Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
CCA2284415548127927912439e-174
CCI441121554812282805173e-64
PHALS_06475147592231171202e-06
PPTG_17130147593121171151e-05
PHYCA_556164147593011171071e-04
PHYRA_81093147592981171071e-04
PHYRA_810971119942391171052e-04
PHYSO_2932861475931883930.007
PITG_1845914759311101920.010
PYU1_G00173214759294117870.035
HYAP_071051475927183850.056
PYVX_191911475929682820.17
PPTG_161222346937074761.1
PYAR_1622312474111078742.3
CCI398984032655103714.7
PYU1_G01229512743348376689.6
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= CCA22844

Length=279
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

CCA22844                                                              483        9e-174
CCI44112                                                              203        3e-64 
PHALS_06475                                                           50.8       2e-06 
PPTG_17130                                                            48.9       1e-05 
PHYCA_556164                                                          45.8       1e-04 
PHYRA_81093                                                           45.8       1e-04 
PHYRA_81097                                                           45.1       2e-04 
PHYSO_293286                                                          40.4       0.007 
PITG_18459                                                            40.0       0.010 
PYU1_G001732                                                          38.1       0.035 
HYAP_07105                                                            37.4       0.056 
PYVX_19191                                                            36.2       0.17  
PPTG_16122                                                            33.9       1.1   
PYAR_16223                                                            33.1       2.3   
CCI39898                                                              32.0       4.7   
PYU1_G012295                                                          30.8       9.6   

>CCA22844
Length=279

 Score = 483 bits (1243),  Expect = 9e-174, Method: Compositional matrix adjust.
 Identities = 279/279 (100%), Positives = 279/279 (100%), Gaps = 0/279 (0%)

Query  1    MAKSASDASVFVAYQRQADSETSSNEEDNPSSTQskqkprkknrkkkgsersLLKELAMC  60
            MAKSASDASVFVAYQRQADSETSSNEEDNPSSTQSKQKPRKKNRKKKGSERSLLKELAMC
Sbjct  1    MAKSASDASVFVAYQRQADSETSSNEEDNPSSTQSKQKPRKKNRKKKGSERSLLKELAMC  60

Query  61   KIDKKKGGKNQNKATTVNSKPPKQPAVSTPVVTAEIVQSKQRDSHRNQVSELQSVVLMLF  120
            KIDKKKGGKNQNKATTVNSKPPKQPAVSTPVVTAEIVQSKQRDSHRNQVSELQSVVLMLF
Sbjct  61   KIDKKKGGKNQNKATTVNSKPPKQPAVSTPVVTAEIVQSKQRDSHRNQVSELQSVVLMLF  120

Query  121  PDRNCAVLCCLMNMKTKLTPAYQKTDNTKPAFTPTQGLEASSVSALMSELLLTKKQNAQL  180
            PDRNCAVLCCLMNMKTKLTPAYQKTDNTKPAFTPTQGLEASSVSALMSELLLTKKQNAQL
Sbjct  121  PDRNCAVLCCLMNMKTKLTPAYQKTDNTKPAFTPTQGLEASSVSALMSELLLTKKQNAQL  180

Query  181  LENQQRLIAANAKINDQYQQSQGIQKCEVGYLRVYIYNYVETIAQLRNELIFLHEVCMSS  240
            LENQQRLIAANAKINDQYQQSQGIQKCEVGYLRVYIYNYVETIAQLRNELIFLHEVCMSS
Sbjct  181  LENQQRLIAANAKINDQYQQSQGIQKCEVGYLRVYIYNYVETIAQLRNELIFLHEVCMSS  240

Query  241  QNEVsllkaaasisslPTHNANPHRESRKVGCRPPPGIL  279
            QNEVSLLKAAASISSLPTHNANPHRESRKVGCRPPPGIL
Sbjct  241  QNEVSLLKAAASISSLPTHNANPHRESRKVGCRPPPGIL  279

>CCI44112
Length=228

 Score = 203 bits (517),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 150/280 (54%), Positives = 180/280 (64%), Gaps = 53/280 (19%)

Query  1    MAKSASDASVFVAYQRQADSETSSNEEDNPSSTQskqkprkknrkkkgsersLLKELAMC  60
            M K+ SD+SVFVAYQRQA+S TSSNEE+NP  T+ K KPRKKNRKKK SE++LLKELAMC
Sbjct  1    MTKTLSDSSVFVAYQRQAESGTSSNEEENPVHTKLKPKPRKKNRKKKASEKTLLKELAMC  60

Query  61   KIDKKKGGKNQNKATTVNSKPPKQP-AVSTPVVTAEIVQSKQRDSHRNQVSELQSVVLML  119
            K+D KKG KN     T   KP K+P A +    TA+ +  K +DSHR             
Sbjct  61   KMDNKKGTKN-----TAVRKPSKEPDATNVTANTADYIAPKIQDSHR-------------  102

Query  120  FPDRNCAVLCCLMNMKTKLTPAYQKTDNTKPAFTPTQGLEASSVSALMSELLLTKKQNAQ  179
                          ++ K+  ++ K + T+ A +P Q LEASSVSA MSELLLTKKQNAQ
Sbjct  103  --------------IQAKMATSFAKAEKTELAPSPPQDLEASSVSAHMSELLLTKKQNAQ  148

Query  180  LLENQQRLIAANAKINDQYQQSQGIQKCEVGYLRVYIYNYVETIAQLRNELIFLHEVCMS  239
            LLENQQ LI ANAKIN+QY+QSQ                  ETIA LR+ELIFL ++C+S
Sbjct  149  LLENQQILIEANAKINEQYRQSQ------------------ETIANLRDELIFLRQMCLS  190

Query  240  SQNEVsllkaaasisslPTHNANPHRESRKVGCRPPPGIL  279
            SQNEVSLLKAA+S  S    N + H  SRK+ CRPPPGIL
Sbjct  191  SQNEVSLLKAASSTPS--VTNTDSHGNSRKIPCRPPPGIL  228

>PHALS_06475
Length=223

 Score = 50.8 bits (120),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 61/117 (52%), Gaps = 22/117 (19%)

Query  162  SVSALMSELLLTKKQNAQLLENQQRLIAANAKINDQYQQSQGIQKCEVGYLRVYIYNYVE  221
            SV+ +M +LL   +QN QLL  Q++L  AN  + DQ Q+S                   E
Sbjct  128  SVTEVMDQLLRYTQQNTQLLAVQEQLGHANRNLQDQLQRS------------------AE  169

Query  222  TIAQLRNELIFLHEVCMSSQNEVsllkaaasisslPTHNANPHRESRKVGCRPPPGI  278
             I+ L+NE+    ++C++ Q EVSLL++  ++   P  ++NP  +      RPPPG+
Sbjct  170  IISGLQNEVTIFRQMCLNLQAEVSLLRSNTAVQIAPDASSNPQLQYH----RPPPGM  222

>PPTG_17130
Length=312

 Score = 48.9 bits (115),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 62/117 (53%), Gaps = 21/117 (18%)

Query  162  SVSALMSELLLTKKQNAQLLENQQRLIAANAKINDQYQQSQGIQKCEVGYLRVYIYNYVE  221
            +V+ +M +LL   +QNAQLL  Q++L  AN  + DQ Q+S                   E
Sbjct  216  AVTEVMDQLLRYTQQNAQLLMVQEQLGHANRNLQDQLQRS------------------AE  257

Query  222  TIAQLRNELIFLHEVCMSSQNEVsllkaaasisslPTHNANPHRESRKVGCRPPPGI  278
             I  L+NE+    ++C++ Q EVSLL+++ ++S+ P    NP  +      RPPPG+
Sbjct  258  IINGLQNEVTMFRQMCLNLQAEVSLLRSSTTVSTTPDAGNNPQPQHHH---RPPPGM  311

>PHYCA_556164
Length=301

 Score = 45.8 bits (107),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 56/117 (48%), Gaps = 24/117 (21%)

Query  162  SVSALMSELLLTKKQNAQLLENQQRLIAANAKINDQYQQSQGIQKCEVGYLRVYIYNYVE  221
            +V+ +M +LL   +QNAQLL  Q++L  AN  + DQ Q+S                   E
Sbjct  208  AVTEVMDQLLRYTQQNAQLLMVQEQLGHANRNLQDQLQRS------------------AE  249

Query  222  TIAQLRNELIFLHEVCMSSQNEVsllkaaasisslPTHNANPHRESRKVGCRPPPGI  278
             I  L+NE+    ++C++ Q EV       S ++ P   +NP  +      RPPPG+
Sbjct  250  MINGLQNEVTMFRQMCLNLQAEV---SLLRSSTTAPDAGSNPQPQHHH---RPPPGM  300

>PHYRA_81093
Length=298

 Score = 45.8 bits (107),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 55/117 (47%), Gaps = 30/117 (26%)

Query  162  SVSALMSELLLTKKQNAQLLENQQRLIAANAKINDQYQQSQGIQKCEVGYLRVYIYNYVE  221
            +V+ +M +LLL+ +QN+QLL  Q +L  AN  + DQ Q+S                   E
Sbjct  211  AVTEVMDQLLLSTQQNSQLLMVQDQLGHANRNLQDQLQRSG------------------E  252

Query  222  TIAQLRNELIFLHEVCMSSQNEVsllkaaasisslPTHNANPHRESRKVGCRPPPGI  278
             I  L+NE+    ++C++ Q EV    +    S+ P    N H        RPPPG+
Sbjct  253  IINGLQNEVAMFRQMCLNLQAEV----SLLRSSAGPDVGGNHH--------RPPPGM  297

>PHYRA_81097
Length=239

 Score = 45.1 bits (105),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 55/117 (47%), Gaps = 30/117 (26%)

Query  162  SVSALMSELLLTKKQNAQLLENQQRLIAANAKINDQYQQSQGIQKCEVGYLRVYIYNYVE  221
            +V+ +M +LLL+ +QN+QLL  Q +L  AN  + DQ Q+S                   E
Sbjct  152  AVTEVMDQLLLSTQQNSQLLMVQDQLGHANRNLQDQLQRSG------------------E  193

Query  222  TIAQLRNELIFLHEVCMSSQNEVsllkaaasisslPTHNANPHRESRKVGCRPPPGI  278
             I  L+NE+    ++C++ Q EV    +    S+ P    N H        RPPPG+
Sbjct  194  IINGLQNEVAMFRQMCLNLQAEV----SLLRSSAGPDVGGNHH--------RPPPGM  238

>PHYSO_293286
Length=318

 Score = 40.4 bits (93),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 42/83 (51%), Gaps = 18/83 (22%)

Query  162  SVSALMSELLLTKKQNAQLLENQQRLIAANAKINDQYQQSQGIQKCEVGYLRVYIYNYVE  221
            +V+ +M +LL   +QNAQLL  Q++L  AN  + DQ Q+S                   E
Sbjct  221  AVTEVMDQLLRYTQQNAQLLMVQEQLGHANRSLQDQLQRS------------------AE  262

Query  222  TIAQLRNELIFLHEVCMSSQNEV  244
             I  L+NE+    ++C++ Q EV
Sbjct  263  IINGLQNEVTMFRQMCLNLQAEV  285

>PITG_18459
Length=311

 Score = 40.0 bits (92),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 54/101 (53%), Gaps = 18/101 (18%)

Query  162  SVSALMSELLLTKKQNAQLLENQQRLIAANAKINDQYQQSQGIQKCEVGYLRVYIYNYVE  221
            +V+ +M +LL   +QNAQLL  Q++L  AN  + DQ Q S                   E
Sbjct  216  AVTEVMDQLLRYTQQNAQLLMVQEQLGHANRNLQDQLQSS------------------AE  257

Query  222  TIAQLRNELIFLHEVCMSSQNEVsllkaaasisslPTHNAN  262
             I  L+NE+    ++C++ Q EVSLL+++ ++S+ P   +N
Sbjct  258  IINGLQNEVTMFRQMCLNLQAEVSLLRSSTTVSTAPDAGSN  298

>PYU1_G001732
Length=294

 Score = 38.1 bits (87),  Expect = 0.035, Method: Compositional matrix adjust.
 Identities = 30/117 (26%), Positives = 58/117 (50%), Gaps = 21/117 (18%)

Query  162  SVSALMSELLLTKKQNAQLLENQQRLIAANAKINDQYQQSQGIQKCEVGYLRVYIYNYVE  221
            +VS +M +L L   QN QL   Q++L  AN ++ ++ Q+                    E
Sbjct  199  AVSEMMDQLYLFGHQNTQLRIVQEQLTVANHQMQERLQRD------------------AE  240

Query  222  TIAQLRNELIFLHEVCMSSQNEVsllkaaasisslPTHNANPHRESRKVGCRPPPGI  278
             I  L+NE+    ++C++ Q EVS+ +++++ +     +++   +  K   RPPPG+
Sbjct  241  IINSLQNEVTMFRQMCLNLQAEVSMYRSSSTGAQSSLSSSD---DINKTAHRPPPGM  294

>HYAP_07105
Length=271

 Score = 37.4 bits (85),  Expect = 0.056, Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 41/83 (49%), Gaps = 18/83 (22%)

Query  162  SVSALMSELLLTKKQNAQLLENQQRLIAANAKINDQYQQSQGIQKCEVGYLRVYIYNYVE  221
            +V+ +M +LL   +QN+QLL  Q++L  AN  + DQ Q+                    E
Sbjct  204  AVTEVMDQLLRYTQQNSQLLLVQEQLGHANRSLQDQLQRRD------------------E  245

Query  222  TIAQLRNELIFLHEVCMSSQNEV  244
             I  L+NE+    ++C++ Q EV
Sbjct  246  IITGLQNEVTMFRQMCLNLQAEV  268

>PYVX_19191
Length=296

 Score = 36.2 bits (82),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 39/82 (48%), Gaps = 18/82 (22%)

Query  162  SVSALMSELLLTKKQNAQLLENQQRLIAANAKINDQYQQSQGIQKCEVGYLRVYIYNYVE  221
            +VS +M +LL   +QNA LL  Q+++  AN  + +Q Q+                    E
Sbjct  233  AVSEVMDQLLRFGQQNAHLLGLQEQMARANHSLQEQLQRD------------------AE  274

Query  222  TIAQLRNELIFLHEVCMSSQNE  243
             I  L+NE+    ++C+S Q E
Sbjct  275  IIRGLQNEVTMFRQLCLSLQAE  296

>PPTG_16122
Length=370

 Score = 33.9 bits (76),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 37/74 (50%), Gaps = 0/74 (0%)

Query  162  SVSALMSELLLTKKQNAQLLENQQRLIAANAKINDQYQQSQGIQKCEVGYLRVYIYNYVE  221
            S+ A + +LLL+     +L  + ++LIAA   + + +        CE+G   V+ Y+ V 
Sbjct  212  SLPAGVGDLLLSHYIMERLGYSSKKLIAAAQSLQEVWDMGDVEDDCELGLSSVFAYSGVP  271

Query  222  TIAQLRNELIFLHE  235
            +  +   E I LH+
Sbjct  272  SAIEPTVEEIQLHD  285

>PYAR_16223
Length=1110

 Score = 33.1 bits (74),  Expect = 2.3, Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 4/78 (5%)

Query  82   PKQPAVSTPVVTAEIVQSKQRDSHRNQVSELQSVVLMLFPDRNCAVLCCLMNMKTKLTPA  141
            P  P+  T +     V+ +QRD +  +V+    V+L L  D  C V C + +   KLT  
Sbjct  474  PSLPSWPTVLRKGMQVRVRQRDKNSGRVTWHDGVILRLKKDAMCVVECSVDDATKKLT--  531

Query  142  YQKTDNTKPAFT-PTQGL  158
              K  + +P F+ P  G+
Sbjct  532  -VKNGDVRPKFSMPFAGI  548

>CCI39898
Length=655

 Score = 32.0 bits (71),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 51/103 (50%), Gaps = 11/103 (11%)

Query  139  TPAYQKTDNTKPAFTPTQGLEASSVSALMSELLLTK---KQNAQLLENQQRLIAANAKIN  195
            TP+    DN   AF PT   + +  S +++E LL +   K NA + + +Q ++ +N    
Sbjct  420  TPSVVPMDNVAAAFMPTGKCQPAPTSPIVTEDLLYENYNKTNAAVSQVEQSIMLSN----  475

Query  196  DQYQQSQGIQKCEVGYLRVYIYNYVETIAQLRNELIFLHEVCM  238
               QQ   + +C + + +  +  + +T  +LR  LI   ++C+
Sbjct  476  ---QQIMKLSRCNILHAQQLMKQFKQTQRKLR-VLIMSRDICV  514

>PYU1_G012295
Length=483

 Score = 30.8 bits (68),  Expect = 9.6, Method: Compositional matrix adjust.
 Identities = 22/76 (29%), Positives = 36/76 (47%), Gaps = 6/76 (8%)

Query  53   LLKELAMCKIDKKKGGKNQNKATTVNSK---PPKQPAVSTPVVTAEIVQSKQRDSHRNQV  109
            +LKEL+  +I   K G    +   + ++   P      S PVV  E++  KQ+ + + QV
Sbjct  366  MLKELSSIEI---KSGDYMIQVHVIEARDLVPKDSTGTSDPVVYVEVLSEKQQTATKKQV  422

Query  110  SELQSVVLMLFPDRNC  125
                   L++FP RN 
Sbjct  423  LNCVWDDLLIFPMRNL  438

Lambda      K        H        a         alpha
   0.312    0.125    0.346    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 16358635755

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40