.0
CCI441141476036926511022e-148
PITG_18461147604824177212e-89
PYU1_G001731147605294197217e-89
PYIR_13420147605154317172e-88
PYAP_17767147605024177126e-88
PHYSO_474929147604864177091e-87
PYAR_13572147605124236944e-85
PHYCA_576136147605694356951e-84
PPTG_17131147605774386951e-84
PHYRA_81092147605664416854e-83
PYIW_14659147605644266644e-80
PYVX_19188147606254606275e-74
H257_16579147605704255922e-69
SDRG_12684147605214205734e-67
SPRG_184151331253363945551e-66
PHALS_03627147606014275742e-66
H310_02547147605644275685e-66
SPRG_21393147604944154964e-56
PHYKE_83951475814201912065e-16
PYIW_175311430614302441942e-14
PYAP_217451430612981091736e-12
PYAR_169921430612921391728e-12
PYU1_G0074201430613461091718e-12
PYIR_236861430614092101711e-11
CCI45586143069551091701e-11
CCA21326143069541091691e-11
PPTG_045371430613281191692e-11
PYVX_187121430613022081692e-11
PHYRA_735311430613471191692e-11
HYAP_136681430612031091682e-11
PITG_178821430612891091663e-11
PHYSO_2580361430612711091664e-11
PHALS_067751430611851191654e-11
H310_135971430611911091646e-11
PHYCA_41956381781401101491e-10
SDRG_096431430611251101611e-10
SPRG_043681430611421101602e-10
H257_098611430611641091574e-10
PYVX_2037011365558871172e-05
PYIW_23821955396661131065e-04
SPRG_0734016033651581056e-04
SDRG_043041603369741047e-04
PYAP_19866113656371381030.001
CCI40882113656231111030.001
PYU1_G008908955395161091020.001
PYAR_157551136560644970.007
PYU1_G0023125445935246940.011
PYAR_181609553963160950.013
PHALS_120451136562146940.014
PYVX_147762213114371940.019
PHYSO_3495702213113370930.020
PPTG_0528222131105121930.022
PITG_025312213110065930.023
PYVX_151479553953946910.034
H310_01299160337858900.035
PYIW_188671455413151900.041
H257_00498160337158890.045
PHALS_07348317065480900.049
CCI4229915280361469890.060
CCI423019553960169890.064
HYAP_01912317067083890.067
PYIW_141042213125746890.072
PYVX_162205445933043870.076
PHYRA_94840221376165880.083
CCA1683415280361390870.092
PPTG_13469317065583870.094
PHALS_07987160336575870.094
PITG_036233170712103870.095
PHYSO_467548317065985870.10
SPRG_1003612729795551870.10
PHYRA_84807317066063870.11
PYAP_151119553974465870.12
PHYCA_503618317061446860.13
PYAP_1639134977961860.15
PYAR_25287317046446850.17
CCI40039160336576840.18
PPTG_137425445934746840.20
PYU1_G00447822131198101850.23
PHYRA_73846160335975830.25
PYVX_16052160329147820.29
H257_145811136557343830.29
PYIR_197862213128246830.32
CCA14002160378245830.33
PYIW_159661136561948830.33
PYIR_147073170704115830.34
PYAR_1722434978469820.39
PYAP_188055445939381810.49
PYIR_155305445942846810.56
PPTG_00980160338375800.57
PYAP_141842213118448810.57
H310_132041136556643800.69
PYAR_189422213120190810.70
PYIW_19776317068446800.75
PITG_01821160337275790.75
PHYSO_313441160336175790.80
PYU1_G006985317070646800.84
PYIW_17165160335675790.87
PYAP_15260317062183790.87
PYAR_18203695477446790.91
PHYCA_5419371603277159771.3
PYIR_21637160335475771.4
PYVX_1806034994823781.5
CCI43521768347281771.5
H310_0545334975181781.5
PYIW_157595445972846781.5
H257_143411521982892781.5
H257_0462213459451246771.5
PYIW_1312710838128772771.7
PYIW_16979165270104982771.8
PYU1_G005666160333875761.9
PYIR_2178811365631130761.9
PYU1_G00404534938023762.1
PHYRA_740665445935446752.5
H310_050082213100124752.9
SDRG_01249221396751753.3
H310_0065613459455346743.4
PHYKE_4935160329354733.5
CCI47818317067884743.9
PHALS_084422213134970744.3
SDRG_1047112729793747744.7
CCI11615495447674734.9
PYAP_153801490535981725.0
PHYSO_50900034984023735.1
PHALS_1379234988423735.1
CCA20931317068246735.2
PYAR_13649160339744725.4
SDRG_0353534969770726.1
PYIR_1993334981923726.2
PYIR_133648172156692726.3
PPTG_1078534987323726.5
SPRG_0036034969870726.6
PYIW_1594334993523726.7
H257_12548221397825727.0
H257_1635634977121727.7
CCI4097424551997142718.8
CCI5060224541999142719.3
PITG_197641560955090719.7
SPRG_01072221350971709.7
PYU1_G011102678659520719.7
H310_119061521982348719.8
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= CCA22845

Length=431
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

CCA22845                                                              848        0.0   
CCA22847                                                              635        0.0   
CCI44114                                                              429        2e-148
PITG_18461                                                            282        2e-89 
PYU1_G001731                                                          282        7e-89 
PYIR_13420                                                            280        2e-88 
PYAP_17767                                                            278        6e-88 
PHYSO_474929                                                          277        1e-87 
PYAR_13572                                                            271        4e-85 
PHYCA_576136                                                          272        1e-84 
PPTG_17131                                                            272        1e-84 
PHYRA_81092                                                           268        4e-83 
PYIW_14659                                                            260        4e-80 
PYVX_19188                                                            246        5e-74 
H257_16579                                                            232        2e-69 
SDRG_12684                                                            225        4e-67 
SPRG_18415                                                            218        1e-66 
PHALS_03627                                                           225        2e-66 
H310_02547                                                            223        5e-66 
SPRG_21393                                                            195        4e-56 
PHYKE_8395                                                            84.0       5e-16 
PYIW_17531                                                            79.3       2e-14 
PYAP_21745                                                            71.2       6e-12 
PYAR_16992                                                            70.9       8e-12 
PYU1_G007420                                                          70.5       8e-12 
PYIR_23686                                                            70.5       1e-11 
CCI45586                                                              70.1       1e-11 
CCA21326                                                              69.7       1e-11 
PPTG_04537                                                            69.7       2e-11 
PYVX_18712                                                            69.7       2e-11 
PHYRA_73531                                                           69.7       2e-11 
HYAP_13668                                                            69.3       2e-11 
PITG_17882                                                            68.6       3e-11 
PHYSO_258036                                                          68.6       4e-11 
PHALS_06775                                                           68.2       4e-11 
H310_13597                                                            67.8       6e-11 
PHYCA_41956                                                           62.0       1e-10 
SDRG_09643                                                            66.6       1e-10 
SPRG_04368                                                            66.2       2e-10 
H257_09861                                                            65.1       4e-10 
PYVX_20370                                                            49.7       2e-05 
PYIW_23821                                                            45.4       5e-04 
SPRG_07340                                                            45.1       6e-04 
SDRG_04304                                                            44.7       7e-04 
PYAP_19866                                                            44.3       0.001 
CCI40882                                                              44.3       0.001 
PYU1_G008908                                                          43.9       0.001 
PYAR_15755                                                            42.0       0.007 
PYU1_G002312                                                          40.8       0.011 
PYAR_18160                                                            41.2       0.013 
PHALS_12045                                                           40.8       0.014 
PYVX_14776                                                            40.8       0.019 
PHYSO_349570                                                          40.4       0.020 
PPTG_05282                                                            40.4       0.022 
PITG_02531                                                            40.4       0.023 
PYVX_15147                                                            39.7       0.034 
H310_01299                                                            39.3       0.035 
PYIW_18867                                                            39.3       0.041 
H257_00498                                                            38.9       0.045 
PHALS_07348                                                           39.3       0.049 
CCI42299                                                              38.9       0.060 
CCI42301                                                              38.9       0.064 
HYAP_01912                                                            38.9       0.067 
PYIW_14104                                                            38.9       0.072 
PYVX_16220                                                            38.1       0.076 
PHYRA_94840                                                           38.5       0.083 
CCA16834                                                              38.1       0.092 
PPTG_13469                                                            38.1       0.094 
PHALS_07987                                                           38.1       0.094 
PITG_03623                                                            38.1       0.095 
PHYSO_467548                                                          38.1       0.10  
SPRG_10036                                                            38.1       0.10  
PHYRA_84807                                                           38.1       0.11  
PYAP_15111                                                            38.1       0.12  
PHYCA_503618                                                          37.7       0.13  
PYAP_16391                                                            37.7       0.15  
PYAR_25287                                                            37.4       0.17  
CCI40039                                                              37.0       0.18  
PPTG_13742                                                            37.0       0.20  
PYU1_G004478                                                          37.4       0.23  
PHYRA_73846                                                           36.6       0.25  
PYVX_16052                                                            36.2       0.29  
H257_14581                                                            36.6       0.29  
PYIR_19786                                                            36.6       0.32  
CCA14002                                                              36.6       0.33  
PYIW_15966                                                            36.6       0.33  
PYIR_14707                                                            36.6       0.34  
PYAR_17224                                                            36.2       0.39  
PYAP_18805                                                            35.8       0.49  
PYIR_15530                                                            35.8       0.56  
PPTG_00980                                                            35.4       0.57  
PYAP_14184                                                            35.8       0.57  
H310_13204                                                            35.4       0.69  
PYAR_18942                                                            35.8       0.70  
PYIW_19776                                                            35.4       0.75  
PITG_01821                                                            35.0       0.75  
PHYSO_313441                                                          35.0       0.80  
PYU1_G006985                                                          35.4       0.84  
PYIW_17165                                                            35.0       0.87  
PYAP_15260                                                            35.0       0.87  
PYAR_18203                                                            35.0       0.91  
PHYCA_541937                                                          34.3       1.3   
PYIR_21637                                                            34.3       1.4   
PYVX_18060                                                            34.7       1.5   
CCI43521                                                              34.3       1.5   
H310_05453                                                            34.7       1.5   
PYIW_15759                                                            34.7       1.5   
H257_14341                                                            34.7       1.5   
H257_04622                                                            34.3       1.5   
PYIW_13127                                                            34.3       1.7   
PYIW_16979                                                            34.3       1.8   
PYU1_G005666                                                          33.9       1.9   
PYIR_21788                                                            33.9       1.9   
PYU1_G004045                                                          33.9       2.1   
PHYRA_74066                                                           33.5       2.5   
H310_05008                                                            33.5       2.9   
SDRG_01249                                                            33.5       3.3   
H310_00656                                                            33.1       3.4   
PHYKE_4935                                                            32.7       3.5   
CCI47818                                                              33.1       3.9   
PHALS_08442                                                           33.1       4.3   
SDRG_10471                                                            33.1       4.7   
CCI11615                                                              32.7       4.9   
PYAP_15380                                                            32.3       5.0   
PHYSO_509000                                                          32.7       5.1   
PHALS_13792                                                           32.7       5.1   
CCA20931                                                              32.7       5.2   
PYAR_13649                                                            32.3       5.4   
SDRG_03535                                                            32.3       6.1   
PYIR_19933                                                            32.3       6.2   
PYIR_13364                                                            32.3       6.3   
PPTG_10785                                                            32.3       6.5   
SPRG_00360                                                            32.3       6.6   
PYIW_15943                                                            32.3       6.7   
H257_12548                                                            32.3       7.0   
H257_16356                                                            32.3       7.7   
CCI40974                                                              32.0       8.8   
CCI50602                                                              32.0       9.3   
PITG_19764                                                            32.0       9.7   
SPRG_01072                                                            31.6       9.7   
PYU1_G011102                                                          32.0       9.7   
H310_11906                                                            32.0       9.8   

>CCA22845
Length=431

 Score = 848 bits (2192),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/431 (100%), Positives = 431/431 (100%), Gaps = 0/431 (0%)

Query  1    MAWITEIRASQSQHTCKVVNSNLSSESTHVWPTFIKDTRNQRNkvsktrreerkrvklkk  60
            MAWITEIRASQSQHTCKVVNSNLSSESTHVWPTFIKDTRNQRNKVSKTRREERKRVKLKK
Sbjct  1    MAWITEIRASQSQHTCKVVNSNLSSESTHVWPTFIKDTRNQRNKVSKTRREERKRVKLKK  60

Query  61   lskSFTDTWIEDILARPLSTDSKLVEALCFAGIPKELRGRVWGWLLGNKLQINEELFIIC  120
            LSKSFTDTWIEDILARPLSTDSKLVEALCFAGIPKELRGRVWGWLLGNKLQINEELFIIC
Sbjct  61   LSKSFTDTWIEDILARPLSTDSKLVEALCFAGIPKELRGRVWGWLLGNKLQINEELFIIC  120

Query  121  KDRAEAVRSEIALQKEVDAIMKLSAGLSALATQSTDFSEDEADDTKASSSTTRLSTPCLT  180
            KDRAEAVRSEIALQKEVDAIMKLSAGLSALATQSTDFSEDEADDTKASSSTTRLSTPCLT
Sbjct  121  KDRAEAVRSEIALQKEVDAIMKLSAGLSALATQSTDFSEDEADDTKASSSTTRLSTPCLT  180

Query  181  ASENEEIDMIRLPPPTETLQNLAGVAEKLVATCERSVWLVDVDIHRTFAYHPMFQEGGHG  240
            ASENEEIDMIRLPPPTETLQNLAGVAEKLVATCERSVWLVDVDIHRTFAYHPMFQEGGHG
Sbjct  181  ASENEEIDMIRLPPPTETLQNLAGVAEKLVATCERSVWLVDVDIHRTFAYHPMFQEGGHG  240

Query  241  AERTREVLHAYICYRPDLGYVQGLNCKDLTHPKFADSTLLFLTGMSYLAAAICLHMDTFP  300
            AERTREVLHAYICYRPDLGYVQGLNCKDLTHPKFADSTLLFLTGMSYLAAAICLHMDTFP
Sbjct  241  AERTREVLHAYICYRPDLGYVQGLNCKDLTHPKFADSTLLFLTGMSYLAAAICLHMDTFP  300

Query  301  AFKALSALMSTNLLFDMFRLQERRRASVRYITDRRLKYFCNEFHTKMAKALLKVYERNLL  360
            AFKALSALMSTNLLFDMFRLQERRRASVRYITDRRLKYFCNEFHTKMAKALLKVYERNLL
Sbjct  301  AFKALSALMSTNLLFDMFRLQERRRASVRYITDRRLKYFCNEFHTKMAKALLKVYERNLL  360

Query  361  ELDEAEMMRLLHKFPSDISADVLFTALGNVALSCEEINEILSSDGDEDTLTRRVWSPDSF  420
            ELDEAEMMRLLHKFPSDISADVLFTALGNVALSCEEINEILSSDGDEDTLTRRVWSPDSF
Sbjct  361  ELDEAEMMRLLHKFPSDISADVLFTALGNVALSCEEINEILSSDGDEDTLTRRVWSPDSF  420

Query  421  REAEITFPDTY  431
            REAEITFPDTY
Sbjct  421  REAEITFPDTY  431

>CCA22847
Length=364

 Score = 635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/344 (96%), Positives = 332/344 (97%), Gaps = 0/344 (0%)

Query  1    MAWITEIRASQSQHTCKVVNSNLSSESTHVWPTFIKDTRNQRNkvsktrreerkrvklkk  60
            MAWITEIRASQSQHTCKVVNSNLSSESTHVWPTFIKDTRNQRNKVSKTRREERKRVKLKK
Sbjct  1    MAWITEIRASQSQHTCKVVNSNLSSESTHVWPTFIKDTRNQRNKVSKTRREERKRVKLKK  60

Query  61   lskSFTDTWIEDILARPLSTDSKLVEALCFAGIPKELRGRVWGWLLGNKLQINEELFIIC  120
            LSKSFTDTWIEDILARPLSTDSKLVEALCFAGIPKELRGRVWGWLLGNKLQINEELFIIC
Sbjct  61   LSKSFTDTWIEDILARPLSTDSKLVEALCFAGIPKELRGRVWGWLLGNKLQINEELFIIC  120

Query  121  KDRAEAVRSEIALQKEVDAIMKLSAGLSALATQSTDFSEDEADDTKASSSTTRLSTPCLT  180
            KDRAEAVRSEIALQKEVDAIMKLSAGLSALATQSTDFSEDEADDTKASSSTTRLSTPCLT
Sbjct  121  KDRAEAVRSEIALQKEVDAIMKLSAGLSALATQSTDFSEDEADDTKASSSTTRLSTPCLT  180

Query  181  ASENEEIDMIRLPPPTETLQNLAGVAEKLVATCERSVWLVDVDIHRTFAYHPMFQEGGHG  240
            ASENEEIDMIRLPPPTETLQNLAGVAEKLVATCERSVWLVDVDIHRTFAYHPMFQEGGHG
Sbjct  181  ASENEEIDMIRLPPPTETLQNLAGVAEKLVATCERSVWLVDVDIHRTFAYHPMFQEGGHG  240

Query  241  AERTREVLHAYICYRPDLGYVQGLNCKDLTHPKFADSTLLFLTGMSYLAAAICLHMDTFP  300
            AERTREVLHAYICYRPDLGYVQGLNCKDLTHPKFADSTLLFLTGMSYLAAAICLHMDTFP
Sbjct  241  AERTREVLHAYICYRPDLGYVQGLNCKDLTHPKFADSTLLFLTGMSYLAAAICLHMDTFP  300

Query  301  AFKALSALMSTNLLFDMFRLQERRRASVRYITDRRLKYFCNEFH  344
            AFKALSALMSTNLLFDMFRLQERR      + DR LKY   + H
Sbjct  301  AFKALSALMSTNLLFDMFRLQERRTFHYINVFDRILKYEVPDIH  344

>CCI44114
Length=369

 Score = 429 bits (1102),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 221/265 (83%), Positives = 240/265 (91%), Gaps = 1/265 (0%)

Query  1    MAWITEIRASQSQHTCKVVNSNLSSESTHVWPTFIK-DTRNQRNkvsktrreerkrvklk  59
            +AW+TEIRASQS HTC V NSN+S ES H W T IK DTR QRNK+SKTR+EERKRVKL+
Sbjct  94   IAWLTEIRASQSHHTCIVNNSNISFESAHTWSTVIKGDTRKQRNKLSKTRKEERKRVKLR  153

Query  60   klskSFTDTWIEDILARPLSTDSKLVEALCFAGIPKELRGRVWGWLLGNKLQINEELFII  119
            ++SKSFTDTWIEDIL RP+ +D K V ALCFAGIPKELRGRVWGWLLGNKLQINEELF I
Sbjct  154  RMSKSFTDTWIEDILPRPMPSDIKSVVALCFAGIPKELRGRVWGWLLGNKLQINEELFRI  213

Query  120  CKDRAEAVRSEIALQKEVDAIMKLSAGLSALATQSTDFSEDEADDTKASSSTTRLSTPCL  179
            CKDRA+AVRSEIALQKEVDAIMKLSAG S LATQST+FSEDE+DD K S STTRLSTPCL
Sbjct  214  CKDRAKAVRSEIALQKEVDAIMKLSAGPSTLATQSTNFSEDESDDAKVSPSTTRLSTPCL  273

Query  180  TASENEEIDMIRLPPPTETLQNLAGVAEKLVATCERSVWLVDVDIHRTFAYHPMFQEGGH  239
            T SENE+ID+++L  P++TLQNLAGVAEKLVATCERSVWLVDVDIHRTFAYHPMFQEGGH
Sbjct  274  TTSENEDIDLVKLSAPSKTLQNLAGVAEKLVATCERSVWLVDVDIHRTFAYHPMFQEGGH  333

Query  240  GAERTREVLHAYICYRPDLGYVQGL  264
            GAERTREVLHAYICYRPDLGYVQG 
Sbjct  334  GAERTREVLHAYICYRPDLGYVQGF  358

>PITG_18461
Length=482

 Score = 282 bits (721),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 160/417 (38%), Positives = 224/417 (54%), Gaps = 105/417 (25%)

Query  64   SFTDTWIEDILARPLST---DSKLVEALCFAGIPKELRGRVWGWLLGNKLQINEELFIIC  120
            ++T+ W++++ + P  +   D  L++ALCFAGIPKELRGR W W+LGN LQ+NE+LF IC
Sbjct  121  TYTEVWLDEVFSHPSGSTRGDVPLLDALCFAGIPKELRGRAWAWILGNTLQVNEDLFQIC  180

Query  121  KDRAEAVRSEIALQKEVDAIMKLSAGLSALATQSTDFSEDEADDTKASSSTTRLSTPCLT  180
            K RA+AV  E++L+++VD         SA  ++S       +D  +AS S+  L      
Sbjct  181  KARAQAVLMEMSLKRDVDH--------SASPSRSVSNVSKISDRKRASQSSAVL------  226

Query  181  ASENEEIDMIRLPPPTETLQNLAGVAEKLVATCERSVWLVDVDIHRTFAYHPMFQEGGHG  240
                         P    LQ+  G+AE LVA  ERS+ LV+VD+ RTF +HP+FQ GG G
Sbjct  227  -------------PSQNMLQDAVGIAEMLVAHGERSIKLVNVDMPRTFGHHPLFQPGGEG  273

Query  241  AERTREVLHAYICYRPDLGYVQGLNCKDLTHPKFADSTLLFLTGMSYLAAAICLHMDTFP  300
             ERT +VL AYICYRPDLGYVQ                     GMSYLAA +C HMD+F 
Sbjct  274  TERTTKVLEAYICYRPDLGYVQ---------------------GMSYLAATLCFHMDSFT  312

Query  301  AFKALSALMSTNLLFDMFRLQERRRASVRYITDRRLKY----FCNEFHT-----------  345
            AFKAL+ALMS++LLFDMFRL+  R      + ++ L+Y        FH            
Sbjct  313  AFKALAALMSSSLLFDMFRLEATRTFHYIDVYNQILEYELPALAAHFHEIGIDAQMYAVD  372

Query  346  -------------------------------KMAKALLKVYERNLLELDEAEMMRLLHKF  374
                                           + +  LL +++ +LL ++   +MRLLH F
Sbjct  373  WALTLFTRSLPLDLALRIWDVYVLLGTPFFFQASMGLLSLFQDSLLAMEAENIMRLLHNF  432

Query  375  PSDISADVLFTALGNVALSCEEINEILSSDGDEDTLTRRVWSPDSFREAEITFPDTY  431
            P + S+  LF A+ +V+LSCEE+ E+L+          ++WSPD  RE  + +PDTY
Sbjct  433  PKNTSSRQLFKAISSVSLSCEEVTELLAGG--------KLWSPDEVREVPVKYPDTY  481

>PYU1_G001731
Length=529

 Score = 282 bits (721),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 169/419 (40%), Positives = 219/419 (52%), Gaps = 90/419 (21%)

Query  64   SFTDTWIEDILARPLSTDSKLVEALCFAGIPKELRGRVWGWLLGNKLQINEELFIICKDR  123
            SF++ W+ED+       ++ LVE LCFAGIPKE+RGR W W+LGNKLQ+NE+LF ICK R
Sbjct  149  SFSELWVEDVFTHSAKNEASLVEGLCFAGIPKEMRGRAWAWILGNKLQVNEDLFNICKAR  208

Query  124  AEAVRSEIALQKEVDAIMKLSAGLSALATQSTDFSEDEADDTKAS-SSTTRLSTPCLTAS  182
            A AVR E+ L+KE +      +GL+A  T S       A       S+ T  S P    +
Sbjct  209  ATAVRREMVLKKEAE-----KSGLNAERTDSATSLASSASLPATDDSNATDPSNPVAAVA  263

Query  183  ENEEIDMIRLPPPTETLQNL----AGVAEKLVATCERSVWLVDVDIHRTFAYHPMFQEGG  238
             +E+      P   E  QN+      +AE LVA  ERS+ LV++D+ RTF +HP+FQ G 
Sbjct  264  PDED-----RPDSKEVAQNMLQEAVSIAEMLVAHGERSIRLVNIDMPRTFGHHPLFQAGA  318

Query  239  HGAERTREVLHAYICYRPDLGYVQGLNCKDLTHPKFADSTLLFLTGMSYLAAAICLHMDT  298
             G ERT EVL AYICYRPDLGYVQG                     MSY+AAA+C HMD+
Sbjct  319  DGTERTTEVLEAYICYRPDLGYVQG---------------------MSYIAAALCFHMDS  357

Query  299  FPAFKALSALMSTNLLFDMFRLQERRR---------------------------ASVRYI  331
            F AFKAL +LMST+LLFDMFRL+E+R                             +  Y 
Sbjct  358  FTAFKALVSLMSTSLLFDMFRLEEKRTFHYLGVYNQIVEFELPRLHAHLQDTGIEAQMYA  417

Query  332  TDRRLKYFCNE-------------------FHTKMAKALLKVYERNLLELDEAEMMRLLH  372
             D  L  F                      F  + +  +L +YE  LL +D  E+MR LH
Sbjct  418  VDWALSLFTRSLPLNLALRIWDCFVLIGTPFFFQASVGILALYEDALLTMDAEEIMRFLH  477

Query  373  KFPSDISADVLFTALGNVALSCEEINEILSSDGDEDTLTRRVWSPDSFREAEITFPDTY  431
              P   SA  LF A+ +VALS  EI E+L+          ++WSPDS R  +I +P+TY
Sbjct  478  NIPKSTSATDLFDAIESVALSAREITELLAGG--------KLWSPDSSRHIQIQYPETY  528

>PYIR_13420
Length=515

 Score = 280 bits (717),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 170/431 (39%), Positives = 226/431 (52%), Gaps = 94/431 (22%)

Query  64   SFTDTWIEDILARPLSTDSKLVEALCFAGIPKELRGRVWGWLLGNKLQINEELFIICKDR  123
            SF++ W++DI+++    DS LVEALCFAGIPKE+RGR W W+LGNKLQ+NE+LF ICK R
Sbjct  115  SFSELWVDDIISQSGKQDSSLVEALCFAGIPKEVRGRAWAWILGNKLQVNEDLFKICKAR  174

Query  124  AEAVRSEIALQKEVDAIMKLSAG--------------LSALATQSTDFSEDEADDTKA-S  168
            A AVR E+ L++E +   +L A                 A    S+  + D  + T A +
Sbjct  175  ALAVRREMVLKREAENRTRLQAAERTNSTSSLVSSSSSPATTVNSSSSASDPQNHTIAET  234

Query  169  SSTTRLSTPCLTASENEEIDMIRLPPPTET--LQNLAGVAEKLVATCERSVWLVDVDIHR  226
            S+ T L    +   EN+ +             LQ    +AE LVA  ERS+ LV+VD+ R
Sbjct  235  SNGTELK--LIGDDENQSVSQSAADDEAHAAMLQEAVSIAEMLVAHGERSIRLVNVDMPR  292

Query  227  TFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLNCKDLTHPKFADSTLLFLTGMS  286
            TF +HP+FQ G  G ERT EVL AYICYRPDLGYVQ                     GMS
Sbjct  293  TFGHHPLFQPGADGTERTTEVLEAYICYRPDLGYVQ---------------------GMS  331

Query  287  YLAAAICLHMDTFPAFKALSALMSTNLLFDMFRLQERR--------RASVRYITDRRLKY  338
            YLAAA+C HMD+F AFKAL +LMST+LLFDMFRL+E+R           V Y   R   +
Sbjct  332  YLAAALCFHMDSFTAFKALVSLMSTSLLFDMFRLEEKRTFHYLGVYNQIVEYELPRLHAH  391

Query  339  FCNE--------------------------------------FHTKMAKALLKVYERNLL  360
            F N                                       F  + +  +L +YE  LL
Sbjct  392  FENSGIEAQMYAVDWALTLFTRSLPLNLALRIWDCFVFLGTPFFFQASVGILTLYEDALL  451

Query  361  ELDEAEMMRLLHKFPSDISADVLFTALGNVALSCEEINEILSSDGDEDTLTRRVWSPDSF  420
             ++  ++MR LH  P   SA  LF A+ +V LS  EI+E+L+          ++WSPDS 
Sbjct  452  GMEAEDIMRFLHNIPKSTSAPDLFDAIESVTLSSREISELLAGG--------KLWSPDSS  503

Query  421  REAEITFPDTY  431
            R+ +I +P+TY
Sbjct  504  RQIKIQYPETY  514

>PYAP_17767
Length=502

 Score = 278 bits (712),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 164/417 (39%), Positives = 223/417 (53%), Gaps = 95/417 (23%)

Query  64   SFTDTWIEDILARPLSTDSKLVEALCFAGIPKELRGRVWGWLLGNKLQINEELFIICKDR  123
            SF++ W+ED+L      D  ++EALCFAGIPKELRGRVW W+LGNKLQINEELF ICK R
Sbjct  131  SFSEVWVEDVLMHASRDDVPMLEALCFAGIPKELRGRVWSWVLGNKLQINEELFTICKAR  190

Query  124  AEAVRSEIALQKEVDAIMKLSAGLSA-LATQSTDFSEDEADDTKASSSTTRLSTPCLTAS  182
            A AV+ E++L++E D      AG+ A +AT+ST  S  E+  +    S T          
Sbjct  191  ATAVQQEMSLKREADV-----AGIKASIATEST-LSSGESSPSGLDRSPTE---------  235

Query  183  ENEEI--DMIRLPPPTETLQNLAGVAEKLVATCERSVWLVDVDIHRTFAYHPMFQEGGHG  240
            E E++  +M+++      L +   VAEKLV+  ERS+ LV VD+ RTF +HP+FQ G  G
Sbjct  236  EGEKVSKEMVKV----HILLDAVDVAEKLVSRGERSIRLVSVDMPRTFGHHPLFQTGADG  291

Query  241  AERTREVLHAYICYRPDLGYVQGLNCKDLTHPKFADSTLLFLTGMSYLAAAICLHMDTFP  300
              RT EVL AY CYRPD+GYVQ                     GMSYLAAA+C HMD+F 
Sbjct  292  TTRTIEVLEAYSCYRPDVGYVQ---------------------GMSYLAAALCFHMDSFT  330

Query  301  AFKALSALMSTNLLFDMFRLQERRRASVRYITDRRLKYFCNEFHTKMAKA----------  350
            AFK +  LMS ++LFDMFR++ +R     ++ D+ L+Y     H     A          
Sbjct  331  AFKGMVGLMSNSVLFDMFRMEAKRTFHYIHVYDKILEYELPHVHAHFQSAGIDAQMYAVD  390

Query  351  ------------------------------------LLKVYERNLLELDEAEMMRLLHKF  374
                                                +L ++E  LL +   E+MR LH  
Sbjct  391  WALTLFTRCLPLNLAFRLWDCFVLLGTPFFFQASMGILALFEERLLVMQPEEIMRFLHHI  450

Query  375  PSDISADVLFTALGNVALSCEEINEILSSDGDEDTLTRRVWSPDSFREAEITFPDTY  431
            P   +A  LF A+ +++LSC +I+ ILSS  D      R W+PD+ R  E+ FP++Y
Sbjct  451  PKTTTAVELFAAIDSLSLSCRDIDAILSSGVD------RPWTPDTPRAVEVKFPESY  501

>PHYSO_474929
Length=486

 Score = 277 bits (709),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 158/417 (38%), Positives = 223/417 (53%), Gaps = 105/417 (25%)

Query  64   SFTDTWIEDILARPLST---DSKLVEALCFAGIPKELRGRVWGWLLGNKLQINEELFIIC  120
            +FT+TW++++  +P  +   D  L++ALCFAGIPKELRGR W W+LGN LQ+NE+LF IC
Sbjct  125  TFTETWLDEVFVQPSGSTREDVPLLDALCFAGIPKELRGRAWAWILGNTLQVNEDLFNIC  184

Query  121  KDRAEAVRSEIALQKEVDAIMKLSAGLSALATQSTDFSEDEADDTKASSSTTRLSTPCLT  180
            K RA+AV  E++L+++VD  +     +S+++  S        D  +A  S+  L      
Sbjct  185  KARAQAVLMEMSLKRDVDHSVSPGRSVSSVSKIS--------DRKRARRSSAVL------  230

Query  181  ASENEEIDMIRLPPPTETLQNLAGVAEKLVATCERSVWLVDVDIHRTFAYHPMFQEGGHG  240
                         P    LQ+  G+AE LVA  ERS+ LV+VD+ RTF +HP+FQ G  G
Sbjct  231  -------------PVQNMLQDAVGIAEMLVAHGERSIKLVNVDMPRTFGHHPLFQPGAEG  277

Query  241  AERTREVLHAYICYRPDLGYVQGLNCKDLTHPKFADSTLLFLTGMSYLAAAICLHMDTFP  300
             ERT EVL AYICYRPDLGYVQG                     MSYLAA +C HMD+F 
Sbjct  278  TERTTEVLEAYICYRPDLGYVQG---------------------MSYLAATLCFHMDSFT  316

Query  301  AFKALSALMSTNLLFDMFRLQERRRASVRYITDRRLKY----------------------  338
            AFKAL ALMS++LLFDMFRL+  R      + ++ L+Y                      
Sbjct  317  AFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILEYELPALAAHFQEIGIDAQMYAVD  376

Query  339  ------------------------FCNEFHTKMAKALLKVYERNLLELDEAEMMRLLHKF  374
                                        F  + +  LL +++ +LL ++  ++MRLLH F
Sbjct  377  WALTLFTRSLPLDLALRIWDVYVLLGTPFFFQASMGLLSLFQDSLLAMEAEDIMRLLHNF  436

Query  375  PSDISADVLFTALGNVALSCEEINEILSSDGDEDTLTRRVWSPDSFREAEITFPDTY  431
            P + S+  LF A+ +V+LSC+EI E+L+          ++WSPD  R+  + FP+TY
Sbjct  437  PKNTSSRQLFEAISSVSLSCQEITELLAGG--------KLWSPDEARQVPVKFPETY  485

>PYAR_13572
Length=512

 Score = 271 bits (694),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 173/423 (41%), Positives = 229/423 (54%), Gaps = 89/423 (21%)

Query  64   SFTDTWIEDILARPLSTDSKLVEALCFAGIPKELRGRVWGWLLGNKLQINEELFIICKDR  123
            SF++ W+ED+L R    D+ L+EALCFAGIPKELRGRVW W+LGNKL INEELF ICK R
Sbjct  123  SFSEAWVEDVLTRNDRDDAPLLEALCFAGIPKELRGRVWAWVLGNKLLINEELFNICKTR  182

Query  124  AEAVRSEIALQKEVDAIMKLSAGL--SALATQSTDFSEDEAD---DTKASSSTTRLSTPC  178
            A+AV+ E+ L+KE D     S+GL  + L + +TD S + A     T   S   R+S+  
Sbjct  183  AQAVQQEMELKKEAD-----SSGLMQTILESGTTDTSGESAGLKRTTTLESRVARMSSES  237

Query  179  LTA--------SENEEIDMIRLP-PPTETLQNLAGVAEKLVATCERSVWLVDVDIHRTFA  229
             T          E ++ID  +     T  L +   VAEKLV+  ERS+ LV VD+ RTF 
Sbjct  238  STTILGDYNDQEEYQDIDEAKSELAKTMILLDAVDVAEKLVSQGERSIRLVSVDMPRTFG  297

Query  230  YHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLNCKDLTHPKFADSTLLFLTGMSYLA  289
            +H +FQ G  G  RT EVL AY CYRPDLGYVQ                     GMSYLA
Sbjct  298  HHTLFQTGADGTTRTVEVLEAYSCYRPDLGYVQ---------------------GMSYLA  336

Query  290  AAICLHMDTFPAFKALSALMSTNLLFDMFRLQERRRASVRYIT--DRRLKYFCNEFHTKM  347
            AA+C HMD+F AFKA+ ALMS ++LFDMFR++ +R  +  YI    R L++   + H   
Sbjct  337  AALCFHMDSFTAFKAMVALMSNSVLFDMFRMEAKR--TFHYINAYGRILEFELPQLHAHF  394

Query  348  AKA-----------LLKVYERN----------------------------LLELDEAEMM  368
              +            L ++ R+                            LL ++  E+M
Sbjct  395  QNSGIDAQMYAVDWALTLFTRSLPLNLAFRLWDCFVLVGTPFFFQASMDRLLAMEPEEIM  454

Query  369  RLLHKFPSDISADVLFTALGNVALSCEEINEILSSDGDEDTLTRRVWSPDSFREAEITFP  428
            R LH  P   ++  LF A+ +V+LSC EI  IL+  G+E     R WSP+S R  E+ FP
Sbjct  455  RFLHHLPKTTTSVELFAAIDSVSLSCREITVILAG-GEE-----RPWSPESPRMVEVKFP  508

Query  429  DTY  431
            +TY
Sbjct  509  ETY  511

>PHYCA_576136
Length=569

 Score = 272 bits (695),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 159/435 (37%), Positives = 233/435 (54%), Gaps = 97/435 (22%)

Query  64   SFTDTWIEDILARPLST---DSKLVEALCFAGIPKELRGRVWGWLLGNKLQINEELFIIC  120
            ++T+ W+E++  +P  +   +  L++ALCFAGIPKELRGR W W+LGN LQ+N++LF IC
Sbjct  164  TYTEIWLEEVFTQPSGSTRDEVPLLDALCFAGIPKELRGRAWAWILGNTLQVNQDLFNIC  223

Query  121  KDRAEAVRSEIALQKEVDAIMKLSAGLSALATQS------------------TDFSEDEA  162
            KDRA+AV  E++L+++V+  +  +  +S+ +T +                  +  +  E 
Sbjct  224  KDRAQAVLMEMSLKRDVEHSVVETTTVSSESTSAMLESPTRSVSSVSSASSASAMTNVED  283

Query  163  DDTKASSSTTRLSTPCLTASENEEIDMIRLPPPTETLQNLAGVAEKLVATCERSVWLVDV  222
            ++  ++ + T LSTP ++  +        LP     LQ+  G+AE LVA  ERS+ LV+V
Sbjct  284  NEASSAEAVTGLSTPEISDRKRARRSSAVLPV-QNMLQDAVGIAEMLVAHGERSIKLVNV  342

Query  223  DIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLNCKDLTHPKFADSTLLFL  282
            D+ RTF +HP+FQ G  G ERT EVL AYICYRPDLGYVQG                   
Sbjct  343  DMPRTFGHHPLFQPGAEGTERTTEVLEAYICYRPDLGYVQG-------------------  383

Query  283  TGMSYLAAAICLHMDTFPAFKALSALMSTNLLFDMFRLQERRRASVRYITDRRLKY----  338
              MSYLAA +C HMD+F AFKAL ALMS++LLFDMFRL+  R      + ++ L+Y    
Sbjct  384  --MSYLAATLCFHMDSFTAFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILEYELPS  441

Query  339  ------------------------------------------FCNEFHTKMAKALLKVYE  356
                                                          F  + +  LL +++
Sbjct  442  VSAHFQEIGIDAQMYAVDWALTLFTRSLPLDLALRIWDVYVLLGTPFFFQASMGLLSLFQ  501

Query  357  RNLLELDEAEMMRLLHKFPSDISADVLFTALGNVALSCEEINEILSSDGDEDTLTRRVWS  416
             +LL ++   +MRLLH FP   S+  LF A+ +V+LSCEEI E+L+          ++WS
Sbjct  502  DSLLAMEAEGIMRLLHNFPKSTSSRELFGAIESVSLSCEEITELLAGG--------KLWS  553

Query  417  PDSFREAEITFPDTY  431
            PD  ++  + FPDTY
Sbjct  554  PDEAQQVPVKFPDTY  568

>PPTG_17131
Length=577

 Score = 272 bits (695),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 165/438 (38%), Positives = 233/438 (53%), Gaps = 99/438 (23%)

Query  64   SFTDTWIEDILARPLST---DSKLVEALCFAGIPKELRGRVWGWLLGNKLQINEELFIIC  120
            ++T+ W++++   P  +   D  L++ALCFAGIPKELRGR W W+LGN LQ+NE+LF IC
Sbjct  168  TYTEVWLDEVFTHPSGSTRDDVPLLDALCFAGIPKELRGRAWAWILGNTLQVNEDLFKIC  227

Query  121  KDRAEAVRSEIALQKEVD---------------AIMKLSAGLSALATQSTDFSEDEADDT  165
            K RA+AV  E++L+++VD               A+++  +   +  + ++  SE   +D+
Sbjct  228  KARAQAVLMEMSLKRDVDHSVVETPSVSSESASAMLEPPSRSVSNVSSASSASESIVEDS  287

Query  166  KASSST--TRLSTPCLTASENEEIDMIR----LPPPTETLQNLAGVAEKLVATCERSVWL  219
            +A + T   R S+  +   E  +    R    + P    LQ+  G+AE LVA  ERS+ L
Sbjct  288  EAPTLTEYGRDSSTTMLIPEISDRKRARRSSAVLPVQNMLQDAVGIAEMLVAHGERSIKL  347

Query  220  VDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLNCKDLTHPKFADSTL  279
            V+VD+ RTF +HP+FQ G  G ERT EVL AYICYRPDLGYVQ                 
Sbjct  348  VNVDMPRTFGHHPLFQPGAEGTERTTEVLEAYICYRPDLGYVQ-----------------  390

Query  280  LFLTGMSYLAAAICLHMDTFPAFKALSALMSTNLLFDMFRLQERRR--------------  325
                GMSYLAA +C HMD+F AFKAL ALMS++LLFDMFRL+  R               
Sbjct  391  ----GMSYLAATLCFHMDSFTAFKALVALMSSSLLFDMFRLEATRTFHYIDVYNQIFEYE  446

Query  326  -------------ASVRYITDRRLKYFCNE-------------------FHTKMAKALLK  353
                          +  Y  D  L  F                      F  + +  LL 
Sbjct  447  LPALSAHFHEIGIDAQMYAVDWALTLFTRSLPLDLALRIWDVYVLLGTPFFFQASMGLLS  506

Query  354  VYERNLLELDEAEMMRLLHKFPSDISADVLFTALGNVALSCEEINEILSSDGDEDTLTRR  413
            +++ +LL ++  E+MRLLH FP + S+  LF A+ +V+LSCEEI E+L+          +
Sbjct  507  LFQDSLLAMEAEEIMRLLHNFPKNTSSRQLFKAISSVSLSCEEITELLAGG--------K  558

Query  414  VWSPDSFREAEITFPDTY  431
            +WSPD  RE  + +PDTY
Sbjct  559  LWSPDEAREVPVKYPDTY  576

>PHYRA_81092
Length=566

 Score = 268 bits (685),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 164/441 (37%), Positives = 229/441 (52%), Gaps = 102/441 (23%)

Query  64   SFTDTWIEDILARPLST---DSKLVEALCFAGIPKELRGRVWGWLLGNKLQINEELFIIC  120
            +FT+TW++++  +P      D  L++ALCFAGIPKELRGR W W LGN LQ+N++LF IC
Sbjct  154  TFTETWLDEVFTQPSGGTREDVPLLDALCFAGIPKELRGRAWAWTLGNTLQVNQDLFNIC  213

Query  121  KDRAEAVRSEIALQKEVD-------------------AIMKLSAGLSALATQSTDFSEDE  161
            K RA+AV  E++L+++VD                       +S+  SA +   T+  E+E
Sbjct  214  KARAQAVLMEMSLKRDVDHSVAETPTSSSSASPILESPTRSVSSVSSASSASDTNVEEEE  273

Query  162  ADDTKASSSTTRLST-----PCLTASENEEI-DMIR------LPPPTETLQNLAGVAEKL  209
            +  T   S+ T+ +      P    S   EI D  R      + P    LQ+  G+AE L
Sbjct  274  SPVTTDESTNTQPTADSDVLPTTEVSMATEITDRKRARRSSAILPAQNMLQDAVGIAEML  333

Query  210  VATCERSVWLVDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLNCKDL  269
            VA  ERS+ LV+VD+ RTF +HP+FQ G  G  RT EVL AYICYRPDLGYVQG      
Sbjct  334  VAHGERSIKLVNVDMPRTFGHHPLFQPGAEGTARTTEVLEAYICYRPDLGYVQG------  387

Query  270  THPKFADSTLLFLTGMSYLAAAICLHMDTFPAFKALSALMSTNLLFDMFRLQERRRASVR  329
                           MSYLAA +C HMD+F AFKAL A+MS++LLFDMFRL+  R     
Sbjct  388  ---------------MSYLAATLCFHMDSFTAFKALVAMMSSSLLFDMFRLEATRTFHYI  432

Query  330  YITDRRLKY---------------------------------------FCNEFHTKMAKA  350
             + ++ L+Y                                           F  + +  
Sbjct  433  EVYNQILEYELPALAAHFQELGIDAQMYAVDWSLPLDLALRLWDVYVLLGTPFFFQASMG  492

Query  351  LLKVYERNLLELDEAEMMRLLHKFPSDISADVLFTALGNVALSCEEINEILSSDGDEDTL  410
            LL +++ +LL ++  ++MRLLH FP   S+  LF A+ +V+LSC EI E+L         
Sbjct  493  LLSLFQDSLLAMEPEDIMRLLHNFPKSTSSQQLFDAISSVSLSCNEITEMLVGGP-----  547

Query  411  TRRVWSPDSFREAEITFPDTY  431
               +WSPD+ R+  + +PDTY
Sbjct  548  ---LWSPDAARQVPVKYPDTY  565

>PYIW_14659
Length=564

 Score = 260 bits (664),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 163/426 (38%), Positives = 223/426 (52%), Gaps = 87/426 (20%)

Query  64   SFTDTWIEDILARPLSTDS-KLVEALCFAGIPKELRGRVWGWLLGNKLQINEELFIICKD  122
            SF + WI+DI+ +    D+  +VEALCF GIPKE+RGR W W+LGNKLQ+NE+LF ICK 
Sbjct  167  SFGELWIDDIILQSGRHDAPNIVEALCFVGIPKEVRGRAWAWILGNKLQVNEDLFKICKA  226

Query  123  RAEAVRSEIALQKEVDAIMKLSAG---LSALATQSTDFSEDEADDTKASSSTTRLSTPCL  179
            RA AVR E+ L++E +   +L A     SA +  S+  +   +  T  SS+T+ +  P +
Sbjct  227  RALAVRREMTLKREAETRSRLQAAERTTSATSLASSSSANSSSPATANSSNTSEVQFPPI  286

Query  180  TASENEEIDMIRLPPPTET--------LQNLAGVAEKLVATCERSVWLVDVDIHRTFAYH  231
               +   +D       +++        L     +AE LVA  ERS+ LV+VD+ RTF +H
Sbjct  287  AEDKLRHLDGADDSEKSQSGDETQSMMLLEAVSIAEMLVAHGERSIRLVNVDMPRTFGHH  346

Query  232  PMFQEGGHGAERTREVLHAYICYRPDLGYVQGLNCKDLTHPKFADSTLLFLTGMSYLAAA  291
            P+FQ G  G ERT EVL AYICYRPDLGYVQ                     GMSYLAA 
Sbjct  347  PLFQPGADGTERTTEVLEAYICYRPDLGYVQ---------------------GMSYLAAT  385

Query  292  ICLHMDTFPAFKALSALMSTNLLFDMFRLQERRRASVRYITDRRLKYFCNEFHT------  345
            +C HMD+F AFKA+ +LMST+LLFDMFRL+E R      I ++ ++Y     H       
Sbjct  386  LCFHMDSFTAFKAMVSLMSTSLLFDMFRLEETRTFHYLGIYNQIIEYELPRLHAHFQDSG  445

Query  346  ----------------------------------------KMAKALLKVYERNLLELDEA  365
                                                    + +  +L +YE  LL ++  
Sbjct  446  IEAQMYAVDWALTLFTRSLPLNLALRIWDCFVFLGTPFFFQASVGILTLYEDALLAMEAE  505

Query  366  EMMRLLHKFPSDISADVLFTALGNVALSCEEINEILSSDGDEDTLTRRVWSPDSFREAEI  425
            ++MR LH  P   SA  LF A+ +V LS  EI E+L   G E      +WSPD+ R+ +I
Sbjct  506  DIMRFLHNIPKSTSAPDLFDAIESVTLSSHEITELLG--GGE------LWSPDASRQIQI  557

Query  426  TFPDTY  431
             FP+TY
Sbjct  558  QFPETY  563

>PYVX_19188
Length=625

 Score = 246 bits (627),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 165/460 (36%), Positives = 227/460 (49%), Gaps = 122/460 (27%)

Query  65   FTDTWIEDILARPLST------DSKLVEALCFAGIPKELRGRVWGWLLGNKLQINEELFI  118
            FTD W+E+IL            +S  +EALCFAGIPKE+RGR W W+LGNKLQ+NE LF 
Sbjct  194  FTDVWLEEILTATREAVAGDEDESARLEALCFAGIPKEVRGRAWAWILGNKLQVNENLFK  253

Query  119  ICKDRAEAVRSEIALQKEVDAIMKLSAGLSALATQSTDFSEDEADDTKASSST-------  171
            ICK RA AV+ E++L+++ D  M+ +    A  T  T     E +D   +SS        
Sbjct  254  ICKARARAVQLEMSLKRQADLSMQSAVKPMAAFTTPTKAERSEREDAVVASSHSSSPSPV  313

Query  172  -----TR--LSTPCLTASENEEIDMIRLPPPT----------------------------  196
                 TR   ++    AS++ + DM  LP  +                            
Sbjct  314  SSSSSTRNDWTSAKRMASDDTDADMPMLPLKSRDEESMNDGDFEGKTNGQIAENAPAIRP  373

Query  197  ETLQNLAGVAEKLVATCERSVWLVDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRP  256
            + L++  G+AE LVA  ERS+ LV+VD+ RTF +HP+F+ G  G ERT EVL AY CYRP
Sbjct  374  DMLKDAVGIAEMLVAHGERSIHLVNVDMPRTFGHHPLFKAGAEGTERTTEVLEAYACYRP  433

Query  257  DLGYVQGLNCKDLTHPKFADSTLLFLTGMSYLAAAICLHMDTFPAFKALSALMSTNLLFD  316
            DLGYVQG                     MSYLAA +C HMD+F AFKAL AL+S++LLFD
Sbjct  434  DLGYVQG---------------------MSYLAATLCFHMDSFAAFKALVALLSSSLLFD  472

Query  317  MFRLQER-----------------------RRASV---RYITDRRLKYFCNE--------  342
            MFRL+ R                         A +    Y  D  L  F           
Sbjct  473  MFRLESRTFHYFAIYNQIFEYELPELYRHFEAAGIDPEMYAVDWALTLFTRSLPLHLALR  532

Query  343  -----------FHTKMAKALLKVYERNLLELDEAEMMRLLHKFPSDISADVLFTALGNVA  391
                       F  + +  +L ++E  LL ++  +M+R LH  P  +++  +F A+  V+
Sbjct  533  LWDCYVLLGTPFFFQASMGILALFEDTLLRMEAEQMVRFLHNLPKSVTSREIFDAIATVS  592

Query  392  LSCEEINEILSSDGDEDTLTRRVWSPDSFREAEITFPDTY  431
            LSC EI ++L   GD       +WSPDS R  ++T+PD+Y
Sbjct  593  LSCREITQLLEG-GD-------LWSPDSTRSVQVTYPDSY  624

>H257_16579
Length=570

 Score = 232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 150/425 (35%), Positives = 207/425 (49%), Gaps = 90/425 (21%)

Query  65   FTDTWIEDILAR---PLSTDSKLVEALCFAGIPKELRGRVWGWLLGNKLQINEELFIICK  121
            F   W+ED+L       +    +VEALCFAGIPKELRGR W  +LGN+LQINE+LF IC+
Sbjct  176  FGSIWLEDVLPHWGDAAALPPHMVEALCFAGIPKELRGRAWSAMLGNRLQINEQLFDICR  235

Query  122  DRAEAVRSEIALQKEVDAIMKLSAGLSALATQSTDFSEDEADDTKASSSTTRLS------  175
             RA+AV  E+ L ++ D   +L + L     Q       +  +    +S  +L+      
Sbjct  236  SRAKAVLLEMHLVQDKDEKCRLES-LEQHKEQVNGQRNHQVAEQLHHNSRPQLTLPVHRP  294

Query  176  ---TPCLTASENEEIDMIRLPPPTETLQNLAGVAEKLVATCERSVWLVDVDIHRTFAYHP  232
               TP  + S NE+  ++  PP     +++  VAE+L+A  ER++ LV  D+ RTF  HP
Sbjct  295  TDDTPLPSLSANEKAPVVAEPP----TKDMPSVAEQLIADNERNIKLVQRDMPRTFGNHP  350

Query  233  MFQEGGHGAERTREVLHAYICYRPDLGYVQGLNCKDLTHPKFADSTLLFLTGMSYLAAAI  292
            +FQ+G  G ++T +VL AY CYRPDLGYVQ                     GMSYLAA +
Sbjct  351  LFQDGAAGTQKTYDVLEAYTCYRPDLGYVQ---------------------GMSYLAAIL  389

Query  293  CLHMDTFPAFKALSALMSTNLLFDMFRLQERRRASVRYITDRRLK---------------  337
            CLH+D+F AF+A+ +LMST L+FDM+RL+E R      + D  LK               
Sbjct  390  CLHLDSFGAFRAMVSLMSTRLMFDMYRLEEDRTFLYLTVYDTVLKHELPTLYSHFQEIGM  449

Query  338  -------------------------------YFCNEFHTKMAKALLKVYERNLLELDEAE  366
                                           Y    F  +   A+L +YE  LL LD  +
Sbjct  450  DPKMYVVDWAFTLFTRCVPLEVVLRIWDCYIYLGTPFFFQACMAILVMYEDTLLTLDLGD  509

Query  367  MMRLLHKFPSDISADVLFTALGNVALSCEEINEILSSDGDEDTLTRRVWSPDSFREAEIT  426
             M+ LH  P   S    F A+  V LS   IN +L+  GD      R WSP   R  E+ 
Sbjct  510  AMKFLHNVPKSCSPHDFFEAMDTVNLSRPAINALLAG-GDV-----RPWSPVGKRSIEVE  563

Query  427  FPDTY  431
            +P+ Y
Sbjct  564  YPEAY  568

>SDRG_12684
Length=521

 Score = 225 bits (573),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 153/420 (36%), Positives = 193/420 (46%), Gaps = 116/420 (28%)

Query  64   SFTDTWIEDILARPLSTDSK------LVEALCFAGIPKELRGRVWGWLLGNKLQINEELF  117
            SFT+ W+ D+L  P   D+K       V  LCFAGIPKE+RGR W  LLGNKLQINE+LF
Sbjct  164  SFTEAWLHDVL--PHWGDAKHQKPMDFVRGLCFAGIPKEVRGRAWAALLGNKLQINEQLF  221

Query  118  IICKDRAEAVRSEIALQKEVDAIMKLSAGLSALATQSTDFSEDEADDTKASSSTTRLSTP  177
             ICK RA+AV  ++A  K                          A DT+ +  +  + T 
Sbjct  222  EICKTRAKAVLLDVAAAK--------------------------AKDTRPNRPSLTIDTS  255

Query  178  CLTASENEEIDMIRLPPPTETLQNLAGVAEKLVATCERSVWLVDVDIHRTFAYHPMFQEG  237
             L          + +  P      L    E L+A  ER++ LV +D+ RTF  HP FQ G
Sbjct  256  GLDGG------FVVVTSPQHAKSTLT---EALIADNERNIKLVKLDMPRTFGSHPQFQAG  306

Query  238  GHGAERTREVLHAYICYRPDLGYVQGLNCKDLTHPKFADSTLLFLTGMSYLAAAICLHMD  297
              GA++T EVL AY CYRPDLGYVQ                     GMSYLAA +CLHMD
Sbjct  307  AVGAQKTYEVLEAYTCYRPDLGYVQ---------------------GMSYLAAILCLHMD  345

Query  298  TFPAFKALSALMSTNLLFDMFRLQERRRASVRYITDRRLK--------YF----------  339
            +F AFKA+ +L+ST LLFDM+RL+E R      + D  L+        YF          
Sbjct  346  SFSAFKAMVSLLSTRLLFDMYRLEEDRTLHYLRVYDTILQHELPALHAYFEEIGMDAKMY  405

Query  340  ----------------------------CNEFHTKMAKALLKVYERNLLELDEAEMMRLL  371
                                           F  +   A+L +YE +LL LD  + MR L
Sbjct  406  VVDWAFTLFTRCVPLDVVLRIWDVYILVGTPFFFQACMAILILYEEHLLTLDLGDAMRFL  465

Query  372  HKFPSDISADVLFTALGNVALSCEEINEILSSDGDEDTLTRRVWSPDSFREAEITFPDTY  431
            H  P   S    F AL  V LSC  I+ +L+  GD      R WSP   R   + FPD Y
Sbjct  466  HDIPKSTSPSSFFDALDAVNLSCSAIDGLLAG-GDV-----RPWSPVGRRPVSVEFPDAY  519

>SPRG_18415
Length=336

 Score = 218 bits (555),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 144/394 (37%), Positives = 181/394 (46%), Gaps = 108/394 (27%)

Query  84   LVEALCFAGIPKELRGRVWGWLLGNKLQINEELFIICKDRAEAVRSEIALQKEVDAIMKL  143
             V+ LCFAGIPKE+RGR W  LLGNKLQINE+LF ICK RA+AV  E+A  K        
Sbjct  3    FVQGLCFAGIPKEVRGRAWAALLGNKLQINEQLFEICKTRAKAVLVEVAATK--------  54

Query  144  SAGLSALATQSTDFSEDEADDTKASSSTTRLSTPCLTASENEEIDMIRLPPPTETLQNLA  203
                              A DT  +  +  + T  L          + +  P      L 
Sbjct  55   ------------------AKDTHPNRPSLTIDTSGLDGG------FVVVTSPQHATSTLT  90

Query  204  GVAEKLVATCERSVWLVDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQG  263
               E L+A  ER++ LV +D+ RTF  HP FQ G  GA++T EVL AY CYRPDLGYVQ 
Sbjct  91   ---EALIADNERNIKLVKLDMPRTFGSHPQFQAGAVGAQKTYEVLEAYTCYRPDLGYVQ-  146

Query  264  LNCKDLTHPKFADSTLLFLTGMSYLAAAICLHMDTFPAFKALSALMSTNLLFDMFRLQER  323
                                GMSYLAA +CLHMD+F AFKA+ +L+ST LLFDM+RL+E 
Sbjct  147  --------------------GMSYLAAILCLHMDSFSAFKAMVSLLSTRLLFDMYRLEED  186

Query  324  RRASVRYITDRRLK--------YF---------------------C--------------  340
            R      + D  L+        YF                     C              
Sbjct  187  RTLHYLRVYDTILQHELPTLHAYFEEIGMDAKMYVVDWAFTLFTRCVPLDVVLRIWDVYI  246

Query  341  ---NEFHTKMAKALLKVYERNLLELDEAEMMRLLHKFPSDISADVLFTALGNVALSCEEI  397
                 F  +   A+L +YE +LL LD  ++MR LH  P  +S    F AL  V LSC  I
Sbjct  247  LLGTPFFFQACMAILILYEEHLLALDLGDVMRFLHDIPKSMSPSDFFDALDAVNLSCSAI  306

Query  398  NEILSSDGDEDTLTRRVWSPDSFREAEITFPDTY  431
            + +L+          R WSP   R   + FPD Y
Sbjct  307  DSLLAGG------NVRPWSPVGRRPVSVEFPDAY  334

>PHALS_03627
Length=601

 Score = 225 bits (574),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 147/427 (34%), Positives = 209/427 (49%), Gaps = 111/427 (26%)

Query  64   SFTDTWIEDILARPLST---DSKLVEALCFAGIPKELRGRVWGWLLGNKLQINEELFIIC  120
            +FT+ W+ ++   P  +   +  L++ALCFAGIPKELRGR W W LGN LQ+NE+LF IC
Sbjct  161  TFTEVWLNEVFTWPSGSTRDEVPLLDALCFAGIPKELRGRAWAWALGNTLQVNEDLFQIC  220

Query  121  KDRAEAVRSEIALQKEVDAIMKLSAGLSALATQS---------------TDFSEDEADDT  165
            K RA+AV+ E++L++++D  +  S  +S+ +  +               +  SE +++D 
Sbjct  221  KVRAQAVQMEMSLKRDLDHTVVRSLTISSESESAMLESPTRSMSSVSSASSASELDSEDK  280

Query  166  KASSSTTRL--------------STPCLTASENEEID-------MIRLPPPTETLQNLAG  204
            +   S   +              S P +  S   +I           + P    LQ+  G
Sbjct  281  EVPRSDRHVNDILEGTNNLSIAKSKPTIAVSSTPDISDKSKKRRSSAVLPVQNMLQDAVG  340

Query  205  VAEKLVATCERSVWLVDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGL  264
            +AE LVA  ERS+ LV+VD+ RTF +HP+FQ G  G +RT EVL AYICYRPDLGYVQ  
Sbjct  341  IAEMLVAHGERSIKLVNVDMPRTFGHHPLFQPGAEGTKRTTEVLEAYICYRPDLGYVQ--  398

Query  265  NCKDLTHPKFADSTLLFLTGMSYLAAAICLHMDTFPAFKALSALMSTNLLFDMFRLQERR  324
                               GMSYLAA +C HMD+F AFKAL ALMS++LLFDMFRL+  R
Sbjct  399  -------------------GMSYLAATLCFHMDSFTAFKALVALMSSSLLFDMFRLEATR  439

Query  325  R---------------------------ASVRYITDRRLKYFCNE---------------  342
                                         +  Y  D  L  F                  
Sbjct  440  TFHYIDVYNKIFEYELPVLAAHFEEIGIDAQMYAVDWALTLFTRSLPLDLALRIWDVYVL  499

Query  343  ----FHTKMAKALLKVYERNLLELDEAEMMRLLHKFPSDISADVLFTALGN-----VALS  393
                F  + +  LL  ++ +LL ++   +MRLLH FP + S+  LF ++ +     VAL+
Sbjct  500  LGTPFFFQASMGLLSFFQNSLLAMEPENVMRLLHTFPKNTSSRQLFDSISSDLGPLVALA  559

Query  394  CEEINEI  400
             E   E+
Sbjct  560  SEPRKEV  566

>H310_02547
Length=564

 Score = 223 bits (568),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 148/427 (35%), Positives = 201/427 (47%), Gaps = 97/427 (23%)

Query  65   FTDTWIEDILA----RPLSTDSKLVEALCFAGIPKELRGRVWGWLLGNKLQINEELFIIC  120
            F   W++D+L     +       LVEALCFAGIPKE+RGR W  +LGN+LQINE+LF IC
Sbjct  173  FGAIWLDDVLPHWGDQAALVPPHLVEALCFAGIPKEIRGRAWSAMLGNRLQINEQLFDIC  232

Query  121  KDRAEAVRSEIALQKEVDAIMKLSAGLSALATQSTDFSEDEADDTKASSSTTRLSTPCLT  180
            + RA+AV  E+ L KE D   +          Q        A          +L      
Sbjct  233  RARAKAVLLEMDLVKEADEKSR----------QLVRLEHKLAPHQHVLEPQPQLHNERDH  282

Query  181  ASENEEIDMIRLP-------PPTE---TLQNLAGVAEKLVATCERSVWLVDVDIHRTFAY  230
            A +++   +++LP       PP+    T  +   +A+KL+A  ER++ LV  D+ RTF  
Sbjct  283  AHDDDAPPLLQLPAHLSIAGPPSRDSSTALDAQALADKLIADNERNIKLVQRDMPRTFGN  342

Query  231  HPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLNCKDLTHPKFADSTLLFLTGMSYLAA  290
            HP+FQ+G  GA++T EVL AY CYRPDLGYVQ                     GMSYLAA
Sbjct  343  HPLFQDGAAGAQKTYEVLEAYTCYRPDLGYVQ---------------------GMSYLAA  381

Query  291  AICLHMDTFPAFKALSALMSTNLLFDMFRLQERRRASVRYITDRRLK-------------  337
             +CLH+D+F AF+A+ +LMST LLFDM+RL+E R      + D  L+             
Sbjct  382  ILCLHLDSFGAFRAMVSLMSTRLLFDMYRLEEERTLLYLSVYDSVLRHELPVLHAHFQEI  441

Query  338  ---------------------------------YFCNEFHTKMAKALLKVYERNLLELDE  364
                                             Y    F  +   A+L +YE  L+ LD 
Sbjct  442  GIDPRMYMVDWAFTLFTRCVPLEVVLRIWDCYMYLGTPFFFQACMAILIMYENTLVTLDL  501

Query  365  AEMMRLLHKFPSDISADVLFTALGNVALSCEEINEILSSDGDEDTLTRRVWSPDSFREAE  424
             + M+ LH  P   S    F AL  V LS   IN +L+  GD      R WSP   R  +
Sbjct  502  GDAMKFLHNVPKSCSPHEFFQALDAVNLSRPAINALLAG-GD-----LRPWSPVGKRSIQ  555

Query  425  ITFPDTY  431
            + +P+ Y
Sbjct  556  VEYPEAY  562

>SPRG_21393
Length=494

 Score = 195 bits (496),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 141/415 (34%), Positives = 179/415 (43%), Gaps = 133/415 (32%)

Query  64   SFTDTWIEDILARPLSTDSKLVEALCFAGIPKELRGRVWGWLLGNKLQINEELFIICKDR  123
            SFT+ W+ED                       E+RGR W  LLGNKLQINE+LF ICK R
Sbjct  164  SFTEAWLED-----------------------EVRGRAWAALLGNKLQINEQLFEICKTR  200

Query  124  AEAVRSEIALQKEVDAIMKLSAGLSALATQSTDFSEDEADDTKASSSTTRLSTPCLTA-S  182
            A+AV  E+A                  AT++ D                R + P LT  +
Sbjct  201  AKAVLVEVA------------------ATKAKDM---------------RPNRPSLTIDT  227

Query  183  ENEEIDMIRLPPPTETLQNLAGVAEKLVATCERSVWLVDVDIHRTFAYHPMFQEGGHGAE  242
               +   + +  P      L    E L+A  ER++ LV +D+ RTF  HP FQ G  GA+
Sbjct  228  SGLDGGFVVVTSPQHAKSTLT---EALIADNERNIKLVKLDMPRTFGSHPQFQAGAVGAQ  284

Query  243  RTREVLHAYICYRPDLGYVQGLNCKDLTHPKFADSTLLFLTGMSYLAAAICLHMDTFPAF  302
            +T EVL AY CYRPDLGYVQ                     GMSYLAA +CLHMD+F AF
Sbjct  285  KTYEVLEAYTCYRPDLGYVQ---------------------GMSYLAAILCLHMDSFSAF  323

Query  303  KALSALMSTNLLFDMFRLQERRRASVRYITDRRLK--------YF---------------  339
            KA+ +L+ST LLFDM+RL+E R      + D  L+        YF               
Sbjct  324  KAMVSLLSTRLLFDMYRLEEDRTLHYLGVYDTILQHELPTLHAYFEEIGMDAKMYVVDWA  383

Query  340  -----------------------CNEFHTKMAKALLKVYERNLLELDEAEMMRLLHKFPS  376
                                      F  +   A+L +YE +LL LD  + MR LH  P 
Sbjct  384  FTLFTRCVPLDVVLRIWDVYILLGTPFFFQACMAILILYEEHLLVLDLGDAMRFLHDIPK  443

Query  377  DISADVLFTALGNVALSCEEINEILSSDGDEDTLTRRVWSPDSFREAEITFPDTY  431
              S    F AL  V LSC  I+ +L+          R WSP   R   + FPD Y
Sbjct  444  STSPSDFFDALDAVNLSCSAIDSLLAGGN------VRPWSPVGRRPVSVEFPDAY  492

>PHYKE_8395
Length=1420

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 86/191 (45%), Gaps = 49/191 (26%)

Query  241  AERTREVLHAYICYRPDLGYVQGLNCKDLTHPKFADSTLLFLTGMSYLAAAICLHMDTFP  300
            A R+  VL      +  +G  + L   DL           ++ GMSYLAA +C HMD+F 
Sbjct  227  ARRSSAVLPVQNMLKDAVGIAEMLVAHDLG----------YVQGMSYLAATLCFHMDSFT  276

Query  301  AFKALSALMSTNLLFDMFRLQERRRASVRYITDRRLKY----------------------  338
            AFKAL ALMS++LLFDMFRL+  R      + ++ L++                      
Sbjct  277  AFKALVALMSSSLLFDMFRLEATRTFHYIEVYNQILEHELPALAAHFQEQGIDAQMYAVD  336

Query  339  -----------------FCNEFHTKMAKALLKVYERNLLELDEAEMMRLLHKFPSDISAD  381
                                 F  + +  LL +++ +LLE+D  ++MRLLH FP   S+ 
Sbjct  337  WSLPLDLALRLWDVYVLLGTPFFFQASMGLLTLFQDSLLEMDAGDIMRLLHNFPKTTSSC  396

Query  382  VLFTALGNVAL  392
             LF A+ +  L
Sbjct  397  QLFEAISSNPL  407

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 86/160 (54%), Gaps = 20/160 (13%)

Query  2    AWITEIRA------SQSQHTCKVVNSNLS-SESTHVWPTFIKDTRNQ-RNkvsktrreer  53
            +W++E+RA      + S     V    LS S  T    T + D R   R +VSK RR E+
Sbjct  99   SWVSELRALLAGGYNPSHSEPTVFGRKLSDSVKTSTVGTTLHDRRKAARKRVSKERRAEK  158

Query  54   krvklkklskSFTDTWIEDILARPLS---TDSKLVEALCFAGIPKELRGRVWGWLLGNKL  110
            +R +L K+ ++F++ W+E++   P      +  L++ALCFAGIPKELRGRV     G+++
Sbjct  159  RRQQLPKIKQTFSEMWVEEVFTLPSGGTRAEMPLLDALCFAGIPKELRGRVAE---GSEV  215

Query  111  QINEELFIICKDRAEAVRSEIALQKEVDAIMKLSAGLSAL  150
             +  ++     DR  A RS   L   V  ++K + G++ +
Sbjct  216  PLTTDI----NDRNRARRSSAVL--PVQNMLKDAVGIAEM  249

>PYIW_17531
Length=1430

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 66/244 (27%), Positives = 98/244 (40%), Gaps = 77/244 (32%)

Query  79    STDSKLVEALCFAGIPKELRGRVWGWLLGNKLQINEELFIICKDRAEAVRSEIALQKEVD  138
             S D+ L  ++   GIP  +R +VW   +GNKL++  E++ I + RA      +A +++  
Sbjct  1063  SRDTPLAHSMWRQGIPPSIRAKVWPLAIGNKLKVTPEMYQIYRRRA------VAYKQQER  1116

Query  139   AIMKLSAGLSALATQSTDFSEDEADDTKASSSTTRLSTPCLTASENEEIDMIRLPPPTET  198
              I     G+        D SE                             M R       
Sbjct  1117  EISNSFGGIG-------DGSE-----------------------------MKR-------  1133

Query  199   LQNLAGVAEKLVATCERSVWLVDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDL  258
                   +++ ++   E ++ L+D D+ RTF    +F   G       EVL  Y CYRPDL
Sbjct  1134  -----AMSDSMMNGREHTLALIDTDLPRTFPSLKLFDASGPYYAFLLEVLETYACYRPDL  1188

Query  259   GYVQGLNCKDLTHPKFADSTLLFLTGMSYLAAAICLHM--DTFPAFKALSALMSTNLLFD  316
             GY+Q                     GMSYLAA +CLHM  D +  F+ L+ LM    LF 
Sbjct  1189  GYIQ---------------------GMSYLAAMLCLHMPQDRYLTFQCLANLMVNEHLFT  1227

Query  317   MFRL  320
              + L
Sbjct  1228  FYLL  1231

>PYAP_21745
Length=1298

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 54/109 (50%), Gaps = 23/109 (21%)

Query  214   ERSVWLVDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLNCKDLTHPK  273
             E ++ L+D D+ RTF    +F   G   E   EVL  Y CYRPDLGY+Q           
Sbjct  1018  EHTLALIDTDLPRTFPSLKLFDATGPYYEYLLEVLETYACYRPDLGYIQ-----------  1066

Query  274   FADSTLLFLTGMSYLAAAICLHM--DTFPAFKALSALMSTNLLFDMFRL  320
                       GMSYLAA +CLHM  D + AF+ L+ LM    LF  + L
Sbjct  1067  ----------GMSYLAALLCLHMPQDRYLAFQCLANLMVNEHLFTFYLL  1105

 Score = 44.7 bits (104),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 29/48 (60%), Gaps = 0/48 (0%)

Query  81    DSKLVEALCFAGIPKELRGRVWGWLLGNKLQINEELFIICKDRAEAVR  128
             D+ L  A+   GIP  +R RVW   +GNKL+I  E++ I + RA A +
Sbjct  954   DTPLAHAMWRQGIPPSIRARVWPLAIGNKLKITPEMYQIYRKRAIAYK  1001

>PYAR_16992
Length=1292

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 64/139 (46%), Gaps = 30/139 (22%)

Query  211   ATCERSVWLVDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLNCKDLT  270
             A  + ++ L+D D+ RTF    +F   G   E   EVL  Y CYRPDLGY+Q        
Sbjct  1009  ARSQHTLALIDTDLPRTFPSLKLFDATGPYYEFLLEVLETYACYRPDLGYIQ--------  1060

Query  271   HPKFADSTLLFLTGMSYLAAAICLHM--DTFPAFKALSALMSTNLLFDMFRLQERRRASV  328
                          GMSYLAA +CLHM  D + AF+ L+ LM    LF  + L        
Sbjct  1061  -------------GMSYLAALLCLHMPQDRYLAFQCLANLMVNEHLFTFYLLDAE-----  1102

Query  329   RYITDRRLKYFCNEFHTKM  347
               ++D   K F    H+++
Sbjct  1103  --LSDVYYKLFEEFLHSRL  1119

 Score = 40.4 bits (93),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 29/53 (55%), Gaps = 6/53 (11%)

Query  81    DSKLVEALCFAGIPKELRGRVWGWLLGNKLQINEELFIICKDRAEAVRSEIAL  133
             D+ L  A+   GIP  +R RVW   +GNKL+I  E+F       E+ RS+  L
Sbjct  969   DTPLAHAMWRQGIPPSIRARVWPLAIGNKLKITPEIF------TESARSQHTL  1015

>PYU1_G007420
Length=1346

 Score = 70.5 bits (171),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 53/109 (49%), Gaps = 23/109 (21%)

Query  214   ERSVWLVDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLNCKDLTHPK  273
             E S+ L+D D+ RTF    +F   G   E   EVL  Y CYRPDLGY+Q           
Sbjct  1061  EHSLALIDTDLPRTFPSLKLFDASGPYYEFLLEVLETYACYRPDLGYIQ-----------  1109

Query  274   FADSTLLFLTGMSYLAAAICLHM--DTFPAFKALSALMSTNLLFDMFRL  320
                       GMSYLAA +CLHM  D +  F+ L+ LM    LF  + L
Sbjct  1110  ----------GMSYLAAMLCLHMPHDRYLTFQCLANLMVNEHLFTFYLL  1148

 Score = 45.1 bits (105),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (60%), Gaps = 0/52 (0%)

Query  79    STDSKLVEALCFAGIPKELRGRVWGWLLGNKLQINEELFIICKDRAEAVRSE  130
             S D+ L  ++   GIP  +R +VW   +GNKL+I  E++ I + RA A + E
Sbjct  998   SKDTPLAHSMWRQGIPPSIRAKVWPLAIGNKLKITPEMYQIYRRRAIAYKQE  1049

>PYIR_23686
Length=1409

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 62/210 (30%), Positives = 87/210 (41%), Gaps = 35/210 (17%)

Query  203   AGVAEKLVATCERSVWLVDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQ  262
             +G    ++   E ++ L+D D+ RTF    +F   G   E   EVL  Y CYRPDLGY+Q
Sbjct  1114  SGGKNNVMIGREHTLALIDTDLPRTFPSLKLFDASGPYYEFLLEVLETYACYRPDLGYIQ  1173

Query  263   GLNCKDLTHPKFADSTLLFLTGMSYLAAAICLHM--DTFPAFKALSALMSTNLLFDMFRL  320
                                  GMSYLAA +CLHM  D +  F+ L+ LM    LF  + L
Sbjct  1174  ---------------------GMSYLAAMLCLHMPQDRYLTFQCLANLMVNEHLFTFYLL  1212

Query  321   QERRRASVRYITDRRLKYFCNEFHTKMAKALL--KVYERNLLELDEAEMMRLLHKFPSDI  378
                       + D  L       H  M    +   +Y  N L+         L   P ++
Sbjct  1213  DAELSGVYYTLFDEFLSARLPALHKHMGAIGISCSMYLMNWLQ------TLFLQVLPLEL  1266

Query  379   SADVL--FTALGNVAL--SCEEINEILSSD  404
             +A V   F   G V L  +   I+E+L +D
Sbjct  1267  AARVFDNFLLDGTVFLFRTAMAIHELLQAD  1296

 Score = 43.9 bits (102),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 31/52 (60%), Gaps = 0/52 (0%)

Query  79    STDSKLVEALCFAGIPKELRGRVWGWLLGNKLQINEELFIICKDRAEAVRSE  130
             S D+ L  ++   GIP  +R +VW   +GNKL++  E++ I + RA A + E
Sbjct  1059  SKDTPLAHSMWRQGIPPSIRAKVWPLAIGNKLKVTPEMYQIYRKRAIAYKLE  1110

>CCI45586
Length=955

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 54/109 (50%), Gaps = 23/109 (21%)

Query  214  ERSVWLVDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLNCKDLTHPK  273
            E S+ L+D D+ RTF    +F   G   E   +VL  Y CYRPDLGY+Q           
Sbjct  711  EHSLSLIDTDLPRTFPSLRLFDSTGPYNEYLVQVLETYACYRPDLGYIQ-----------  759

Query  274  FADSTLLFLTGMSYLAAAICLHMDTFP--AFKALSALMSTNLLFDMFRL  320
                      GMSYLAA +CLH+ T P   F+ L+ LM  + LF  + L
Sbjct  760  ----------GMSYLAAMLCLHIPTNPYLTFQCLANLMVQHHLFTFYLL  798

 Score = 38.1 bits (87),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 17/46 (37%), Positives = 25/46 (54%), Gaps = 0/46 (0%)

Query  79   STDSKLVEALCFAGIPKELRGRVWGWLLGNKLQINEELFIICKDRA  124
            S  S L   +   GIP  +R RVW   +GN L+   E++ + +DRA
Sbjct  650  SRHSSLTHTMWRQGIPPSIRARVWPLAIGNALKTTPEMYHLYRDRA  695

>CCA21326
Length=954

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 54/109 (50%), Gaps = 23/109 (21%)

Query  214  ERSVWLVDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLNCKDLTHPK  273
            E S+ L+D D+ RTF    +F   G   E   +VL  Y CYRPDLGY+Q           
Sbjct  716  EHSLSLIDTDLPRTFPSLRLFDSTGPYNEYLLQVLETYACYRPDLGYIQ-----------  764

Query  274  FADSTLLFLTGMSYLAAAICLHMDTFP--AFKALSALMSTNLLFDMFRL  320
                      GMSYLAA +CLH+ T P   F+ L+ LM  + LF  + L
Sbjct  765  ----------GMSYLAAMLCLHIPTNPYLTFQCLANLMVQHHLFTFYLL  803

 Score = 38.1 bits (87),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 17/46 (37%), Positives = 25/46 (54%), Gaps = 0/46 (0%)

Query  79   STDSKLVEALCFAGIPKELRGRVWGWLLGNKLQINEELFIICKDRA  124
            S  S L   +   GIP  +R RVW   +GN L+   E++ + +DRA
Sbjct  655  SRHSSLTHTMWRQGIPPSIRARVWPLAIGNALKTTPEMYHLYRDRA  700

>PPTG_04537
Length=1328

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 58/119 (49%), Gaps = 24/119 (20%)

Query  214   ERSVWLVDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLNCKDLTHPK  273
             E ++ L+D D+ RTF    +F   G       EVL  Y CYRPDLGY+Q           
Sbjct  1047  EHTLALIDTDLPRTFPSLKLFDSSGPYYAFLLEVLETYACYRPDLGYIQ-----------  1095

Query  274   FADSTLLFLTGMSYLAAAICLHM--DTFPAFKALSALMSTNLLFDMFRLQERRRASVRY  330
                       GMSYLAA +CLHM  D + AF+ L+ LM    LF  F L +   ASV Y
Sbjct  1096  ----------GMSYLAAMLCLHMPQDRYLAFQCLANLMVNEHLF-TFYLLDADLASVYY  1143

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 35/57 (61%), Gaps = 0/57 (0%)

Query  81    DSKLVEALCFAGIPKELRGRVWGWLLGNKLQINEELFIICKDRAEAVRSEIALQKEV  137
             D+ L  +L   GIP  +R RVW   +GNKL+I  E+F I + RA A + + AL+++ 
Sbjct  985   DTPLAHSLWRQGIPPSIRARVWPMAIGNKLKITPEMFRIYRRRAAAYKKDRALKEDA  1041

>PYVX_18712
Length=1302

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 68/208 (33%), Positives = 93/208 (45%), Gaps = 42/208 (20%)

Query  214   ERSVWLVDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLNCKDLTHPK  273
             E ++ L+D D+ RTF    +F   G   +   EVL  Y CYRPDLGY+Q           
Sbjct  1019  EHTLSLIDTDLPRTFPSLKLFDTSGPYYDFLLEVLETYACYRPDLGYIQ-----------  1067

Query  274   FADSTLLFLTGMSYLAAAICLHM--DTFPAFKALSALMSTNLLFDMFRLQERRRASVRYI  331
                       GMSYLAA +CLHM  D + AF+ L+ LM    LF  F L +   + V Y+
Sbjct  1068  ----------GMSYLAAMLCLHMPQDRYLAFQCLANLMVHEHLF-TFYLLDAELSDVYYV  1116

Query  332   T-DRRLKYFCNEFHTKMAKALL--KVYERNLLELDEAEMMRLLHKFPSDISADVL--FTA  386
               D  L     E H  +A   +   +Y  N L+         L   P +++A V   F  
Sbjct  1117  LFDEFLLARLPELHAHLADLGISNSMYLMNWLQ------TLFLQVLPLELAARVFDNFLL  1170

Query  387   LGNV-----ALSCEEI--NEILSSDGDE  407
              G V     AL+  E+   E+L +D DE
Sbjct  1171  DGTVFLFRTALAIHELLAPELLRADIDE  1198

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/54 (39%), Positives = 32/54 (59%), Gaps = 0/54 (0%)

Query  79    STDSKLVEALCFAGIPKELRGRVWGWLLGNKLQINEELFIICKDRAEAVRSEIA  132
             S D+ L  ++   GIP  +R RVW   + NKL+I  E++ I + RA A ++E A
Sbjct  957   SKDTPLAHSMWRQGIPPSIRARVWPLAIANKLKITPEMYQIYRKRATAYKAEKA  1010

>PHYRA_73531
Length=1347

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 58/119 (49%), Gaps = 24/119 (20%)

Query  214   ERSVWLVDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLNCKDLTHPK  273
             E ++ L+D D+ RTF    +F   G       EVL  Y CYRPDLGY+Q           
Sbjct  1066  EHTLALIDTDLPRTFPSLKLFDSSGPYYAFLLEVLETYACYRPDLGYIQ-----------  1114

Query  274   FADSTLLFLTGMSYLAAAICLHM--DTFPAFKALSALMSTNLLFDMFRLQERRRASVRY  330
                       GMSYLAA +CLHM  D + AF+ L+ LM    LF  F L +   ASV Y
Sbjct  1115  ----------GMSYLAAMLCLHMPQDRYLAFQCLANLMVNEHLF-TFYLLDADLASVYY  1162

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 35/60 (58%), Gaps = 0/60 (0%)

Query  81    DSKLVEALCFAGIPKELRGRVWGWLLGNKLQINEELFIICKDRAEAVRSEIALQKEVDAI  140
             D+ L  +L   GIP  +R RVW   +GNKL++  E+F I + RA A + + A ++   A+
Sbjct  1002  DTPLAHSLWRQGIPPSIRARVWPMAIGNKLKVTPEMFKIYRRRAAAYKKDQAAKENNGAV  1061

>HYAP_13668
Length=1203

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 53/109 (49%), Gaps = 23/109 (21%)

Query  214   ERSVWLVDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLNCKDLTHPK  273
             E ++ L+D D+ RTF    +F   G       EVL  Y CYRPDLGY+Q           
Sbjct  922   EHTLALIDTDLPRTFPSLKLFDSSGPYYAFLLEVLETYACYRPDLGYIQ-----------  970

Query  274   FADSTLLFLTGMSYLAAAICLHM--DTFPAFKALSALMSTNLLFDMFRL  320
                       GMSYLAA +CLHM  D + AF+ L+ LM    LF  + L
Sbjct  971   ----------GMSYLAAMLCLHMPQDRYLAFQCLANLMVNEHLFTFYLL  1009

 Score = 45.1 bits (105),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 33/56 (59%), Gaps = 0/56 (0%)

Query  81   DSKLVEALCFAGIPKELRGRVWGWLLGNKLQINEELFIICKDRAEAVRSEIALQKE  136
            D+ L  +L   GIP  +R RVW   +GNKL++  E+F I + RA A + +   ++E
Sbjct  858  DTPLAHSLWRQGIPPSIRARVWPMAIGNKLKVTPEMFKIYRRRAIAYKKDRVAKEE  913

>PITG_17882
Length=1289

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 53/109 (49%), Gaps = 23/109 (21%)

Query  214   ERSVWLVDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLNCKDLTHPK  273
             E ++ L+D D+ RTF    +F   G       EVL  Y CYRPDLGY+Q           
Sbjct  1008  EHTLALIDTDLPRTFPSLKLFDASGPYYAFLLEVLETYACYRPDLGYIQ-----------  1056

Query  274   FADSTLLFLTGMSYLAAAICLHM--DTFPAFKALSALMSTNLLFDMFRL  320
                       GMSYLAA +CLHM  D + AF+ L+ LM    LF  + L
Sbjct  1057  ----------GMSYLAAMLCLHMPQDRYLAFQCLANLMVNEHLFTFYLL  1095

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 35/56 (63%), Gaps = 0/56 (0%)

Query  81    DSKLVEALCFAGIPKELRGRVWGWLLGNKLQINEELFIICKDRAEAVRSEIALQKE  136
             D+ L  +L   GIP  +R RVW   +GNKL++  E+F I + RA A +S+ A +++
Sbjct  946   DTPLAHSLWRQGIPPSIRARVWPMAIGNKLKVTPEMFKIYRRRAAAYKSDRASKED  1001

>PHYSO_258036
Length=1271

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 53/109 (49%), Gaps = 23/109 (21%)

Query  214   ERSVWLVDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLNCKDLTHPK  273
             E ++ L+D D+ RTF    +F   G       EVL  Y CYRPDLGY+Q           
Sbjct  990   EHTLALIDTDLPRTFPSLKLFDSSGPYYAFLLEVLETYACYRPDLGYIQ-----------  1038

Query  274   FADSTLLFLTGMSYLAAAICLHM--DTFPAFKALSALMSTNLLFDMFRL  320
                       GMSYLAA +CLHM  D + AF+ L+ LM    LF  + L
Sbjct  1039  ----------GMSYLAAMLCLHMPQDRYLAFQCLANLMVNEHLFTFYLL  1077

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 37/62 (60%), Gaps = 0/62 (0%)

Query  79   STDSKLVEALCFAGIPKELRGRVWGWLLGNKLQINEELFIICKDRAEAVRSEIALQKEVD  138
            + D+ L  +L   GIP  +R RVW   +GNKL++  E+F I + RA A + + A +++ D
Sbjct  924  NKDTPLAHSLWRQGIPPSIRARVWPMAIGNKLKVTPEMFKIYRRRAAAYKKDRAAKEKND  983

Query  139  AI  140
             +
Sbjct  984  DV  985

>PHALS_06775
Length=1185

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 58/119 (49%), Gaps = 24/119 (20%)

Query  214   ERSVWLVDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLNCKDLTHPK  273
             E ++ L+D D+ RTF    +F   G       EVL  Y C+RPDLGY+Q           
Sbjct  908   EHTLALIDTDLPRTFPSLKLFDASGPYYTLLLEVLETYACFRPDLGYIQ-----------  956

Query  274   FADSTLLFLTGMSYLAAAICLHM--DTFPAFKALSALMSTNLLFDMFRLQERRRASVRY  330
                       GMSYLAA +CLHM  D + AF+ L+ LM    LF  F L +   ASV Y
Sbjct  957   ----------GMSYLAAMLCLHMPQDRYLAFQCLANLMVHEHLF-TFYLLDAELASVYY  1004

 Score = 43.1 bits (100),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 0/50 (0%)

Query  81   DSKLVEALCFAGIPKELRGRVWGWLLGNKLQINEELFIICKDRAEAVRSE  130
            +S L  AL   GIP  +R RVW   +GN+L++  E+F + + RA A + +
Sbjct  844  NSALTHALWRQGIPPSIRARVWPLAIGNQLKVTPEMFQMYRRRAIAYKKD  893

>H310_13597
Length=1191

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 53/109 (49%), Gaps = 23/109 (21%)

Query  214   ERSVWLVDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLNCKDLTHPK  273
             E +V L+  D+ RTF    +F   G   +  REVL  Y CYRPDLGY+Q           
Sbjct  940   EHTVRLIHTDLPRTFPTLKLFDTSGPYFDFLREVLETYACYRPDLGYIQ-----------  988

Query  274   FADSTLLFLTGMSYLAAAICLHM--DTFPAFKALSALMSTNLLFDMFRL  320
                       GMSY+AA +CLHM  D F  F+ L+ +M    LF  + L
Sbjct  989   ----------GMSYIAALLCLHMPTDRFLTFQCLANVMVHEHLFTFYLL  1027

 Score = 41.2 bits (95),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 0/50 (0%)

Query  79   STDSKLVEALCFAGIPKELRGRVWGWLLGNKLQINEELFIICKDRAEAVR  128
            + DS L + L   GIP  LR +VW   +GN L+I   ++ + + RA   R
Sbjct  880  TKDSPLAQTLWRQGIPPSLRSKVWPLAIGNTLKITPAMYQLYRQRASQTR  929

>PHYCA_41956
Length=140

 Score = 62.0 bits (149),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 52/110 (47%), Gaps = 24/110 (22%)

Query  223  DIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLNCKDLTHPKFADSTLLFL  282
            D+ RTF    +F   G       EVL  Y CYRPDLGY+Q                    
Sbjct  1    DLPRTFPSLKLFDSSGPYYAFLLEVLETYACYRPDLGYIQ--------------------  40

Query  283  TGMSYLAAAICLHM--DTFPAFKALSALMSTNLLFDMFRLQERRRASVRY  330
             GMSYLAA +CLHM  D + AF+ L+ LM    LF  F L +   A+V Y
Sbjct  41   -GMSYLAAMLCLHMPQDRYLAFQCLANLMVNEHLFT-FYLLDADLANVYY  88

>SDRG_09643
Length=1125

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 54/110 (49%), Gaps = 23/110 (21%)

Query  214  ERSVWLVDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLNCKDLTHPK  273
            E +V L+  D+ RTF    +F   G   E  REVL  Y CYRPDLGY+Q           
Sbjct  864  EHTVMLIHTDLPRTFPSLKLFDASGPYFEFLREVLETYACYRPDLGYIQ-----------  912

Query  274  FADSTLLFLTGMSYLAAAICLHM--DTFPAFKALSALMSTNLLFDMFRLQ  321
                      GMSY+AA +CLH+  D +  F+ L+ +M    LF  + L+
Sbjct  913  ----------GMSYIAALLCLHIPTDRYLTFQCLANVMVHEHLFTFYLLK  952

 Score = 43.1 bits (100),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 30/56 (54%), Gaps = 0/56 (0%)

Query  81   DSKLVEALCFAGIPKELRGRVWGWLLGNKLQINEELFIICKDRAEAVRSEIALQKE  136
            DS L ++L   GIP  +R  VW   +GN L+I  E++ I + RA   RS   L  E
Sbjct  806  DSALAQSLWRQGIPPSIRSTVWPLAIGNGLKITPEMYDIYRHRATKARSGEMLPTE  861

>SPRG_04368
Length=1142

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 54/110 (49%), Gaps = 23/110 (21%)

Query  214  ERSVWLVDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLNCKDLTHPK  273
            E +V L+  D+ RTF    +F   G   E  REVL  Y CYRPDLGY+Q           
Sbjct  881  EHTVMLIHTDLPRTFPSLKLFDASGPYFEFLREVLETYACYRPDLGYIQ-----------  929

Query  274  FADSTLLFLTGMSYLAAAICLHM--DTFPAFKALSALMSTNLLFDMFRLQ  321
                      GMSY+AA +CLH+  D +  F+ L+ +M    LF  + L+
Sbjct  930  ----------GMSYIAALLCLHIPTDRYLTFQCLANVMVHEHLFTFYLLK  969

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 38/74 (51%), Gaps = 4/74 (5%)

Query  67   DTWIEDILARPL----STDSKLVEALCFAGIPKELRGRVWGWLLGNKLQINEELFIICKD  122
            ++W    LA+P     S DS L ++L   GIP  +R  VW   +GN L+I  E++ I + 
Sbjct  805  ESWSAIALAQPHHWAESKDSALAQSLWRQGIPPSIRSTVWPLAIGNGLKITPEMYDIYRH  864

Query  123  RAEAVRSEIALQKE  136
            RA   RS   L  E
Sbjct  865  RASKARSGEMLPTE  878

>H257_09861
Length=1164

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 53/109 (49%), Gaps = 23/109 (21%)

Query  214  ERSVWLVDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLNCKDLTHPK  273
            E +V L+  D+ RTF    +F   G   +  REVL  Y CYRPDLGY+Q           
Sbjct  901  EHTVKLIHTDLPRTFPTLKLFDTSGPYFDYLREVLETYACYRPDLGYIQ-----------  949

Query  274  FADSTLLFLTGMSYLAAAICLHM--DTFPAFKALSALMSTNLLFDMFRL  320
                      GMSY+AA +CLH+  D +  F+ L+ +M    LF  + L
Sbjct  950  ----------GMSYIAALLCLHIPTDRYLTFQCLANVMVHEHLFTFYLL  988

 Score = 41.2 bits (95),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 0/50 (0%)

Query  79   STDSKLVEALCFAGIPKELRGRVWGWLLGNKLQINEELFIICKDRAEAVR  128
            S DS L + L   GIP  LR +VW   +GN L+I   ++ + + RA   R
Sbjct  840  SRDSPLAQTLWRQGIPPSLRSKVWPLAIGNSLKITPAMYHLYRQRASQAR  889

>PYVX_20370
Length=558

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 46/87 (53%), Gaps = 11/87 (13%)

Query  220  VDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLNCKDLTHPKFADSTL  279
            +D D+HRTF   P F +G  GA +   VL A   + PD+GY Q      LT P     T+
Sbjct  21   IDRDVHRTFPTVPFFADG-DGAAQLGNVLKAIAVHDPDVGYCQIAVNTHLTFP-----TM  74

Query  280  LFLT-----GMSYLAAAICLHMDTFPA  301
            L++T     GM+Y+ A + + ++  P+
Sbjct  75   LWVTNRRTQGMNYVVAIVLMVLNGHPS  101

>PYIW_23821
Length=666

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 51/113 (45%), Gaps = 11/113 (10%)

Query  203  AGVAEKLVATCERSVWLVDV--DIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGY  260
            AG  ++L+   E S  + D+  D++RT+  HP FQ    G    + VL AY  + P +GY
Sbjct  339  AGYFQQLILDRETSPSVADIEKDVYRTYPEHPFFQ-AEKGKNELKNVLCAYSLHNPSVGY  397

Query  261  VQGLNCKDLTHPKFADSTLLFLTGM-SYLAAAICLHMDTFPAFKALSALMSTN  312
             Q +N         A   LLF++   ++    + LH    PA     ++  T 
Sbjct  398  CQSMNF-------IAGMLLLFMSEEDAFWLLCVMLHKKYLPAANYTQSMAGTQ  443

>SPRG_07340
Length=365

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 66/158 (42%), Gaps = 35/158 (22%)

Query  199  LQNLAGVAEKLVAT----CERSVWLVDVDIHRTFAYHPMFQEG---GHGAERTREVLHAY  251
            +QN  G+   L+AT    CE ++     DI RTF  H +F++    G GA     +L AY
Sbjct  124  MQNHPGMYRDLLATAHIPCEETI---SRDIGRTFPKHHLFKDAQSIGQGA--LMNILKAY  178

Query  252  ICYRPDLGYVQGLNCKDLTHPKFADSTLLFLTGMSYLAAAICLHMDTFPAFKALSALMST  311
              Y PD+GY Q                     GM +++A    +M     F  L A+++ 
Sbjct  179  SVYDPDVGYCQ---------------------GMGFISALFLSYMPEEHTFWQLVAVLNQ  217

Query  312  NL--LFDMFRLQERRRASVRYITDRRLKYFCNEFHTKM  347
                L DM+R    R   +  I D  ++ +  +  T M
Sbjct  218  KKFGLADMYRPGMPRVVEIIAIFDACIRLYLPKLGTHM  255

>SDRG_04304
Length=369

 Score = 44.7 bits (104),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 39/74 (53%), Gaps = 12/74 (16%)

Query  199  LQNLAGVAEKLVAT----CERSVWLVDVDIHRTFAYHPMFQEG---GHGAERTREVLHAY  251
            +QN  G+   L+AT    CE ++     DI RTF  H +F++    G GA     +L AY
Sbjct  128  MQNHPGMYRDLLATAHIPCEETI---SRDIGRTFPKHHLFKDAQSIGQGA--LMNILKAY  182

Query  252  ICYRPDLGYVQGLN  265
              Y PD+GY QG+ 
Sbjct  183  SVYDPDVGYCQGMG  196

>PYAP_19866
Length=637

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 57/138 (41%), Gaps = 31/138 (22%)

Query  220  VDVDIHRTFAYHPMFQ-EGGHGAERTREVLHAYICYRPDLGYVQGLNCKDLTHPKFADST  278
            +  D+ RTF  HP F    G G  +   VL A   +  D+GY QG+N             
Sbjct  114  ISRDVDRTFPTHPFFSGSSGDGQRQLGNVLKAVALHSTDIGYCQGMN-------------  160

Query  279  LLFLTGMSYLAAAICLHMDTFP---------AFKALSALMSTNLLFDMFRLQERRRASVR  329
                    Y+AAA+ +HM   P         +F  L+AL+    + DM+R +    +   
Sbjct  161  --------YVAAALLIHMTRQPDASIAPQEASFWLLTALVRHYGMDDMWRAKMPGLSRSL  212

Query  330  YITDRRLKYFCNEFHTKM  347
            ++  + L+    + HT +
Sbjct  213  HVYQQLLRRHFYDLHTHL  230

>CCI40882
Length=623

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 35/111 (32%), Positives = 50/111 (45%), Gaps = 12/111 (11%)

Query  192  LPPPTETLQNLAGVAEKLVATCERSVWL---VDVDIHRTFAYHPMFQEGGHGAERTREVL  248
             P  T  +  + G+A     T  +S  +   +  DI RTF   P F E   G  + R VL
Sbjct  38   FPSQTFCIHWILGIASPEETTTLQSTGIEGEIARDIVRTFPTKPFF-ESKEGQRKLRNVL  96

Query  249  HAYICYRPDLGYVQGLNCKDLTHPKFADSTLLFLTGMSYLAAAICL--HMD  297
             A + +RP +GY     C+ L  P   +  L    GM+Y+AA   L  H+D
Sbjct  97   KAILSFRPKVGY-----CQRLPFPG-TEFYLKMCKGMNYVAAIFLLFQHVD  141

>PYU1_G008908
Length=516

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 50/109 (46%), Gaps = 11/109 (10%)

Query  207  EKLVATCERSVWLVDV--DIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGL  264
            ++L++ C  S  + D+  DI RT+  HP FQ    G    + VL AY  + P +GY Q +
Sbjct  323  QELLSQCNSSPSIGDIEKDIFRTYPEHPFFQT-EKGKTELKNVLCAYSLHNPAIGYCQSM  381

Query  265  NCKDLTHPKFADSTLLFLTGM-SYLAAAICLHMDTFPAFKALSALMSTN  312
            N         A   LLF+    ++    + LH +  PA     +++ T 
Sbjct  382  NF-------IAGMMLLFMDEEDAFWLLCVVLHKNYLPAANYTQSMVGTQ  423

>PYAR_15755
Length=606

 Score = 42.0 bits (97),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 25/44 (57%), Gaps = 1/44 (2%)

Query  223  DIHRTFAYHPMF-QEGGHGAERTREVLHAYICYRPDLGYVQGLN  265
            D+ RTF  H  F  +GG G  +   VL A   + PD+GY QG+N
Sbjct  74   DVDRTFPMHKFFASDGGDGQRQLGNVLKAVSLHVPDVGYCQGMN  117

>PYU1_G002312
Length=352

 Score = 40.8 bits (94),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 0/46 (0%)

Query  220  VDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLN  265
            +D D+ RT +  P FQ GG   +    +L  Y    P LGY+QG+N
Sbjct  122  IDKDVSRTQSSLPFFQIGGIAQQWMLRILFLYAKLHPALGYMQGMN  167

>PYAR_18160
Length=631

 Score = 41.2 bits (95),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 31/60 (52%), Gaps = 3/60 (5%)

Query  208  KLVATCERSVWLVDV--DIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLN  265
            + VA  E S  + D+  DIHRT+  H  FQ    G    + VL AY  + P +GY Q +N
Sbjct  274  RQVAQIESSPSIGDIEKDIHRTYPEHVFFQ-SDQGRRELKHVLGAYSLHNPHIGYCQSMN  332

>PHALS_12045
Length=621

 Score = 40.8 bits (94),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 0/46 (0%)

Query  220  VDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLN  265
            +D DI RTF     F + G G      VL A   Y  D+GY QG+N
Sbjct  115  IDRDIERTFPNDRFFSDDGDGKRLLGNVLKAVALYADDVGYCQGMN  160

>PYVX_14776
Length=1143

 Score = 40.8 bits (94),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 34/71 (48%), Gaps = 4/71 (6%)

Query  199  LQNLAGVAEKLVA----TCERSVWLVDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICY  254
            ++   G+ E+L+A    T   +   +DVD+HRT A            E  R VL AY  Y
Sbjct  263  MRKRKGLYERLLAMEGDTSTEATVQIDVDLHRTVADGDKELWSAEKTEMMRRVLVAYSFY  322

Query  255  RPDLGYVQGLN  265
               LGY QGLN
Sbjct  323  NTGLGYCQGLN  333

>PHYSO_349570
Length=1133

 Score = 40.4 bits (93),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 36/70 (51%), Gaps = 3/70 (4%)

Query  199  LQNLAGVAEKLVAT---CERSVWLVDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYR  255
            ++   G+ E+L+A+      +   +DVD+HRT A           ++  R VL AY  Y 
Sbjct  262  MRKHKGMYERLLASELESTEATRQIDVDLHRTVAEEDKELWTDEKSKIMRRVLVAYSYYN  321

Query  256  PDLGYVQGLN  265
            P LGY QGLN
Sbjct  322  PGLGYCQGLN  331

>PPTG_05282
Length=1105

 Score = 40.4 bits (93),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 50/121 (41%), Gaps = 8/121 (7%)

Query  204  GVAEKLVAT---CERSVWLVDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGY  260
            G  E+L+A+      +   +DVD+HRT A           +   R VL AY  Y P LGY
Sbjct  269  GQYERLLASELESTEATRQIDVDLHRTVADEDKELWTEEKSRMMRRVLVAYSIYNPGLGY  328

Query  261  VQGLNCKDLTHPKFADSTLLFLTGMSYLAAAICLHMDTFPAFKALSALMSTNLLFDMFRL  320
             QGLN       +F D    F     YL  AI   +        L   +  ++  D+ R+
Sbjct  329  CQGLNYIVARSLQFLDEEEAF-----YLLVAIIQLVPDDYYTTMLGLAVDQHVFADLVRI  383

Query  321  Q  321
            Q
Sbjct  384  Q  384

>PITG_02531
Length=1100

 Score = 40.4 bits (93),  Expect = 0.023, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 32/65 (49%), Gaps = 3/65 (5%)

Query  204  GVAEKLVATCERSVWL---VDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGY  260
            G  E+L+A+   S      +DVD+HRT A           +   R VL AY  Y P LGY
Sbjct  264  GQYERLLASESESTEATRQIDVDLHRTVANEDKELWTEEKSRMMRRVLVAYSIYNPGLGY  323

Query  261  VQGLN  265
             QGLN
Sbjct  324  CQGLN  328

>PYVX_15147
Length=539

 Score = 39.7 bits (91),  Expect = 0.034, Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query  220  VDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLN  265
            +D D+ RTF  H  FQ G  G    + VL AY  + P +GY Q +N
Sbjct  284  IDKDVARTFPEHEFFQTG-KGQLELQAVLTAYAVHNPAIGYCQSMN  328

>H310_01299
Length=378

 Score = 39.3 bits (90),  Expect = 0.035, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 31/58 (53%), Gaps = 8/58 (14%)

Query  211  ATCERSVWLVDVDIHRTFAYHPMFQEG---GHGAERTREVLHAYICYRPDLGYVQGLN  265
            A CE ++     DI RTF  H +F++    G GA     VL AY  Y P++GY QG+ 
Sbjct  153  APCEDTI---SRDIGRTFPKHHLFKDSTSLGQGA--LMNVLRAYSVYDPNVGYCQGMG  205

>PYIW_18867
Length=413

 Score = 39.3 bits (90),  Expect = 0.041, Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 65/151 (43%), Gaps = 43/151 (28%)

Query  219  LVDVDIHRTFAY---------HPMFQEGGHGAER----------------TREVLHAYIC  253
            ++D D+ RTF +         H  FQ+    A +                TRE+L A++ 
Sbjct  124  MIDQDVERTFHHLHEVITHTQHSAFQQPTRNAFKKKAPLSDADFAAWRASTRELLSAFLL  183

Query  254  YRPDLGYVQGLNCKDLTHPKFADSTLLFL-TGMSYLAAAICLHMDTFPAFKALSALMSTN  312
             +P +GY Q  NC + T   F  +  + L  GM++LAA I           A  A ++  
Sbjct  184  LKPQIGYCQ--NCLNATLYSFGGAKSIGLKQGMTHLAAVI-----------AQEAKLNCE  230

Query  313  LLFDMFR-LQERRRASVRYITDRR---LKYF  339
            + F +F  + E+ R  + Y  D R   L++F
Sbjct  231  IAFRLFLCMTEKYRMDLLYGPDMRDVNLRFF  261

>H257_00498
Length=371

 Score = 38.9 bits (89),  Expect = 0.045, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 31/58 (53%), Gaps = 8/58 (14%)

Query  211  ATCERSVWLVDVDIHRTFAYHPMFQEG---GHGAERTREVLHAYICYRPDLGYVQGLN  265
            A CE ++     DI RTF  H +F++    G GA     VL AY  Y P++GY QG+ 
Sbjct  146  APCEDTI---SRDIGRTFPKHHLFKDATSLGQGA--LMNVLRAYSVYDPNVGYCQGMG  198

>PHALS_07348
Length=654

 Score = 39.3 bits (90),  Expect = 0.049, Method: Compositional matrix adjust.
 Identities = 26/80 (33%), Positives = 36/80 (45%), Gaps = 15/80 (19%)

Query  201  NLAGVAEK-----------LVATCER----SVWLVDVDIHRTFAYHPMFQEGGHGAERTR  245
            NL+G +EK           LV   E+    +   +++DI+RTF           G  R R
Sbjct  332  NLSGASEKQAIAGHNYYADLVEKAEKMDLETFCQIELDINRTFGNSGTTISSESGRSRLR  391

Query  246  EVLHAYICYRPDLGYVQGLN  265
             +L AY    P +GY QGLN
Sbjct  392  RILQAYSLRNPRVGYCQGLN  411

>CCI42299
Length=614

 Score = 38.9 bits (89),  Expect = 0.060, Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 30/69 (43%), Gaps = 16/69 (23%)

Query  220  VDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLNCKDLTHPKFADSTL  279
            ++ D+ RTF  HP F     G    R VL AY  + P +GY Q +N              
Sbjct  373  IEKDVSRTFPEHPFFCR-QQGRRELRNVLAAYSLHNPSIGYCQSMN--------------  417

Query  280  LFLTGMSYL  288
             F+TGM  L
Sbjct  418  -FITGMMLL  425

>CCI42301
Length=601

 Score = 38.9 bits (89),  Expect = 0.064, Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 30/69 (43%), Gaps = 16/69 (23%)

Query  220  VDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLNCKDLTHPKFADSTL  279
            ++ D+ RTF  HP F     G    R VL AY  + P +GY Q +N              
Sbjct  373  IEKDVSRTFPEHPFFCR-QQGRRELRNVLAAYSLHNPSIGYCQSMN--------------  417

Query  280  LFLTGMSYL  288
             F+TGM  L
Sbjct  418  -FITGMMLL  425

>HYAP_01912
Length=670

 Score = 38.9 bits (89),  Expect = 0.067, Method: Compositional matrix adjust.
 Identities = 24/83 (29%), Positives = 37/83 (45%), Gaps = 7/83 (8%)

Query  220  VDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLNCKDLTHPKFADSTL  279
            +++DI RTF +         G  + R +L AY    P +GY QGLN         AD  +
Sbjct  382  IELDIGRTFGHSGTIISSESGRGQLRRILRAYSLRNPSVGYCQGLNYIVAFLLLIADEEV  441

Query  280  LFLTGMSYLAAAICLHMDTFPAF  302
            +F     +L +  C   D +P +
Sbjct  442  VF-----WLLSVFC--EDLYPGY  457

>PYIW_14104
Length=1257

 Score = 38.9 bits (89),  Expect = 0.072, Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 25/46 (54%), Gaps = 0/46 (0%)

Query  220  VDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLN  265
            +DVD++RT ++            + R VL AY  Y P LGY QGLN
Sbjct  295  IDVDLYRTVSHADKATWSDEKTHQLRRVLVAYSNYNPTLGYCQGLN  340

>PYVX_16220
Length=330

 Score = 38.1 bits (87),  Expect = 0.076, Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 0/43 (0%)

Query  223  DIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLN  265
            D+ RT +    F +GG G      +L  Y    PD+GY+QG+N
Sbjct  109  DVSRTRSELSFFADGGRGQHSMLRILFLYAKLHPDVGYMQGMN  151

>PHYRA_94840
Length=761

 Score = 38.5 bits (88),  Expect = 0.083, Method: Compositional matrix adjust.
 Identities = 24/65 (37%), Positives = 32/65 (49%), Gaps = 3/65 (5%)

Query  204  GVAEKLVAT---CERSVWLVDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGY  260
            G  E+L+A+      +   +DVD+HRT A           +   R +L AY  Y P LGY
Sbjct  263  GQYERLLASELESTEATRQIDVDLHRTVADEDKEFWTEEKSRMMRRILVAYSLYNPGLGY  322

Query  261  VQGLN  265
             QGLN
Sbjct  323  CQGLN  327

>CCA16834
Length=613

 Score = 38.1 bits (87),  Expect = 0.092, Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 39/90 (43%), Gaps = 22/90 (24%)

Query  220  VDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLNCKDLTHPKFADSTL  279
            ++ D+ RTF  HP F     G    R +L AY  + P +GY Q +N              
Sbjct  365  IEKDVCRTFPDHPFFGM-KQGRRELRNMLAAYSLHNPSIGYCQSMN--------------  409

Query  280  LFLTGMSYLAAAICLHMDTFPAFKALSALM  309
             F+TGM      + L M    AF  L+AL+
Sbjct  410  -FITGM------MLLFMPEEDAFWLLTALL  432

>PPTG_13469
Length=655

 Score = 38.1 bits (87),  Expect = 0.094, Method: Compositional matrix adjust.
 Identities = 24/83 (29%), Positives = 38/83 (46%), Gaps = 7/83 (8%)

Query  220  VDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLNCKDLTHPKFADSTL  279
            +++DI RTF +         G ++ R +L AY    P +GY QGLN         AD  +
Sbjct  368  IELDIDRTFGHSGTTICSVSGRDQLRRILRAYSLRNPSVGYCQGLNFIVAFLMLMADEEV  427

Query  280  LFLTGMSYLAAAICLHMDTFPAF  302
            +F     +L +  C   D +P +
Sbjct  428  IF-----WLLSVFC--EDLYPGY  443

>PHALS_07987
Length=365

 Score = 38.1 bits (87),  Expect = 0.094, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 39/75 (52%), Gaps = 8/75 (11%)

Query  196  TETLQNLAGVAEKLVAT----CERSVWLVDVDIHRTFAYHPMFQE-GGHGAERTREVLHA  250
            ++ L N +G+  +LV T    CE ++     DI RTF  H +F++    G      +L A
Sbjct  121  SQMLSNNSGIYHQLVQTIGVPCEETI---ARDIGRTFPKHTLFRDRSSLGQCALMNMLKA  177

Query  251  YICYRPDLGYVQGLN  265
            Y  + P++GY QG+ 
Sbjct  178  YSLHDPEVGYCQGMG  192

>PITG_03623
Length=712

 Score = 38.1 bits (87),  Expect = 0.095, Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 48/103 (47%), Gaps = 10/103 (10%)

Query  220  VDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLNCKDLTHPKFADSTL  279
            +++DI RTF +         G ++ R +L AY    P +GY QGLN         AD  +
Sbjct  425  IELDIDRTFGHSGTKLCSESGRDQLRRILQAYSLRNPSVGYCQGLNFIVAFLMLIADEEV  484

Query  280  LFLTGMSYLAAAICLHMDTFPAFKALSALMSTNLLFDMFRLQE  322
            +F     +L +  C   D +P +   S  MS ++  DM  L++
Sbjct  485  VF-----WLLSVFC--EDLYPGY--YSPAMS-DIQRDMLVLKQ  517

>PHYSO_467548
Length=659

 Score = 38.1 bits (87),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 26/85 (31%), Positives = 40/85 (47%), Gaps = 11/85 (13%)

Query  220  VDVDIHRTFAYHP--MFQEGGHGAERTREVLHAYICYRPDLGYVQGLNCKDLTHPKFADS  277
            +++DI RTF +    +  E G G  + R +L AY    P +GY QGLN         AD 
Sbjct  371  IELDIDRTFGHSGTTICSEAGRG--QLRRILRAYSLRNPSVGYCQGLNFIVAFFLLMADE  428

Query  278  TLLFLTGMSYLAAAICLHMDTFPAF  302
             ++F     +L +  C   D +P +
Sbjct  429  EVVF-----WLLSVFC--EDLYPGY  446

>SPRG_10036
Length=955

 Score = 38.1 bits (87),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (53%), Gaps = 3/51 (6%)

Query  215  RSVWLVDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLN  265
            R  +L+  D+ RTFA  PM Q       R   +L A++ + P LGY Q +N
Sbjct  734  RDYYLIASDVQRTFADQPMMQSV---RPRLERLLLAFVAHAPSLGYCQSMN  781

>PHYRA_84807
Length=660

 Score = 38.1 bits (87),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 20/63 (32%), Positives = 32/63 (51%), Gaps = 0/63 (0%)

Query  203  AGVAEKLVATCERSVWLVDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQ  262
            AG+  +  +T   +   +++DI RTF +         G ++ R +L AY    P +GY Q
Sbjct  355  AGLVREADSTETETFRQIELDIDRTFGHSGTAICSQSGRDQLRRILRAYSLRNPSVGYCQ  414

Query  263  GLN  265
            GLN
Sbjct  415  GLN  417

>PYAP_15111
Length=744

 Score = 38.1 bits (87),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 22/65 (34%), Positives = 34/65 (52%), Gaps = 3/65 (5%)

Query  203  AGVAEKLVATCERSVWLVDV--DIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGY  260
            +G   +LV   E S  + D+  DI+RT+  H  FQ    G +  + VL AY  +  ++GY
Sbjct  392  SGYYAQLVDQIENSPSIGDIEKDINRTYPEHAFFQ-SKQGRQELKNVLGAYSLHNREIGY  450

Query  261  VQGLN  265
             Q +N
Sbjct  451  CQSMN  455

>PHYCA_503618
Length=614

 Score = 37.7 bits (86),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 17/46 (37%), Positives = 25/46 (54%), Gaps = 0/46 (0%)

Query  220  VDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLN  265
            +++DI RTF +         G ++ R +L AY    P +GY QGLN
Sbjct  363  IELDIDRTFGHSGTTVCSKSGRDQLRRILRAYSLRNPTIGYCQGLN  408

>PYAP_16391
Length=779

 Score = 37.7 bits (86),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 29/61 (48%), Gaps = 15/61 (25%)

Query  218  WL--VDVDIHRTFAYHPMFQEGGHG-----AERT------REVLHAYICYRPDLGYVQGL  264
            WL  +DVD+ RT       Q  G G      ERT      R VL AY  Y P +GY QG+
Sbjct  539  WLREIDVDVART--QQKAIQANGSGRNEQAMERTQHEASIRRVLRAYAMYNPRVGYCQGM  596

Query  265  N  265
            N
Sbjct  597  N  597

>PYAR_25287
Length=464

 Score = 37.4 bits (85),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 0/46 (0%)

Query  220  VDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLN  265
            +++DI RTF           G    R VL AY  + P +GY QGLN
Sbjct  176  IELDIDRTFGQSGTKMSTEEGRALLRRVLKAYSMHNPTVGYCQGLN  221

>CCI40039
Length=365

 Score = 37.0 bits (84),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 37/76 (49%), Gaps = 12/76 (16%)

Query  196  TETLQNLAGVAEKLVAT----CERSVWLVDVDIHRTFAYHPMFQEG---GHGAERTREVL  248
            T+   +  GV  +L+ T    CE S+     DI RTF  H +F      G GA     VL
Sbjct  119  TQMAMHNPGVYRELLQTIDIPCEDSI---ARDIGRTFPKHYLFHAKNSLGQGA--LMNVL  173

Query  249  HAYICYRPDLGYVQGL  264
             AY  + PD+GY QG+
Sbjct  174  KAYSLHDPDVGYCQGM  189

>PPTG_13742
Length=347

 Score = 37.0 bits (84),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 15/46 (33%), Positives = 26/46 (57%), Gaps = 0/46 (0%)

Query  220  VDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLN  265
            ++ D+ RT +   +F  GG   ++   +L  +    PD+GYVQG+N
Sbjct  115  IEKDVFRTRSELTLFAGGGIAQQQMLYILFVFAKLHPDIGYVQGMN  160

>PYU1_G004478
Length=1198

 Score = 37.4 bits (85),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 31/101 (31%), Positives = 39/101 (39%), Gaps = 30/101 (30%)

Query  220  VDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLNCKDLTHPKFADSTL  279
            +DVD++RT +            ++ R VL AY  Y P LGY QGLN              
Sbjct  287  IDVDLYRTVSKTDKTLWNEDKTQQMRRVLVAYSYYNPTLGYCQGLN--------------  332

Query  280  LFLTGMSYLAAAICLHMDTFPAFKALSALMSTNLLFDMFRL  320
                   Y+ A I L +D   AF          LL  M RL
Sbjct  333  -------YIVARILLFLDEEEAFY---------LLIKMIRL  357

>PHYRA_73846
Length=359

 Score = 36.6 bits (83),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 37/75 (49%), Gaps = 8/75 (11%)

Query  196  TETLQNLAGVAEKLVAT----CERSVWLVDVDIHRTFAYHPMFQE-GGHGAERTREVLHA  250
            T+ L N  G   +L+ T    CE ++     DI RTF  H +F++    G      VL A
Sbjct  134  TQMLLNNPGAYHQLLQTAQVPCEETI---ARDIGRTFPRHSLFRDRSSLGQCALMNVLKA  190

Query  251  YICYRPDLGYVQGLN  265
            Y  + P++GY QG+ 
Sbjct  191  YSLHDPEVGYCQGMG  205

>PYVX_16052
Length=291

 Score = 36.2 bits (82),  Expect = 0.29, Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 4/47 (9%)

Query  223  DIHRTFAYHPMFQE----GGHGAERTREVLHAYICYRPDLGYVQGLN  265
            D+ RTF  H +F++    G  G      VL AY  + PD+GY QG+ 
Sbjct  74   DVGRTFPKHLLFRDPSAPGATGQAALFNVLRAYALHDPDVGYCQGMG  120

 Score = 32.3 bits (72),  Expect = 5.8, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 24/39 (62%), Gaps = 4/39 (10%)

Query  92   GIPKELRGRVWGWLLG--NKLQINEELF--IICKDRAEA  126
            G+P+ LRGRVW  L G    LQ N  L+  ++ +DR+ A
Sbjct  27   GVPEALRGRVWAHLAGATTMLQHNPHLYATLVAQDRSLA  65

>H257_14581
Length=573

 Score = 36.6 bits (83),  Expect = 0.29, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 23/43 (53%), Gaps = 1/43 (2%)

Query  223  DIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLN  265
            D+ RTF   P+F  G  G      VL A   + PD+GY QG+N
Sbjct  118  DLDRTFPSEPLFATG-QGPALLANVLKAVSVHVPDVGYCQGMN  159

>PYIR_19786
Length=1282

 Score = 36.6 bits (83),  Expect = 0.32, Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 24/46 (52%), Gaps = 0/46 (0%)

Query  220  VDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLN  265
            +DVD+ RT +            ++ R VL AY  Y P LGY QGLN
Sbjct  306  IDVDLFRTVSNADKSSWSEEKTQQMRRVLIAYANYNPTLGYCQGLN  351

>CCA14002
Length=782

 Score = 36.6 bits (83),  Expect = 0.33, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 24/45 (53%), Gaps = 5/45 (11%)

Query  223  DIHRTFAYHPMFQEG---GHGAERTREVLHAYICYRPDLGYVQGL  264
            DI RTF  H +F      G GA     VL AY  + PD+GY QG+
Sbjct  563  DIGRTFPKHYLFHAKNSLGQGA--LMNVLKAYSLHDPDVGYCQGM  605

>PYIW_15966
Length=619

 Score = 36.6 bits (83),  Expect = 0.33, Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 23/48 (48%), Gaps = 0/48 (0%)

Query  218  WLVDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLN  265
            W +  D+ RTF     F E   G  +   VL A   + P++ Y QG+N
Sbjct  107  WEIGRDVERTFPTLAFFSEDSDGRRQLGNVLKATAVHAPEVAYCQGMN  154

>PYIR_14707
Length=704

 Score = 36.6 bits (83),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 51/115 (44%), Gaps = 8/115 (7%)

Query  157  FSEDEADDTKASSSTTRLSTPCLTASENEEIDMIRLPPPTETLQNLAGVA--EKLVATCE  214
            FS    D  K +S   +L+   +  S  E++ M  L    E  QN AGV   + LV   E
Sbjct  349  FSLYRGDAAKENSVVRQLARAGIPRSWREQVYM-DLSGAREKQQN-AGVEHYKSLVEQSE  406

Query  215  RSVWL----VDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLN  265
             +  L    +++DI RTF +         G    + VL AY    P +GY QGLN
Sbjct  407  TTDSLAFRQIELDIDRTFGHSGTKICTEAGRSVLKRVLRAYSLRNPSVGYCQGLN  461

>PYAR_17224
Length=784

 Score = 36.2 bits (82),  Expect = 0.39, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 31/69 (45%), Gaps = 13/69 (19%)

Query  210  VATCERSVWL--VDVDIHRTFAYHPMFQEGGHGAER-----------TREVLHAYICYRP  256
            V T    VWL  +DVD+ RT +      +    AE             R VL AY+ Y P
Sbjct  541  VDTARLVVWLREIDVDVVRTCSRAVYATKSATPAEMLSSYRALLEATIRRVLRAYVMYNP  600

Query  257  DLGYVQGLN  265
             +GY QG+N
Sbjct  601  RVGYCQGMN  609

>PYAP_18805
Length=393

 Score = 35.8 bits (81),  Expect = 0.49, Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 36/81 (44%), Gaps = 9/81 (11%)

Query  193  PPPTETLQNLAGVAEKLVATCERSVWLVDV--------DIHRTFAYHPMFQEGGHGAERT  244
            P PTE   + +    KL+AT      L DV        D+ RT +    F  GG   +  
Sbjct  104  PQPTEPEMD-SKSNGKLLATFAEQALLQDVALMKEIEKDVSRTQSDLAFFSVGGIQQQWM  162

Query  245  REVLHAYICYRPDLGYVQGLN  265
              +L  Y    P+LGY+QG+N
Sbjct  163  LRILFVYAKLNPELGYMQGMN  183

>PYIR_15530
Length=428

 Score = 35.8 bits (81),  Expect = 0.56, Method: Compositional matrix adjust.
 Identities = 16/46 (35%), Positives = 24/46 (52%), Gaps = 0/46 (0%)

Query  220  VDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLN  265
            +D D+ RT +  P F  G    +    +L  Y    P+LGY+QG+N
Sbjct  197  IDKDVSRTQSALPFFAIGDIAQQWMLRILFVYAKLTPELGYMQGMN  242

>PPTG_00980
Length=383

 Score = 35.4 bits (80),  Expect = 0.57, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 37/75 (49%), Gaps = 8/75 (11%)

Query  196  TETLQNLAGVAEKLVAT----CERSVWLVDVDIHRTFAYHPMFQE-GGHGAERTREVLHA  250
            ++ L N  G   +L+ T    CE ++     DI RTF  H +F++    G      VL A
Sbjct  139  SQMLLNNPGAYHQLLQTTQVPCEETI---ARDIGRTFPKHSLFRDRSSLGQCALMNVLKA  195

Query  251  YICYRPDLGYVQGLN  265
            Y  + P++GY QG+ 
Sbjct  196  YSLHDPEVGYCQGMG  210

>PYAP_14184
Length=1184

 Score = 35.8 bits (81),  Expect = 0.57, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 26/48 (54%), Gaps = 4/48 (8%)

Query  220  VDVDIHRTFAYH--PMFQEGGHGAERTREVLHAYICYRPDLGYVQGLN  265
            +D D++RT      P++ E    A   R VL AY  Y P LGY QGLN
Sbjct  334  IDADLNRTVPDEDKPLWDEEKSKA--MRRVLVAYSFYNPTLGYCQGLN  379

>H310_13204
Length=566

 Score = 35.4 bits (80),  Expect = 0.69, Method: Compositional matrix adjust.
 Identities = 17/43 (40%), Positives = 23/43 (53%), Gaps = 1/43 (2%)

Query  223  DIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLN  265
            D+ RTF   P+F    HG      VL A   + P++GY QG+N
Sbjct  109  DLDRTFPLEPLFAST-HGPALLANVLKAVSVHVPEVGYCQGMN  150

>PYAR_18942
Length=1201

 Score = 35.8 bits (81),  Expect = 0.70, Method: Compositional matrix adjust.
 Identities = 25/90 (28%), Positives = 36/90 (40%), Gaps = 21/90 (23%)

Query  220  VDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLNCKDLTHPKFADSTL  279
            +D D+HRT             ++  R VL AY  + P LGY QGLN              
Sbjct  314  IDADLHRTVPEEDKTLWSDEKSKMMRRVLVAYSFFNPTLGYCQGLN--------------  359

Query  280  LFLTGMSYLAAAICLHMDTFPAFKALSALM  309
                   Y+ A + L +D   AF  L+ ++
Sbjct  360  -------YIVARLLLFVDEVEAFFLLTKML  382

>PYIW_19776
Length=684

 Score = 35.4 bits (80),  Expect = 0.75, Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 0/46 (0%)

Query  220  VDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLN  265
            +++DI RTF +         G    R VL AY    P +GY QGLN
Sbjct  396  IELDIDRTFGHSGTKICSEAGRAVLRRVLRAYSIRNPSIGYCQGLN  441

>PITG_01821
Length=372

 Score = 35.0 bits (79),  Expect = 0.75, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 37/75 (49%), Gaps = 8/75 (11%)

Query  196  TETLQNLAGVAEKLVAT----CERSVWLVDVDIHRTFAYHPMFQE-GGHGAERTREVLHA  250
            ++ L N  G   +L+ T    CE ++     DI RTF  H +F++    G      VL A
Sbjct  138  SQMLLNNPGAYHQLLQTTQVPCEETI---ARDIGRTFPKHSLFRDRSSLGQCALMNVLKA  194

Query  251  YICYRPDLGYVQGLN  265
            Y  + P++GY QG+ 
Sbjct  195  YSLHDPEVGYCQGMG  209

>PHYSO_313441
Length=361

 Score = 35.0 bits (79),  Expect = 0.80, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 37/75 (49%), Gaps = 8/75 (11%)

Query  196  TETLQNLAGVAEKLVAT----CERSVWLVDVDIHRTFAYHPMFQE-GGHGAERTREVLHA  250
            ++ L N  G   +L+ T    CE ++     DI RTF  H +F++    G      VL A
Sbjct  136  SQMLLNNPGAYHQLLQTARVPCEETI---ARDIGRTFPRHSLFRDRSSLGQCALMNVLKA  192

Query  251  YICYRPDLGYVQGLN  265
            Y  + P++GY QG+ 
Sbjct  193  YSLHDPEVGYCQGMG  207

>PYU1_G006985
Length=706

 Score = 35.4 bits (80),  Expect = 0.84, Method: Compositional matrix adjust.
 Identities = 17/46 (37%), Positives = 23/46 (50%), Gaps = 0/46 (0%)

Query  220  VDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLN  265
            +++DI RTF +         G    R +L AY    P +GY QGLN
Sbjct  417  IELDIDRTFGHSGTKICTEEGRAVLRRILRAYSIRNPSIGYCQGLN  462

>PYIW_17165
Length=356

 Score = 35.0 bits (79),  Expect = 0.87, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 35/75 (47%), Gaps = 8/75 (11%)

Query  196  TETLQNLAGVAEKLV----ATCERSVWLVDVDIHRTFAYHPMFQE-GGHGAERTREVLHA  250
            T+ + N  GV  + +      CE ++     DI RTF  H +F E    G      VL A
Sbjct  142  TQMMLNNPGVYHEFLQAKSVPCEETI---ARDIGRTFPKHYLFNERSSLGQCALMNVLKA  198

Query  251  YICYRPDLGYVQGLN  265
            Y  + P++GY QG+ 
Sbjct  199  YSLHDPEVGYCQGMG  213

>PYAP_15260
Length=621

 Score = 35.0 bits (79),  Expect = 0.87, Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 36/83 (43%), Gaps = 7/83 (8%)

Query  220  VDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLNCKDLTHPKFADSTL  279
            +++DI RTF +         G +  R VL AY  +  ++GY QG+N          D   
Sbjct  330  IELDIDRTFGHSRTKIATVEGRQTMRRVLKAYSMHNTNVGYCQGMNFIVGFLSLLLDEES  389

Query  280  LFLTGMSYLAAAICLHMDTFPAF  302
             F     +L A IC   D FP +
Sbjct  390  TF-----WLLAVIC--EDMFPGY  405

>PYAR_18203
Length=774

 Score = 35.0 bits (79),  Expect = 0.91, Method: Compositional matrix adjust.
 Identities = 15/46 (33%), Positives = 24/46 (52%), Gaps = 0/46 (0%)

Query  220  VDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLN  265
            +D D+ RT +  P F +G    +    +L  Y    P+ GY+QG+N
Sbjct  159  IDKDVSRTRSELPFFSDGSIQQQWMLRILFVYAKLNPEFGYMQGMN  204

>PHYCA_541937
Length=277

 Score = 34.3 bits (77),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 38/159 (24%), Positives = 64/159 (40%), Gaps = 31/159 (19%)

Query  196  TETLQNLAGVAEKLV----ATCERSVWLVDVDIHRTFAYHPMFQE-GGHGAERTREVLHA  250
            ++ L N  G   +L+      CE ++     DI RTF  H +F++    G      VL A
Sbjct  44   SQMLLNNPGAYHQLLQAAHVPCEETI---ARDIGRTFPRHSLFRDRSSLGQCALMNVLKA  100

Query  251  YICYRPDLGYVQGLNCKDLTHPKFADSTLLFLTGMSYLAAAICLHMDTFPAFKALSALMS  310
            Y  + P++GY Q                     GM +L+A    +M    AF  L A ++
Sbjct  101  YSLHDPEVGYCQ---------------------GMGFLSAMFLCYMPEQQAFWLLVACLN  139

Query  311  TNL--LFDMFRLQERRRASVRYITDRRLKYFCNEFHTKM  347
                 L D++R +  +   V +I +   K +  +  T +
Sbjct  140  HKRYGLADLYRPRMPKVPEVTFIFEGLFKQYMPQLSTHL  178

>PYIR_21637
Length=354

 Score = 34.3 bits (77),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 35/75 (47%), Gaps = 8/75 (11%)

Query  196  TETLQNLAGVAEKLVAT----CERSVWLVDVDIHRTFAYHPMFQE-GGHGAERTREVLHA  250
            T+ + N  GV    + +    CE ++     DI RTF  H +F E    G      VL A
Sbjct  143  TQMMINNPGVYHDFLQSKSVPCEETI---ARDIGRTFPKHYLFNERTSLGQCALMNVLKA  199

Query  251  YICYRPDLGYVQGLN  265
            Y  + P++GY QG+ 
Sbjct  200  YSLHDPEVGYCQGMG  214

>PYVX_18060
Length=948

 Score = 34.7 bits (78),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 16/23 (70%), Gaps = 0/23 (0%)

Query  243  RTREVLHAYICYRPDLGYVQGLN  265
            + R VL AY+ Y P +GY QG+N
Sbjct  758  KIRRVLRAYVMYNPRVGYCQGMN  780

>CCI43521
Length=472

 Score = 34.3 bits (77),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 40/81 (49%), Gaps = 13/81 (16%)

Query  222  VDIHRTFAYHPMFQEG--GHGAERTREVLHAYICYRPDLGYVQGLNCKDLTHPKFADSTL  279
            VDI RT A  P+F+     H  ER   +L+ +    P  GYVQG+N  DL  P      +
Sbjct  239  VDIPRTNADVPLFKNERIHHSMER---ILYIWAIRHPASGYVQGIN--DLLTPFL----V  289

Query  280  LFLTGMSYLAAAICLHMDTFP  300
            +FLT   ++   +   +D FP
Sbjct  290  VFLT--PFVDKPLYAALDDFP  308

>H310_05453
Length=751

 Score = 34.7 bits (78),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 40/81 (49%), Gaps = 18/81 (22%)

Query  185  EEIDMIRLPPPTETLQNLAGVAEKLVATCERSVWLVDVDIHRTFAYHPMFQEGGHGAERT  244
            EE D++++P   ET  ++A + E  +++  R V   + D           +   H     
Sbjct  522  EEWDLVQIP---ET--DVAAMVEHALSSPRRDVEQTEED-----------RNAMHAT--M  563

Query  245  REVLHAYICYRPDLGYVQGLN  265
            R +L AY+ + PD+GY QG+N
Sbjct  564  RRLLRAYVMFNPDIGYCQGMN  584

>PYIW_15759
Length=728

 Score = 34.7 bits (78),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 15/46 (33%), Positives = 24/46 (52%), Gaps = 0/46 (0%)

Query  220  VDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLN  265
            +D D+ RT +    F  GG   +    +L  +    P+LGY+QG+N
Sbjct  145  IDKDVSRTQSALSFFAIGGIAQQWMLRILFVFAKLHPELGYMQGMN  190

>H257_14341
Length=828

 Score = 34.7 bits (78),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 40/92 (43%), Gaps = 16/92 (17%)

Query  220  VDVDIHRTFAYHPMFQEGGHGAE--RTREVLHAYICYRPDLGYVQGLN-CKDLTHPKFAD  276
            VD DI RT        +  H A+    R VL A+ C  P +GY QG+N    +   +  D
Sbjct  355  VDADIPRT-------SQAPHAAQWPALRHVLVAFACRHPHIGYCQGMNELAAVLLREVGD  407

Query  277  STLLFLTGMSYLAAAICLHMDTFPAFKALSAL  308
               + L  ++YL   +      FP + + S L
Sbjct  408  DVAVALEALAYLVDEV------FPHYHSPSLL  433

>H257_04622
Length=512

 Score = 34.3 bits (77),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 16/46 (35%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query  220  VDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLN  265
            +D D+ RT+  H  FQ+   G +    VL AY  +  ++GY Q +N
Sbjct  252  IDKDVGRTYPEHAYFQQ-AKGRQELTNVLVAYSIHNTEVGYCQSMN  296

>PYIW_13127
Length=1287

 Score = 34.3 bits (77),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 2/72 (3%)

Query  193   PPPTETLQNLAGVAEKLVATCERSVWLVDVDIHRTFAYHPMFQEGGHGAERTREVLHAYI  252
             P   + +Q +AG+   +    ER+   + VD+ RTFA +  +     G +    VL AY 
Sbjct  1010  PDLPDQIQQVAGI--PVCTQFERAEKQIQVDLQRTFAANQCWINSPQGQKSLARVLLAYA  1067

Query  253   CYRPDLGYVQGL  264
              +   LGY Q +
Sbjct  1068  VHNQSLGYCQSM  1079

>PYIW_16979
Length=1049

 Score = 34.3 bits (77),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 40/82 (49%), Gaps = 19/82 (23%)

Query  133  LQKEVDAIMKLSAGLSALATQSTDFSEDEADDTKASSSTTRLSTPCLTASENEEIDMIRL  192
            L+ + D  MK++AG +ALA+ +    E E              TP   A+ N +++M++L
Sbjct  307  LKNDADVNMKIAAGDTALASVNEKVVEGE--------------TPLFAAARNHDVNMVQL  352

Query  193  PPPTETLQNLAGVAEKLVATCE  214
                  L N A V E+ ++T E
Sbjct  353  -----LLNNGASVNERNISTGE  369

>PYU1_G005666
Length=338

 Score = 33.9 bits (76),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 35/75 (47%), Gaps = 8/75 (11%)

Query  196  TETLQNLAGVAEKLV----ATCERSVWLVDVDIHRTFAYHPMFQE-GGHGAERTREVLHA  250
            T+ + N  GV  + +    A CE ++     DI RTF  H +F E    G      VL  
Sbjct  141  TQMVINNPGVYHEFLQSKHAPCEETI---ARDIGRTFPKHYLFNERTSLGQCALMNVLKV  197

Query  251  YICYRPDLGYVQGLN  265
            Y  + P++GY QG+ 
Sbjct  198  YSLHDPEVGYCQGMG  212

>PYIR_21788
Length=631

 Score = 33.9 bits (76),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 31/130 (24%), Positives = 54/130 (42%), Gaps = 13/130 (10%)

Query  223  DIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLNCKDLTHPKFADSTLLFL  282
            D+ RTF     F E   G  +   VL A   +  D+ Y QG+N        +  +TLL +
Sbjct  120  DVERTFPTQAFFSEDSDGRRQLGNVLKATAYHAKDVAYCQGMN--------YVAATLLLM  171

Query  283  TGMSYL-----AAAICLHMDTFPAFKALSALMSTNLLFDMFRLQERRRASVRYITDRRLK  337
               + L      +A C       AF  L AL+    + D++R +    +   Y+ ++ L+
Sbjct  172  LNENSLESQEEESAACDGSPEETAFWILYALIHNLGMADVWRSKMPGLSRCIYLYNQLLQ  231

Query  338  YFCNEFHTKM  347
               N+ +  +
Sbjct  232  VHFNDLYVHL  241

>PYU1_G004045
Length=380

 Score = 33.9 bits (76),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 16/23 (70%), Gaps = 0/23 (0%)

Query  243  RTREVLHAYICYRPDLGYVQGLN  265
            + R +L AY+ Y P +GY QG+N
Sbjct  190  KIRRILRAYVTYNPRVGYCQGMN  212

>PHYRA_74066
Length=354

 Score = 33.5 bits (75),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 24/46 (52%), Gaps = 0/46 (0%)

Query  220  VDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLN  265
            ++ D+ RT +    F  G    ++   +L  +    PD+GYVQG+N
Sbjct  122  IEKDVFRTRSELAFFSSGSIAMQQMLYILFVFAKLHPDVGYVQGMN  167

>H310_05008
Length=1001

 Score = 33.5 bits (75),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 16/24 (67%), Gaps = 0/24 (0%)

Query  242  ERTREVLHAYICYRPDLGYVQGLN  265
            E+ R VL AY  + P LGY QGLN
Sbjct  297  EKLRRVLVAYAVHNPKLGYCQGLN  320

>SDRG_01249
Length=967

 Score = 33.5 bits (75),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 26/51 (51%), Gaps = 3/51 (6%)

Query  216  SVWLVDVDIHRTFAYH-PMFQEGGHGAERTREVLHAYICYRPDLGYVQGLN  265
            +V  +D D+ RT A   P F      A   R VL AY  + P LGY QGLN
Sbjct  277  AVRQIDADVDRTVAPDDPDFSPDLVDA--LRNVLVAYAAHNPTLGYCQGLN  325

>H310_00656
Length=553

 Score = 33.1 bits (74),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 17/46 (37%), Positives = 24/46 (52%), Gaps = 1/46 (2%)

Query  220  VDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLN  265
            +D D+ RT+  H  FQE   G +    VL AY  +   +GY Q +N
Sbjct  266  IDKDVGRTYPEHAYFQE-TKGKQELTNVLVAYSMHNTAVGYCQSMN  310

>PHYKE_4935
Length=293

 Score = 32.7 bits (73),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (52%), Gaps = 4/54 (7%)

Query  213  CERSVWLVDVDIHRTFAYHPMFQE-GGHGAERTREVLHAYICYRPDLGYVQGLN  265
            CE ++     DI RTF  H +F++    G      VL AY  + P++GY QG+ 
Sbjct  118  CEETI---ARDIGRTFPRHSLFRDRSSLGQCALMNVLKAYSLHDPEVGYCQGMG  168

>CCI47818
Length=678

 Score = 33.1 bits (74),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 39/84 (46%), Gaps = 12/84 (14%)

Query  220  VDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLN-CKDLTHPKFADST  278
            +++D++RTF+    F + G  A   R VL AY      +GY QGLN         F + T
Sbjct  393  IELDVNRTFSTRK-FMKKGQAA--LRRVLQAYSIRNVAIGYCQGLNFIVAFLLQDFEEET  449

Query  279  LLFLTGMSYLAAAICLHMDTFPAF  302
            +       +L A IC   D FP +
Sbjct  450  IF------WLLALIC--EDIFPRY  465

>PHALS_08442
Length=1349

 Score = 33.1 bits (74),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 3/70 (4%)

Query  199  LQNLAGVAEKLVA---TCERSVWLVDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYR  255
            ++   G  E+LV+       ++  +DVD++RT              +  R +L AY  + 
Sbjct  319  MRKQKGQYERLVSLELENTEAIRQIDVDVNRTIPEEDKELWTDEKLKMMRRILVAYSFHN  378

Query  256  PDLGYVQGLN  265
            P LGY QGLN
Sbjct  379  PGLGYCQGLN  388

>SDRG_10471
Length=937

 Score = 33.1 bits (74),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 3/47 (6%)

Query  219  LVDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLN  265
            L+  D+ RTFA  P  Q       R   +L A++ + P LGY Q +N
Sbjct  721  LIASDVQRTFADQPRMQSV---RPRLERLLLAFVAHAPSLGYCQSMN  764

>CCI11615
Length=476

 Score = 32.7 bits (73),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 31/74 (42%), Gaps = 8/74 (11%)

Query  200  QNLAGVAEKLVATCERSV-WL-------VDVDIHRTFAYHPMFQEGGHGAERTREVLHAY  251
            Q  A  A+      ERS+ WL       ++ D+ RTFA         H     R +L AY
Sbjct  113  QKKASAADSYGDLVERSLSWLSPRVVMEIEKDLPRTFAAELGNDNASHPMAELRRILQAY  172

Query  252  ICYRPDLGYVQGLN  265
                P +GY Q +N
Sbjct  173  SLRNPCVGYCQSMN  186

>PYAP_15380
Length=359

 Score = 32.3 bits (72),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 40/81 (49%), Gaps = 11/81 (14%)

Query  271  HPKFADSTLLFLTGMSYLAAAICLHMDTFPAF------KALSALMST-----NLLFDMFR  319
            +PKF  ST + L  +  + A++ L M + PAF      K+LS + S      +++FD++ 
Sbjct  36   YPKFNSSTAVVLGEVLKVLASVVLIMRSPPAFQDAPKDKSLSRVHSAGPSSWSVIFDVYE  95

Query  320  LQERRRASVRYITDRRLKYFC  340
            L      ++ YI    L+Y  
Sbjct  96   LARVSVPALLYIIQNNLQYIA  116

>PHYSO_509000
Length=840

 Score = 32.7 bits (73),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 15/23 (65%), Gaps = 0/23 (0%)

Query  243  RTREVLHAYICYRPDLGYVQGLN  265
            + R VL AY+ Y P +GY QG+ 
Sbjct  650  KIRRVLRAYVVYNPRVGYCQGMG  672

>PHALS_13792
Length=884

 Score = 32.7 bits (73),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 16/23 (70%), Gaps = 0/23 (0%)

Query  243  RTREVLHAYICYRPDLGYVQGLN  265
            + R VL AY+ Y P +GY QG++
Sbjct  694  KMRRVLRAYVVYNPRVGYCQGMS  716

>CCA20931
Length=682

 Score = 32.7 bits (73),  Expect = 5.2, Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 3/46 (7%)

Query  220  VDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRPDLGYVQGLN  265
            +++D++RTF+    F   G  A   R VL AY      +GY QGLN
Sbjct  397  IELDVNRTFSTKK-FMRNGRAA--LRRVLQAYSIRNVAIGYCQGLN  439

>PYAR_13649
Length=397

 Score = 32.3 bits (72),  Expect = 5.4, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 23/44 (52%), Gaps = 1/44 (2%)

Query  223  DIHRTFAYHPMFQE-GGHGAERTREVLHAYICYRPDLGYVQGLN  265
            DI RTF  H +F +    G      VL AY  + P++GY QG+ 
Sbjct  157  DIGRTFPKHYLFHDRASVGQCALMNVLKAYSLHDPEVGYCQGMG  200

>SDRG_03535
Length=697

 Score = 32.3 bits (72),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 20/70 (29%), Positives = 34/70 (49%), Gaps = 5/70 (7%)

Query  243  RTREVLHAYICYRPDLGYVQGLN--CKDLTHPKFADSTLLFLTGMSYLAAAICLHMDTFP  300
            + R +L AY+ + P +GY QG+N   + L     +D   +F T +  +  A  L+    P
Sbjct  504  QMRRLLRAYVVHNPRIGYCQGMNFIIRLLLETPSSDEASVFWTFVELIEGASSLYE---P  560

Query  301  AFKALSALMS  310
             F  L +L +
Sbjct  561  GFHVLQSLFT  570

>PYIR_19933
Length=819

 Score = 32.3 bits (72),  Expect = 6.2, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 15/23 (65%), Gaps = 0/23 (0%)

Query  243  RTREVLHAYICYRPDLGYVQGLN  265
            + R +L AY  Y P +GY QG+N
Sbjct  629  KIRRILRAYAMYNPRVGYCQGMN  651

>PYIR_13364
Length=566

 Score = 32.3 bits (72),  Expect = 6.3, Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 45/92 (49%), Gaps = 9/92 (10%)

Query  319  RLQERRRASVRYITDRRLKYFCNEFHTKMAKALLKVYERN----LLELDEAEMMRL-LHK  373
            + +ERRRA +  I   RLK    E   KMAKAL K+ ++     +LE       R+   +
Sbjct  307  QYKERRRAELENI---RLKLIL-EGQIKMAKALEKILKKRTSLRILESVRGSGKRVKCVR  362

Query  374  FPSDISADVLFTALGNVALSCEEINEILSSDG  405
             P D  A++    L  V  + EE++ +  ++G
Sbjct  363  RPGDGDAEIFRELLAGVEKTLEEVDAVFEANG  394

>PPTG_10785
Length=873

 Score = 32.3 bits (72),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 15/23 (65%), Gaps = 0/23 (0%)

Query  243  RTREVLHAYICYRPDLGYVQGLN  265
            + R VL AY+ Y P +GY QG+ 
Sbjct  683  KLRRVLRAYVVYNPRVGYCQGMG  705

>SPRG_00360
Length=698

 Score = 32.3 bits (72),  Expect = 6.6, Method: Compositional matrix adjust.
 Identities = 20/70 (29%), Positives = 34/70 (49%), Gaps = 5/70 (7%)

Query  243  RTREVLHAYICYRPDLGYVQGLN--CKDLTHPKFADSTLLFLTGMSYLAAAICLHMDTFP  300
            + R +L AY+ + P +GY QG+N   + L     +D   +F T +  +  A  L+    P
Sbjct  505  QMRRLLRAYVVHNPRVGYCQGMNFIIRLLLESPSSDEASVFWTFVQLIEGANSLYE---P  561

Query  301  AFKALSALMS  310
             F  L +L +
Sbjct  562  GFHVLQSLFT  571

>PYIW_15943
Length=935

 Score = 32.3 bits (72),  Expect = 6.7, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 15/23 (65%), Gaps = 0/23 (0%)

Query  243  RTREVLHAYICYRPDLGYVQGLN  265
            + R +L AY  Y P +GY QG+N
Sbjct  745  KIRRILRAYAMYNPRVGYCQGMN  767

>H257_12548
Length=978

 Score = 32.3 bits (72),  Expect = 7.0, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 17/25 (68%), Gaps = 0/25 (0%)

Query  241  AERTREVLHAYICYRPDLGYVQGLN  265
            +++ R VL AY  + P LGY QGLN
Sbjct  301  SDQLRRVLVAYAVHNPKLGYCQGLN  325

>H257_16356
Length=771

 Score = 32.3 bits (72),  Expect = 7.7, Method: Compositional matrix adjust.
 Identities = 10/21 (48%), Positives = 16/21 (76%), Gaps = 0/21 (0%)

Query  245  REVLHAYICYRPDLGYVQGLN  265
            R +L AY+ + P++GY QG+N
Sbjct  585  RRLLRAYVMFNPEIGYCQGMN  605

>CCI40974
Length=1997

 Score = 32.0 bits (71),  Expect = 8.8, Method: Compositional matrix adjust.
 Identities = 32/142 (23%), Positives = 60/142 (42%), Gaps = 21/142 (15%)

Query  197   ETLQNLAGVAEKLVATCERSVWLVDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRP  256
             ET Q       +L++  + S W++D+D+HR               ER        IC +P
Sbjct  1313  ETGQAQVDYLSRLLSEYDSSRWVIDLDMHRNVLQ--------TATERY------CICRQP  1358

Query  257   DLGYVQGLN-CKDLTHPKFADSTLLFLTGMSYLAAAICLHM----DTFPAFKALSALMST  311
               G++ G + C+D  H      +      + +     C  +     +   FK +++ M  
Sbjct  1359  YSGFMIGCDHCEDWFHDTCIGLSKERAEKIDHYTCPSCTILLELVQSLNQFKTMTSHMVL  1418

Query  312   NLLFDMFRLQERR--RASVRYI  331
             N   DMFR+Q+ +  +A++R +
Sbjct  1419  NGDTDMFRIQDEKQYKAALRKL  1440

>CCI50602
Length=1999

 Score = 32.0 bits (71),  Expect = 9.3, Method: Compositional matrix adjust.
 Identities = 32/142 (23%), Positives = 60/142 (42%), Gaps = 21/142 (15%)

Query  197   ETLQNLAGVAEKLVATCERSVWLVDVDIHRTFAYHPMFQEGGHGAERTREVLHAYICYRP  256
             ET Q       +L++  + S W++D+D+HR               ER        IC +P
Sbjct  1315  ETGQAQVDYLSRLLSEYDSSRWVIDLDMHRNVLQ--------TATERY------CICRQP  1360

Query  257   DLGYVQGLN-CKDLTHPKFADSTLLFLTGMSYLAAAICLHM----DTFPAFKALSALMST  311
               G++ G + C+D  H      +      + +     C  +     +   FK +++ M  
Sbjct  1361  YSGFMIGCDHCEDWFHDTCIGLSKERAEKIDHYTCPSCTILLELVQSLNQFKTMTSHMVL  1420

Query  312   NLLFDMFRLQERR--RASVRYI  331
             N   DMFR+Q+ +  +A++R +
Sbjct  1421  NGDTDMFRIQDEKQYKAALRKL  1442

>PITG_19764
Length=550

 Score = 32.0 bits (71),  Expect = 9.7, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 42/90 (47%), Gaps = 2/90 (2%)

Query  109  KLQINEELFIICKDRAEAVRSEIALQKEVDAIMKLSAGLSALATQSTDFSEDEADDTKAS  168
            KL  NEE  +   +  E      A   E D  +  S  ++ ++T +TDF ++EA DT+  
Sbjct  106  KLIQNEEKVVNDAEEHELPVQVEARDDEADTEVDESLDVAVVSTPNTDFGQNEAMDTEVE  165

Query  169  SSTTRLSTPCLTASENEEIDMIRLPPPTET  198
            S    L  P +    NE +  I LPPP  T
Sbjct  166  SPEM-LPPPQVQEEVNEAL-KIALPPPAPT  193

>SPRG_01072
Length=509

 Score = 31.6 bits (70),  Expect = 9.7, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 34/71 (48%), Gaps = 6/71 (8%)

Query  199  LQNLAGVAEKLVAT---CERSVWLVDVDIHRTFAYHPMFQEGGHG-AERTREVLHAYICY  254
            +Q   G   +L+AT      +V  +D D+ RT A  P   E      +  R VL AY  +
Sbjct  223  MQENPGHYSRLLATDPINAEAVRQIDADVDRTVA--PEDPEWSLDLVDALRNVLVAYAAH  280

Query  255  RPDLGYVQGLN  265
             P LGY QGLN
Sbjct  281  NPTLGYCQGLN  291

>PYU1_G011102
Length=595

 Score = 32.0 bits (71),  Expect = 9.7, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 15/20 (75%), Gaps = 0/20 (0%)

Query  246  EVLHAYICYRPDLGYVQGLN  265
            E+LHA  C  PD+GY QG++
Sbjct  347  EILHALSCRFPDVGYCQGMD  366

>H310_11906
Length=823

 Score = 32.0 bits (71),  Expect = 9.8, Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 9/48 (19%)

Query  220  VDVDIHRTFAYHPMFQEGGHGAE--RTREVLHAYICYRPDLGYVQGLN  265
            +D DI RT        +  H  +    R+VL A+ C  P +GY QG+N
Sbjct  347  IDADIART-------SQAPHETQWPMLRQVLVAFACENPHIGYCQGMN  387

Lambda      K        H        a         alpha
   0.320    0.133    0.395    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 30433678704

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40