Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
CCA228431475858658630450.0
CCI441111475857657820120.0
PYIR_13418147587475399809e-123
PYU1_G001733147587325529623e-120
PYIW_19969147587335309414e-117
PITG_18458147587475328805e-108
PPTG_17129147587455368711e-106
PHYCA_511415147587445428683e-106
PHYKE_83951475814205418925e-105
PHYSO_348903147587665938442e-102
PYAP_17763147587945388435e-102
PHYRA_81098147587415368256e-100
PHALS_06476147587264988193e-99
HYAP_07104147587215348053e-97
PYAR_13571147586665157613e-91
PYVX_23590147586895296374e-73
SPRG_06355147587135725651e-62
SDRG_01763147587365775492e-60
SPRG_126211382110033511998e-15
SDRG_045751382110033121731e-11
H310_082921382110074331595e-10
H257_0193413355510222981533e-09
H257_117731382110263501514e-09
PHYSO_4705331382110844221481e-08
PYIR_141071382111763491434e-08
PYU1_G002110138219993901391e-07
PYAP_222301382111164181354e-07
PPTG_113651382111063391273e-06
PITG_172501382110464061265e-06
PYVX_215131382114463491257e-06
PPTG_036021911538242800.83
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= CCA22843

Length=586
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

CCA22843                                                              1177       0.0   
CCI44111                                                              779        0.0   
PYIR_13418                                                            382        9e-123
PYU1_G001733                                                          375        3e-120
PYIW_19969                                                            367        4e-117
PITG_18458                                                            343        5e-108
PPTG_17129                                                            340        1e-106
PHYCA_511415                                                          338        3e-106
PHYKE_8395                                                            348        5e-105
PHYSO_348903                                                          329        2e-102
PYAP_17763                                                            329        5e-102
PHYRA_81098                                                           322        6e-100
PHALS_06476                                                           320        3e-99 
HYAP_07104                                                            314        3e-97 
PYAR_13571                                                            297        3e-91 
PYVX_23590                                                            249        4e-73 
SPRG_06355                                                            222        1e-62 
SDRG_01763                                                            216        2e-60 
SPRG_12621                                                            81.3       8e-15 
SDRG_04575                                                            71.2       1e-11 
H310_08292                                                            65.9       5e-10 
H257_01934                                                            63.5       3e-09 
H257_11773                                                            62.8       4e-09 
PHYSO_470533                                                          61.6       1e-08 
PYIR_14107                                                            59.7       4e-08 
PYU1_G002110                                                          58.2       1e-07 
PYAP_22230                                                            56.6       4e-07 
PPTG_11365                                                            53.5       3e-06 
PITG_17250                                                            53.1       5e-06 
PYVX_21513                                                            52.8       7e-06 
PPTG_03602                                                            35.4       0.83  

>CCA22843
Length=586

 Score = 1177 bits (3045),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 586/586 (100%), Positives = 586/586 (100%), Gaps = 0/586 (0%)

Query  1    MRSQCDTSMSLPSEVDDAIDDSFYSYNPAIDDCVQSGTVRRSYRKIKLERTESESTKNQF  60
            MRSQCDTSMSLPSEVDDAIDDSFYSYNPAIDDCVQSGTVRRSYRKIKLERTESESTKNQF
Sbjct  1    MRSQCDTSMSLPSEVDDAIDDSFYSYNPAIDDCVQSGTVRRSYRKIKLERTESESTKNQF  60

Query  61   EAVRNEIQDMRNEIQSVRQELLEAIQSTRYDLVKEIIALQGKVTGIGNGLTKIDVKSSPT  120
            EAVRNEIQDMRNEIQSVRQELLEAIQSTRYDLVKEIIALQGKVTGIGNGLTKIDVKSSPT
Sbjct  61   EAVRNEIQDMRNEIQSVRQELLEAIQSTRYDLVKEIIALQGKVTGIGNGLTKIDVKSSPT  120

Query  121  GTNENHTTANKTAFSESAEDDEIISRFITPERSTIVADCSYKSGFVTERLNTKDSSFSTS  180
            GTNENHTTANKTAFSESAEDDEIISRFITPERSTIVADCSYKSGFVTERLNTKDSSFSTS
Sbjct  121  GTNENHTTANKTAFSESAEDDEIISRFITPERSTIVADCSYKSGFVTERLNTKDSSFSTS  180

Query  181  VPLDESQLSKPLDKDEFDEMFPCIDCFSDLKSNALKLARGTRVWALDRVKEWIESNFKSE  240
            VPLDESQLSKPLDKDEFDEMFPCIDCFSDLKSNALKLARGTRVWALDRVKEWIESNFKSE
Sbjct  181  VPLDESQLSKPLDKDEFDEMFPCIDCFSDLKSNALKLARGTRVWALDRVKEWIESNFKSE  240

Query  241  NDHILTIIGEGGSGKSTLAGYICQKFDAKLHAYHFCQFdrksrsssrdvvlslvsQFASK  300
            NDHILTIIGEGGSGKSTLAGYICQKFDAKLHAYHFCQFDRKSRSSSRDVVLSLVSQFASK
Sbjct  241  NDHILTIIGEGGSGKSTLAGYICQKFDAKLHAYHFCQFDRKSRSSSRDVVLSLVSQFASK  300

Query  301  NPLYKRQLTCLNLRYILKESNPLVMANKLLIEPLRAIPVSNSTRGFVLFDGIDQCLVENE  360
            NPLYKRQLTCLNLRYILKESNPLVMANKLLIEPLRAIPVSNSTRGFVLFDGIDQCLVENE
Sbjct  301  NPLYKRQLTCLNLRYILKESNPLVMANKLLIEPLRAIPVSNSTRGFVLFDGIDQCLVENE  360

Query  361  SNDLLDLISHITQRFPSCIGFVVTSKASPAFDAKFKSKSIIHLHERNGKFMNDSRILMEN  420
            SNDLLDLISHITQRFPSCIGFVVTSKASPAFDAKFKSKSIIHLHERNGKFMNDSRILMEN
Sbjct  361  SNDLLDLISHITQRFPSCIGFVVTSKASPAFDAKFKSKSIIHLHERNGKFMNDSRILMEN  420

Query  421  SILNFEPKHTNEACDILMRKSGGNGLYLQFTERALSHPILHGERTFLSLDVLDELPDSVD  480
            SILNFEPKHTNEACDILMRKSGGNGLYLQFTERALSHPILHGERTFLSLDVLDELPDSVD
Sbjct  421  SILNFEPKHTNEACDILMRKSGGNGLYLQFTERALSHPILHGERTFLSLDVLDELPDSVD  480

Query  481  DIFFTIFEDKFGQGHQRVWKNVKPILEAIVAAAAGSHPLVGERQIKQRFQLGKEEWRMMK  540
            DIFFTIFEDKFGQGHQRVWKNVKPILEAIVAAAAGSHPLVGERQIKQRFQLGKEEWRMMK
Sbjct  481  DIFFTIFEDKFGQGHQRVWKNVKPILEAIVAAAAGSHPLVGERQIKQRFQLGKEEWRMMK  540

Query  541  RSFTDIICCGTEGYRIITSSLFAWLIVENRSQHFYIDPKAGIKFLL  586
            RSFTDIICCGTEGYRIITSSLFAWLIVENRSQHFYIDPKAGIKFLL
Sbjct  541  RSFTDIICCGTEGYRIITSSLFAWLIVENRSQHFYIDPKAGIKFLL  586

>CCI44111
Length=576

 Score = 779 bits (2012),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/578 (68%), Positives = 472/578 (82%), Gaps = 4/578 (1%)

Query  9    MSLPSEVDDAIDDSFYSYNPAIDDC-VQSGTVRRSYRKIKLERTESESTKNQFEAVRNEI  67
            MSLPSE DD   D  +S+NP  D+  +QSG+V +S+RK + ERTESEST+ Q EA R+EI
Sbjct  1    MSLPSEADDDFADDVHSFNPVSDESSLQSGSVHKSHRKFRPERTESESTQKQIEAFRDEI  60

Query  68   QDMRNEIQSVRQELLEAIQSTRYDLVKEIIALQGKVTGIGNGLTKIDVKSSPTGTNENHT  127
            + MR EIQ+VRQEL+EAIQ TRYD++KEI+ L+G+V  +     KID   +      NHT
Sbjct  61   KGMRKEIQNVRQELIEAIQCTRYDILKEIVTLKGQVATMS---IKIDSPINAKINKLNHT  117

Query  128  TANKTAFSESAEDDEIISRFITPERSTIVADCSYKSGFVTERLNTKDSSFSTSVPLDESQ  187
            TAN +A SE A+D+EI+S F+TP+RST+++DCS+ +  V++    ++S   T + +DE+ 
Sbjct  118  TANGSACSEGADDNEILSNFVTPDRSTVLSDCSHITRLVSQSSILRESGLPTLMTMDEAN  177

Query  188  LSKPLDKDEFDEMFPCIDCFSDLKSNALKLARGTRVWALDRVKEWIESNFKSENDHILTI  247
            LSKPL KDE DEMFP IDC  D++SNALKLA GTR WALD + +WI+SNF++ N+ +LTI
Sbjct  178  LSKPLSKDEIDEMFPLIDCSGDVESNALKLASGTRGWALDHITKWIQSNFENGNERVLTI  237

Query  248  IGEGGSGKSTLAGYICQKFDAKLHAYHFCQFdrksrsssrdvvlslvsQFASKNPLYKRQ  307
            +GEGG+GKSTLAGY+CQKF A LHAYHF QFDRK  SSSRDVVLSLVSQFASK  LYKRQ
Sbjct  238  VGEGGAGKSTLAGYVCQKFAANLHAYHFFQFDRKLGSSSRDVVLSLVSQFASKLQLYKRQ  297

Query  308  LTCLNLRYILKESNPLVMANKLLIEPLRAIPVSNSTRGFVLFDGIDQCLVENESNDLLDL  367
            LT LNLRYIL ESNPLVMA KLLI+PLRAIP S+ST GFVLFDGIDQCLV+N+SNDLL+L
Sbjct  298  LTRLNLRYILAESNPLVMATKLLIDPLRAIPESDSTFGFVLFDGIDQCLVKNQSNDLLEL  357

Query  368  ISHITQRFPSCIGFVVTSKASPAFDAKFKSKSIIHLHERNGKFMNDSRILMENSILNFEP  427
            +SHIT+RFPS IGFVVTSKA PAF A+ K+ S+IHL   N  F+ DSRILMEN +L FEP
Sbjct  358  LSHITERFPSWIGFVVTSKAFPAFAARLKTNSVIHLDGSNVHFLQDSRILMENLLLYFEP  417

Query  428  KHTNEACDILMRKSGGNGLYLQFTERALSHPILHGERTFLSLDVLDELPDSVDDIFFTIF  487
            KHTNEACDILMRKSGGN LYLQF  RALSHPILHGE+TFLSLDVLDELP+SVD+I FTIF
Sbjct  418  KHTNEACDILMRKSGGNSLYLQFINRALSHPILHGEQTFLSLDVLDELPESVDEIIFTIF  477

Query  488  EDKFGQGHQRVWKNVKPILEAIVAAAAGSHPLVGERQIKQRFQLGKEEWRMMKRSFTDII  547
            +DKFGQGHQRVWKN KPILE IVAAAAG +PLVGE QIKQ+F+L + EWRM+ R+FTDII
Sbjct  478  DDKFGQGHQRVWKNAKPILEVIVAAAAGPYPLVGESQIKQQFELRENEWRMINRAFTDII  537

Query  548  CCGTEGYRIITSSLFAWLIVENRSQHFYIDPKAGIKFL  585
             CGT+GYRII SSL+ WL+VE RSQHF+++P+A  KFL
Sbjct  538  HCGTDGYRIINSSLYDWLVVEKRSQHFHLNPQAVFKFL  575

>PYIR_13418
Length=747

 Score = 382 bits (980),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 216/539 (40%), Positives = 328/539 (61%), Gaps = 26/539 (5%)

Query  58   NQFEAVRNEIQDMRNEIQSVRQELLEAIQSTRYDLVKEIIALQGKVTGIGNGLTKIDVKS  117
            N  +A+R E+ +M+ E+Q++R+E++  +  TRYD++KEI  L+G +  +   L    V+S
Sbjct  167  NPIDALRAELSEMKLEVQAIRREMMNEMHVTRYDVLKEITMLKGTIIQLVTALESKGVRS  226

Query  118  SPTGTNENHTTANKTAFSESAEDDEIISRFITPERSTIVADCSYKSGFVTERLNTKDSSF  177
                       A+  A    A+ +       T  R+T +    Y S    ER  T++ S 
Sbjct  227  ---------LDASGAAVGAEAQPELSSDELDTISRTTAL----YTSKATKERRATREDSA  273

Query  178  STSV----------PLDESQLSKPLDKDEFDEMFPCIDCFSDLKSNALKLARGTRVWALD  227
               V          P+ +  LS PL + + DEMFP ++C ++L++ A      +R WA++
Sbjct  274  PVLVRASSRLTQLAPVADDALSTPLLQHQIDEMFPLVECSTELQAFAQNYDPSSREWAIE  333

Query  228  RVKEWIESNFKSENDHILTIIGEGGSGKSTLAGYICQKFDAKLHAYHFCQFdrksrsssr  287
            R +EW++S F    D++L ++G+GGSGKSTL G +C KF   + A H C FDRKS+SS R
Sbjct  334  RFQEWVDSRFNVGVDNLLALVGDGGSGKSTLTGALCDKFHDNVVAMHLCVFDRKSKSSPR  393

Query  288  dvvlslvsQFASKNPLYKRQLTCLNLRYILKESNPLVMANKLLIEPLRAIPVSNSTRGFV  347
            +V+LSLV+Q  S  PL+K QL  LNL+Y+L+E++PLV+A K+L++PL A+    + + FV
Sbjct  394  NVLLSLVNQLISNLPLFKNQLARLNLKYVLEETDPLVLARKVLVDPLCALEEPLTAKVFV  453

Query  348  LFDGIDQCLVENESNDLLDLISHITQRFPSCIGFVVTSKASPAFDAKFKSKSIIHLHERN  407
             FDGIDQC  +   NDLLD ++ I    P+ +G  +TSK SP   AK    S++    +N
Sbjct  454  -FDGIDQCKSKGR-NDLLDFLAVIIPELPTWVGVFITSKPSPELPAKLAITSLLDFSAKN  511

Query  408  GKFMNDSRILMENSILNFEPKHTNEACDILMRKSGGNGLYLQFTERALSHPILHGERTFL  467
              +MND+ IL+ + I NF  K   +A +IL RKSGGN  +L FT++ALSHP +  +  ++
Sbjct  512  TNYMNDTIILINDIIGNFSDKDVPQAREILKRKSGGNFTFLDFTKQALSHPGMEEDNGYI  571

Query  468  SLDVLDELPDSVDDIFFTIFEDKFGQGHQRVWKNVKPILEAIVAAAAGSHPLVGERQIKQ  527
             LDVL +LP+S+ +I+  IFEDKFG+G  R+WK V+P+LE IV AA+G + L+ E Q ++
Sbjct  572  PLDVLHDLPESIYEIYEEIFEDKFGKGRSRIWKKVQPLLELIVTAASGPYALITENQAQE  631

Query  528  RFQLGKEEWRMMKRSFTDIICCGTEGYRIITSSLFAWLIVENRS-QHFYIDPKAGIKFL  585
            +F L KE+ R ++R+F DII      YRI TS+LF WL+   R+ + FY+D   G+  L
Sbjct  632  QFSLSKEDIRTIRRAFVDIIAVNHGTYRIETSALFEWLVDPQRAGEQFYVDVSGGMNLL  690

>PYU1_G001733
Length=732

 Score = 375 bits (962),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 209/552 (38%), Positives = 333/552 (60%), Gaps = 33/552 (6%)

Query  48   LERTESESTKNQFEAVRNEIQDMRNEIQSVRQELLEAIQSTRYDLVKEIIALQGKVTGIG  107
            +  T   +  ++ +A+R E+ +M+ E+Q++R+E++  +  TRYD++KEI  L+G +  + 
Sbjct  140  MRTTTGAAGGSEADALRAELVEMKQEMQTIRREMMNEMHVTRYDVLKEITMLKGTIIQLV  199

Query  108  NGLTKIDVKSSPTG-----------TNENHTTANKTAFSESAEDDEIISRFITPERSTIV  156
              L    V++   G              +  T      +  A  D + +R +T   + I 
Sbjct  200  AALESKGVRTLDAGGVAEPQPELSPAQLDTITRTTAVHTSKATKDRLAAREVTAIPTII-  258

Query  157  ADCSYKSGFVTERLNTKDSSFSTSVPLDESQLSKPLDKDEFDEMFPCIDCFSDLKSNALK  216
                             +S  +   P+ +  LS PL + + D+MFP +D  +DL+ +A K
Sbjct  259  --------------RGTNSRLTQLAPVADDALSTPLLQHQIDDMFPLVDFSADLQLHAQK  304

Query  217  LARGTRVWALDRVKEWIESNFKSENDHILTIIGEGGSGKSTLAGYICQKFDAKLHAYHFC  276
                +R WA +R ++W++S F    D++L ++G+GGSGKSTL G +C +F   + A H C
Sbjct  305  FDPTSREWAFERFQDWVDSRFNVGGDNLLALVGDGGSGKSTLVGALCDRFHDNIVALHLC  364

Query  277  QFdrksrsssrdvvlslvsQFASKNPLYKRQLTCLNLRYILKESNPLVMANKLLIEPLRA  336
            +FDRKS+SS R+V+LSLV+Q  +  PL+K QL  LNL+Y+L+E++PLV+A K+L++PL A
Sbjct  365  KFDRKSKSSPRNVLLSLVNQLIANLPLFKNQLARLNLKYVLEETDPLVLARKVLVDPLCA  424

Query  337  I--PVSNSTRGFVLFDGIDQCLVENESNDLLDLISHITQRFPSCIGFVVTSKASPAFDAK  394
            +  P+   T   +L DGIDQC    + NDLLD ++ I   FP+ +G  +TSK SP   AK
Sbjct  425  LEEPL---TAKVLLVDGIDQC-KSKDRNDLLDFLAAIIPEFPTWLGIFITSKPSPELPAK  480

Query  395  FKSKSIIHLHERNGKFMNDSRILMENSILNFEPKHTNEACDILMRKSGGNGLYLQFTERA  454
                S++    +N  +MND+ IL+ + I NF  K  +EA DIL RKSGGN  +L FT++A
Sbjct  481  LAITSLLDFSPKNANYMNDTIILINDIIGNFSDKDVSEARDILKRKSGGNFTFLDFTKQA  540

Query  455  LSHPILHGERTFLSLDVLDELPDSVDDIFFTIFEDKFGQGHQRVWKNVKPILEAIVAAAA  514
            LSHP +  E  ++ LDVL +LP+S+ +I+  IFEDKFG+GH R+WK V+P+L+ IV AA+
Sbjct  541  LSHPGMEEENGYVPLDVLHDLPESIYEIYDEIFEDKFGKGHNRLWKKVQPLLDLIVTAAS  600

Query  515  GSHPLVGERQIKQRFQLGKEEWRMMKRSFTDIICCGTEGYRIITSSLFAWLIVENRS-QH  573
            G + L+ E Q +++F L +++ RM++R+FTDII      YR+ TS+++ WL+   RS + 
Sbjct  601  GPYALITEEQAQEQFSLSRDDIRMIRRAFTDIIDVRHGTYRMETSAMYEWLVDPQRSGEQ  660

Query  574  FYIDPKAGIKFL  585
            FY++  A +  L
Sbjct  661  FYVNISASMDIL  672

>PYIW_19969
Length=733

 Score = 367 bits (941),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 212/530 (40%), Positives = 325/530 (61%), Gaps = 25/530 (5%)

Query  58   NQFEAVRNEIQDMRNEIQSVRQELLEAIQSTRYDLVKEIIALQGKVTGIGNGLTKIDVKS  117
            +Q +A+R E+ +M+ E+Q++R+E++  +  TRYD++KE+  L+G +  +   +T ++ K 
Sbjct  170  SQLDALRTELSEMKLEVQAIRREMMNEMHVTRYDVLKEVTMLKGTILQL---VTALETKG  226

Query  118  SPTGTNENHTTANKTA-FSESAEDDEIISRFITPERSTIVADCSYKSGFVTERLNTKDSS  176
                T+E +T +  TA F+  A  D   +R           D S     V        S 
Sbjct  227  --LSTDEINTISRTTALFTSKATKDRRATR-----------DESSSPMLVR-----ASSR  268

Query  177  FSTSVPLDESQLSKPLDKDEFDEMFPCIDCFSDLKSNALKLARGTRVWALDRVKEWIESN  236
             +   P+ +  LS PL + + DEMFP I+C  +L + +      +R WA++R +EWI+S 
Sbjct  269  LTQLAPVADEALSTPLLQHQIDEMFPLIECSDELVALSRTYDSSSREWAVERFQEWIDSR  328

Query  237  FKSENDHILTIIGEGGSGKSTLAGYICQKFDAKLHAYHFCQFdrksrsssrdvvlslvsQ  296
            F    D++L ++GEGGSGKSTLAG +  KF   + A H C FDRKS+SS R+V+LSLV+Q
Sbjct  329  FNVGVDNLLALVGEGGSGKSTLAGALSDKFHDNIVAIHLCTFDRKSKSSPRNVLLSLVNQ  388

Query  297  FASKNPLYKRQLTCLNLRYILKESNPLVMANKLLIEPLRAIPVSNSTRGFVLFDGIDQCL  356
              S  PL+K QL  LNL+Y+L+ES+P+V+A KLL++PL A+    + + F++ DG+DQC 
Sbjct  389  MISNLPLFKNQLARLNLKYVLEESDPVVLARKLLVDPLCALEEPMTAKVFMI-DGLDQCK  447

Query  357  VENESNDLLDLISHITQRFPSCIGFVVTSKASPAFDAKFKSKSIIHLHERNGKFMNDSRI  416
                 NDLLD ++ I    P+ IG  +TSK SP   A+    S++    +N  +MND+ I
Sbjct  448  SRGR-NDLLDFLAVIIPELPTWIGVFITSKPSPELPARLAISSLLDFSAKNTNYMNDTVI  506

Query  417  LMENSILNFEPKHTNEACDILMRKSGGNGLYLQFTERALSHPILHGERTFLSLDVLDELP  476
            ++ + I +F  K   +A +IL RKSGGN  +L FT++ALSHP +  +  ++ LDVL +LP
Sbjct  507  MINDIIGSFSDKDVPQAREILKRKSGGNFTFLDFTKQALSHPGMEEDNGYIPLDVLHDLP  566

Query  477  DSVDDIFFTIFEDKFGQGHQRVWKNVKPILEAIVAAAAGSHPLVGERQIKQRFQLGKEEW  536
            +S+ +I+  IFEDKFG+G  R+WK V+P+LE IV AA+G + L+ E Q +++F L KE+ 
Sbjct  567  ESIYEIYEEIFEDKFGKGRNRIWKKVQPLLELIVTAASGPYALITETQAQEQFALSKEDI  626

Query  537  RMMKRSFTDIICCGTEGYRIITSSLFAWLIVENRS-QHFYIDPKAGIKFL  585
            R ++RSF DII      YRI  S+LF WL+   R+ + FY+D   G+  L
Sbjct  627  RTIRRSFVDIIDVRHGTYRIENSALFEWLVDPQRAGEQFYVDVSGGMSAL  676

>PITG_18458
Length=747

 Score = 343 bits (880),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 199/532 (37%), Positives = 312/532 (59%), Gaps = 31/532 (6%)

Query  59   QFEAVRNEIQDMRNEIQSVRQELLEAIQSTRYDLVKEIIALQGKVTGIGNGLTKIDVKSS  118
            + E +R+E+ +++ E++++R+E++  +  TRYD++KE+  L+G +  +            
Sbjct  151  ELERLRSEVLEVKEEVKAIRREVMNELHVTRYDVLKELALLKGAIAQL------------  198

Query  119  PTGTNENHTTANKTAFSESAEDDEIISRFITPERSTIVADCSYKSGFVTERLN---TKDS  175
             T T      +  +  S S++      R     +++     + +      R N   T   
Sbjct  199  -TATQHIAPASVSSTESSSSDPLSPDERAALTRQTSTKTSQATRDRLAASRTNIHKTPPP  257

Query  176  SFSTSV------PLDESQLSKPLDKDEFDEMFPCIDCFSDLKSNALKLARGTRVWALDRV  229
            +   SV      P+ ++ LS PL+  + +EMFP ID  S+L ++A  L  GTR WAL RV
Sbjct  258  AARASVRLTQLAPVADNALSTPLNPQQINEMFPLIDSTSELAAHARGLTPGTRTWALTRV  317

Query  230  KEWIESNFKSENDHILTIIGEGGSGKSTLAGYICQKFDAKLHAYHFCQFdrksrsssrdv  289
            +EW+++ +   ND +L ++GEGG+GKST  G + Q+F   L A H CQFDRKS+SS R+V
Sbjct  318  EEWLDARYNLGNDTLLAVVGEGGTGKSTFCGTVAQQFRGNLLAAHCCQFDRKSKSSPRNV  377

Query  290  vlslvsQFASKNPLYKRQLTCLNLRYILKESNPLVMANKLLIEPLRAI--PVSNSTRGFV  347
            +LS+V Q     P +K QL  LNL+Y+L+E++P ++A K+L++PL A+  P+  +   F+
Sbjct  378  LLSMVHQLVDSLPSFKNQLARLNLKYVLEEADPFLLAGKVLVDPLNAVEEPMHAT---FI  434

Query  348  LFDGIDQCLV-ENESNDLLDLISHITQRFPSCIGFVVTSKASPAFDAKFKSKSIIHLHER  406
            L DGIDQC V  N  N+LL+L + +  + PS +GF+V+SK S     +    S++    +
Sbjct  435  LVDGIDQCAVGSNGRNELLELFAQVIPQLPSWVGFLVSSKPSSKLAKRLPVSSVLDFSAK  494

Query  407  NGKFMNDSRILMENSILNFEPKHTNEACDILMRKSGGNGLYLQFTERALSHPILHG--ER  464
            NG F+ D+  L+++   NF      EA  +L +KSGGN  YL+FT++ALSHP +    + 
Sbjct  495  NGAFVADASSLVDDIARNFSDDDAAEAKKVLKKKSGGNFAYLEFTKQALSHPGIAAASKE  554

Query  465  TFLSLDVLDELPDSVDDIFFTIFEDKFGQGHQRVWKNVKPILEAIVAAAAGSHPLVGERQ  524
              + L+VL ELP+++ DI+  IFEDKFGQG  RVW   KP+L+ +V AAAG +  V E Q
Sbjct  555  GAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAAAGPYSPVTEEQ  614

Query  525  IKQRFQLGKEEWRMMKRSFTDIICCGTEGYRIITSSLFAWLIVENRS-QHFY  575
             K+ F L  E+ RM++RSF D++      YRI +S+L AWL    RS + FY
Sbjct  615  AKEHFNLTTEDLRMLRRSFVDLVSVKHGSYRIESSALCAWLSDPARSEEQFY  666

>PPTG_17129
Length=745

 Score = 340 bits (871),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 200/536 (37%), Positives = 317/536 (59%), Gaps = 33/536 (6%)

Query  59   QFEAVRNEIQDMRNEIQSVRQELLEAIQSTRYDLVKEIIALQGKVTGIGNGLTKIDVKSS  118
            + E +R+E+ +++ E++++R+E++  +  TRYD++KE+  L+G +      LT     + 
Sbjct  155  ELERLRSEVLEVKEEVKAIRREVMNELHVTRYDVLKELALLKGAIAQ----LTATQHSAP  210

Query  119  PTGTNENHTTANKTAFSESAEDDEIISRFITPERSTIVADCSYKSGFVTERLN---TKDS  175
            P+ ++   ++++      SAE+   ++R  + + S    D          R N   T   
Sbjct  211  PSVSSTESSSSDPL----SAEERAALTRQTSTKTSQATRD-----RLAASRTNIHKTPPP  261

Query  176  SFSTSV------PLDESQLSKPLDKDEFDEMFPCIDCFSDLKSNALKLARGTRVWALDRV  229
            +   SV      P+ ++ LS PL   + +EMFP ID  S+L ++A  L  GTR WAL RV
Sbjct  262  AARASVRLTQLAPVADNALSTPLSPQQINEMFPLIDFTSELAAHARGLTPGTRTWALTRV  321

Query  230  KEWIESNFKSENDHILTIIGEGGSGKSTLAGYICQKFDAKLHAYHFCQFdrksrsssrdv  289
            +EW+++ F   ND +L ++GEGG+GKS   G + Q+F   L A H CQFDRKS+SS R+V
Sbjct  322  EEWLDARFNVGNDTLLAVVGEGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSSPRNV  381

Query  290  vlslvsQFASKNPLYKRQLTCLNLRYILKESNPLVMANKLLIEPLRAI--PVSNSTRGFV  347
            +LS+V Q     P +K QL  LNL+Y+L+E++P ++A K+L++PL A+  P+  +   F+
Sbjct  382  LLSMVHQLVDNLPSFKNQLARLNLKYVLEEADPFLLAGKVLVDPLNAMEEPMHAT---FM  438

Query  348  LFDGIDQCLVE-NESNDLLDLISHITQRFPSCIGFVVTSKASPAFDAKFKSKSIIHLHER  406
            L DGIDQC    N  N+LL+  + +  + PS +GF+++SK S     +    S++    +
Sbjct  439  LVDGIDQCAAGLNGRNELLEFFAQVIPQLPSWVGFLISSKPSSKLAKRLPVSSVLDFSAK  498

Query  407  NGKFMNDSRILMENSILNFEPKHTNEACDILMRKSGGNGLYLQFTERALSHPILHG--ER  464
            NG F+ D   ++++   NF    T EA  +L +KSGGN  YL+FT++ALSHP +    + 
Sbjct  499  NGAFVADVSSIVDDIARNFSDDDTAEAKKVLKKKSGGNFAYLEFTKQALSHPGMAAASKE  558

Query  465  TFLSLDVLDELPDSVDDIFFTIFEDKFGQGHQRVWKNVKPILEAIVAAAAGSHPLVGERQ  524
              + L+VL ELP+++ DI+  IFEDKFGQG  RVW   KP+L+ IV AAAG +  + E Q
Sbjct  559  GAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLIVGAAAGPYSPMTEEQ  618

Query  525  IKQRFQLGKEEWRMMKRSFTDIICCGTEGYRIITSSLFAWLIVENRSQ---HFYID  577
             K+ F+   E+ RM++RSF D++      YRI +S+L AWL    RS+   +F ID
Sbjct  619  AKEHFKFTAEDLRMLRRSFVDLVAVKHGAYRIESSALCAWLSDPARSEEQFYFSID  674

>PHYCA_511415
Length=744

 Score = 338 bits (868),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 203/542 (37%), Positives = 313/542 (58%), Gaps = 46/542 (8%)

Query  59   QFEAVRNEIQDMRNEIQSVRQELLEAIQSTRYDLVKEIIALQGKVTGIGNGLTKIDVKSS  118
            + E +R+E+ +++ E++++R+E++  +  TRYD++KE+  L+G +  +            
Sbjct  153  ELERLRSEVLEVKEEVKAIRREVMNELHVTRYDVLKELTLLKGAIAQL------------  200

Query  119  PTGTNENHTTANKTAFSESAEDDEIISRFITPERSTIVADCSYKSGFVTE------RLN-  171
               T   H++ + ++   S+ D          ER+ +    S K+   T       RLN 
Sbjct  201  ---TAAQHSSPSVSSTESSSSDP-----LSAEERAALTRQTSTKTSAATRDRLAASRLNV  252

Query  172  --TKDSSFSTSV------PLDESQLSKPLDKDEFDEMFPCIDCFSDLKSNALKLARGTRV  223
              T   +   SV      P+ ++ LS PL   + +EMFP ID  SDL ++A  L  G+R 
Sbjct  253  HKTPPPAARASVRLTQLAPVADNALSTPLSSQQINEMFPLIDFTSDLAAHARGLTPGSRT  312

Query  224  WALDRVKEWIESNFKSENDHILTIIGEGGSGKSTLAGYICQKFDAKLHAYHFCQFdrksr  283
            WAL RV+EW+++ F    D +L ++GEGG+GKS   G + Q+F   L A H CQFDRKS+
Sbjct  313  WALTRVEEWLDARFNVGTDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQFDRKSK  372

Query  284  sssrdvvlslvsQFASKNPLYKRQLTCLNLRYILKESNPLVMANKLLIEPLRAI--PVSN  341
            SS R+V+LS+V Q     PL+K QL  LNL+Y+L+E++P+++A K+L++PL A+  PV  
Sbjct  373  SSPRNVLLSMVHQLVDNLPLFKNQLARLNLKYVLEEADPILLAGKVLVDPLNAMEEPVHA  432

Query  342  STRGFVLFDGIDQCLV-ENESNDLLDLISHITQRFPSCIGFVVTSKASPAFDAKFKSKSI  400
            +   F+L DGIDQC    N  N+LL   + +  + PS IGF+++SK S     +    S+
Sbjct  433  T---FMLVDGIDQCSAGPNGRNELLQFFAQVIPQLPSWIGFLMSSKPSSKLAKRLPVSSV  489

Query  401  IHLHERNGKFMNDSRILMENSILNFEPKHTNEACDILMRKSGGNGLYLQFTERALSHPIL  460
            +    +NG F+ D   L+++   NF      EA  +L  KSGGN  YL+FT++ALSHP +
Sbjct  490  LDFSAKNGAFVADVSSLVDDIARNFSDDDAAEAKKVLKHKSGGNFAYLEFTKQALSHPGM  549

Query  461  HG--ERTFLSLDVLDELPDSVDDIFFTIFEDKFGQGHQRVWKNVKPILEAIVAAAAGSHP  518
                +   + L VL ELP+++ DI+  IFEDKFGQG  RVW   KP+L+ +V AA+G + 
Sbjct  550  TATSKEGAVPLGVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAASGPYS  609

Query  519  LVGERQIKQRFQLGKEEWRMMKRSFTDIICCGTEGYRIITSSLFAWLIVENRSQ---HFY  575
             V E Q K+ F+L  E+ RM++RSF D++      YRI +S+L AWL    RS+   +F 
Sbjct  610  PVTEEQAKEHFKLTAEDLRMLRRSFVDLVAVKHGSYRIESSALCAWLSDPARSEEQFYFS  669

Query  576  ID  577
            ID
Sbjct  670  ID  671

>PHYKE_8395
Length=1420

 Score = 348 bits (892),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 205/541 (38%), Positives = 318/541 (59%), Gaps = 25/541 (5%)

Query  48    LERTESESTKNQFEA--VRNEIQDMRNEIQSVRQELLEAIQSTRYDLVKEIIALQGKVTG  105
             L RT SE T N  E   +R E+Q+++ E+Q++R+E++  +  TRYD++KE+  L+G V  
Sbjct  809   LSRTISEDTYNNNEVSRLRAELQEVKAEVQTIRREVMNELHMTRYDVLKELTLLKGAVAQ  868

Query  106   IGNGLTKIDVKSSPTGTNENHTTANKTAFSESAEDDEIISRFITPERSTIVADCSYKSGF  165
             +    T          T     + + ++   SAED   ++R  +   S    D   KS  
Sbjct  869   LSAAQT----------TGSVSPSTSSSSDPLSAEDRAALTRVPSKLTSKTTKDRLAKSRV  918

Query  166   VTERLNTKDSSFSTSV----PLDESQLSKPLDKDEFDEMFPCIDCFSDLKSNALKLARGT  221
                 +    +  S  +    P+ ++ LS PL+  + +EMFP ID  S+L ++A  L  GT
Sbjct  919   NIHTVPPPAARASVRLTQLAPVADNALSTPLNPQQINEMFPLIDFTSELAAHARGLVPGT  978

Query  222   RVWALDRVKEWIESNFKSENDHILTIIGEGGSGKSTLAGYICQKFDAKLHAYHFCQFdrk  281
             R WAL RV+EW+++ F   ND +L ++G+GG+GKS   G + Q+F   L A H CQFDRK
Sbjct  979   RTWALTRVEEWLDARFNVGNDTVLAVVGDGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRK  1038

Query  282   srsssrdvvlslvsQFASKNPLYKRQLTCLNLRYILKESNPLVMANKLLIEPLRAI--PV  339
             S+S+ R+V+LS V Q     P +K QL  LNL+Y+L+ES+P ++A K+ ++PL A+  P+
Sbjct  1039  SKSTPRNVLLSFVHQLVDNLPPFKNQLARLNLKYVLEESDPFLLAAKVFVDPLNAVEEPI  1098

Query  340   SNSTRGFVLFDGIDQCLV-ENESNDLLDLISHITQRFPSCIGFVVTSKASPAFDAKFKSK  398
               +   F+L +G+DQC    N  N+LL+ +S I  + PS +GF+++SK    F  +    
Sbjct  1099  HAT---FMLVEGLDQCSAGPNGRNELLEFLSQIIPQLPSWVGFMISSKPFSKFAKRLPVS  1155

Query  399   SIIHLHERNGKFMNDSRILMENSILNFEPKHTNEACDILMRKSGGNGLYLQFTERALSHP  458
             S++    +NG F++D   L+++   NF  + + EA  +L RKSGGN  YL+FT++ALSHP
Sbjct  1156  SVLDFSAKNGAFVSDVSSLVDDIARNFSDEDSAEAKRVLKRKSGGNFAYLEFTKQALSHP  1215

Query  459   --ILHGERTFLSLDVLDELPDSVDDIFFTIFEDKFGQGHQRVWKNVKPILEAIVAAAAGS  516
                +  +   + L+VLD+LP S+ DI+  IFEDKFGQG  R+W   KP+L+ IV AAAG 
Sbjct  1216  GMAMASKEGAVPLEVLDDLPQSLFDIYTEIFEDKFGQGRARIWAKAKPLLQLIVGAAAGP  1275

Query  517   HPLVGERQIKQRFQLGKEEWRMMKRSFTDIICCGTEGYRIITSSLFAWLIVENRS-QHFY  575
             +  V E Q K+ F    E+ RM++RSF D++      YR+ +S+L +WL    RS + FY
Sbjct  1276  YSPVTEGQAKEHFGFTTEDLRMLRRSFVDLVEVKHGAYRLESSALCSWLSDPARSEEQFY  1335

Query  576   I  576
             +
Sbjct  1336  L  1336

>PHYSO_348903
Length=766

 Score = 329 bits (844),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 202/593 (34%), Positives = 336/593 (57%), Gaps = 45/593 (8%)

Query  8    SMSLPSEVDDAIDDSFYSYNPAIDDCVQSGTVRRSYRKIKLERTESESTKNQFEAVRNEI  67
            S++ PS    +   +F ++N   ++  QS T  R +  I      + + + + E +R E+
Sbjct  122  SVTTPSNYAASTPGNFSNHNGQNNNTNQSTTFARGFSAIPTTVGSAVAEEGELERLRAEV  181

Query  68   QDMRNEIQSVRQELLEAIQSTRYDLVKEIIALQGKVTGIGNGLTKIDVKSSPTGTNENHT  127
             +++ E++++R+E++  +  TRYD++KE+  L+G V  +               T   H+
Sbjct  182  LEVKEEVKAIRREVMNELHVTRYDVLKELALLKGAVAQL---------------TAAQHS  226

Query  128  TANKTAFSESAEDDEIISRFITPERSTIVADCSYKSGFVT-ERLNTKDSSFSTS------  180
            +    + ++S+  D + +     +R+ +V   S K+   T ERL    ++   +      
Sbjct  227  SPPSVSSTDSSSLDPLSAD----DRAKLVRQTSTKTSPATRERLAASRANVQKTPPPFAR  282

Query  181  --------VPLDESQLSKPLDKDEFDEMFPCIDCFSDLKSNALKLARGTRVWALDRVKEW  232
                     P+ +  LS PL   + +EMFP ID  S+L ++A  L  G+R WAL RV+EW
Sbjct  283  ASVRLTQLAPVADDALSTPLTSQQINEMFPLIDFTSELAAHARGLTPGSRTWALTRVEEW  342

Query  233  IESNFKSENDHILTIIGEGGSGKSTLAGYICQKFDAKLHAYHFCQFdrksrsssrdvvls  292
            ++S F + +D +L ++GEGG+GKS   G + Q+F   + A H CQFDRKS+S+ R+V+LS
Sbjct  343  LDSRFNTGSDILLAVVGEGGTGKSAFCGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLS  402

Query  293  lvsQFASKNPLYKRQLTCLNLRYILKESNPLVMANKLLIEPLRAI--PVSNSTRGFVLFD  350
            +V Q     P +K QL  LNL+Y+L+E++P+++A K+L++PL A+  PV  +   F++ D
Sbjct  403  MVHQIVDNYPPFKNQLARLNLKYVLEEADPMLLAAKVLVDPLNALEEPVQAA---FMMVD  459

Query  351  GIDQCLVENES-NDLLDLISHITQRFPSCIGFVVTSKASPAFDAKFKSKSIIHLHERNGK  409
            GIDQC    +  N+LL+  + I  + P+ +GF+++SK S     +    S++     N  
Sbjct  460  GIDQCAAGAQGRNELLEFFAQIIPQLPTWVGFLLSSKPSSKLAKRLPVSSVLDFSAENDA  519

Query  410  FMNDSRILMENSILNFEPKHTNEACDILMRKSGGNGLYLQFTERALSHPILHG--ERTFL  467
            F+ D   L+E+   NF      +A  +L +KSGGN  YL+FT++ALSHP +    +   +
Sbjct  520  FVADVAPLVEDIARNFSDDDFVKAKSMLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAV  579

Query  468  SLDVLDELPDSVDDIFFTIFEDKFGQGHQRVWKNVKPILEAIVAAAAGSHPLVGERQIKQ  527
             L VL++LP+++ DI+  IFEDKFGQG  RVW   KP+L+ +V AA+G +  V E Q ++
Sbjct  580  PLGVLNDLPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAASGPYSPVTEEQARE  639

Query  528  RFQLGKEEWRMMKRSFTDIICCGTEGYRIITSSLFAWLIVENRSQ---HFYID  577
             F L  E+ RM++RSF D++      YRI +S+L AWL    RS+   +F ID
Sbjct  640  HFNLTAEDLRMLRRSFVDLVAVRHGSYRIESSALCAWLSDPARSEEQFYFSID  692

>PYAP_17763
Length=794

 Score = 329 bits (843),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 192/538 (36%), Positives = 311/538 (58%), Gaps = 27/538 (5%)

Query  63   VRNEIQDMRNEIQSVRQELLEAIQSTRYDLVKEIIALQGKVTGI-----GNGLTKIDVKS  117
            +R E+++M+ E+Q++++E++  +  TRYD++KE+  L+G +  +      +G    D  +
Sbjct  183  LRAELREMKQEMQAIKREMMNEMHLTRYDVLKEVTMLKGTIMQLVSVIQQSGGVHFDTAT  242

Query  118  SPTGTNENHTTANKTAFSESAEDDEIISRFITPERSTIVADCSYKSGFVTER-------L  170
            +     +    AN+     S E+ E +SR     ++T V     K    T R       L
Sbjct  243  AAAMGIDVPPQANEL----SPEEKEALSR-----KTTTVVSKVTKERITTTREDQIPPVL  293

Query  171  NTKDSSFSTSVPLDESQLSKPLDKDEFDEMFPCIDCFSDLKSNALKLARGTRVWALDRVK  230
             +  S  +   P+D+S LS PL +++ D+MFP ID  ++++  +     G+R W  DRV+
Sbjct  294  RSTSSRLTQLAPVDDSALSTPLHQEQIDDMFPLIDFSAEVQIQSRIRETGSREWVFDRVQ  353

Query  231  EWIESNFKSENDHILTIIGEGGSGKSTLAGYICQKFDAKLHAYHFCQFdrksrsssrdvv  290
            EW++S F    D +L ++G+ GSGK+  A  +C K++ ++ A HFC+FDRK++SS R+V+
Sbjct  354  EWLDSRFNVGADVVLAMVGDAGSGKTVAAASVCDKYEDQVVAKHFCKFDRKAKSSPRNVL  413

Query  291  lslvsQFASKNPLYKRQLTCLNLRYILKESNPLVMANKLLIEPLRAI--PVSNSTRGFVL  348
            LSLV+Q  S  P++K QL  LNL+Y+L+E++   ++ K+LI+PL A+  P+   T  FV+
Sbjct  414  LSLVNQLTSSLPMFKSQLARLNLKYVLEETDVPALSRKVLIDPLNALEEPL---TPKFVV  470

Query  349  FDGIDQCLVENESNDLLDLISHITQRFPSCIGFVVTSKASPAFDAKFKSKSIIHLHERNG  408
            FD IDQC      NDL D +S I    P  +GF+V+SK SP F       S++    +N 
Sbjct  471  FDAIDQCRTGVGYNDLQDFLSAIIPECPKWLGFLVSSKPSPEFAVSVPVSSVLDFSAQNA  530

Query  409  KFMNDSRILMENSILNFEPKHTNEACDILMRKSGGNGLYLQFTERALSHPILHGERTFLS  468
             +MND+  L+ +    F      EA  IL  KSGGN  YL+FT++ALS+P +     F+ 
Sbjct  531  NYMNDTVFLINDIAAVFHDNDQAEAKQILKTKSGGNYSYLEFTKQALSNPGMEEASGFVP  590

Query  469  LDVLDELPDSVDDIFFTIFEDKFGQGHQRVWKNVKPILEAIVAAAAGSHPLVGERQIKQR  528
            +DVL +LP S+ +I+  IFEDKFG+G  RVW+   P+L+ I  AA+G +  + E+ I   
Sbjct  591  VDVLHDLPQSLYEIYEEIFEDKFGKGRTRVWRKALPVLQLIFTAASGPYAQITEQNIMDS  650

Query  529  FQLGKEEWRMMKRSFTDIICCGTEGYRIITSSLFAWLIVENR-SQHFYIDPKAGIKFL  585
                K+E RM++R+F DII      Y I++S+++ WL  + R  + ++ID    +K L
Sbjct  651  LSYTKDEVRMLRRAFIDIISIRHGTYAIVSSAVYDWLTDQQRKGEQYFIDVNLYVKVL  708

>PHYRA_81098
Length=741

 Score = 322 bits (825),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 196/536 (37%), Positives = 311/536 (58%), Gaps = 32/536 (6%)

Query  59   QFEAVRNEIQDMRNEIQSVRQELLEAIQSTRYDLVKEIIALQGKVTGIG---------NG  109
            + E +R+E+ +++ E++++R+E++  +  TRYD++KE+  L+G +  +          + 
Sbjct  145  ELERLRSEVVEVKEEVKAIRREVMNELHVTRYDVLKELALLKGAIAQLAATQHLSPAASV  204

Query  110  LTKIDVKSSPTGTNENHTTANKTAFSESAEDDEIISRFITPERSTIVADCSYKSGFVTER  169
             +     S P   +E      +T+   S+   E ++      R+ I     +K+     R
Sbjct  205  SSTESSSSDPLSADERAALTRQTSTKTSSATRERLA----ASRANI-----HKTPPPAAR  255

Query  170  LNTKDSSFSTSVPLDESQLSKPLDKDEFDEMFPCIDCFSDLKSNALKLARGTRVWALDRV  229
             + + +  +   P+ ++ LS PL   + ++MFP ID  S+L ++A  L  G+R WAL RV
Sbjct  256  ASVRLTQLA---PVADNALSTPLTPQQINDMFPLIDFTSELAAHARSLTPGSRTWALTRV  312

Query  230  KEWIESNFKSENDHILTIIGEGGSGKSTLAGYICQKFDAKLHAYHFCQFdrksrsssrdv  289
            +EW+++ F   +D +L ++GEGG+GKS   G + Q+F   L A H CQFDRKS+SS R+V
Sbjct  313  EEWLDARFNVGHDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQFDRKSKSSPRNV  372

Query  290  vlslvsQFASKNPLYKRQLTCLNLRYILKESNPLVMANKLLIEPLRAI--PVSNSTRGFV  347
            +LS+V Q     P +K QL  LNL+Y+L+E++P V+A K+L++PL A+  P+  +   F+
Sbjct  373  LLSMVHQLVDSLPPFKNQLARLNLKYVLEEADPFVLAGKVLVDPLNAMEEPMHAT---FM  429

Query  348  LFDGIDQCLVENES-NDLLDLISHITQRFPSCIGFVVTSKASPAFDAKFKSKSIIHLHER  406
            L DGIDQC       N+LL+  + +    PS +GF+V+SK S     +    S++    +
Sbjct  430  LVDGIDQCSAGPRGRNELLEFFAQVIPLLPSWVGFMVSSKPSSKLAKRLPVSSVLDFSAK  489

Query  407  NGKFMNDSRILMENSILNFEPKHTNEACDILMRKSGGNGLYLQFTERALSHPILHG--ER  464
            NG F++D   L+E+   NF      EA  +L +KSGGN  YL+FT++ALSHP +    + 
Sbjct  490  NGAFVSDVSSLVEDVARNFSDNDAAEAKKVLKQKSGGNFAYLEFTKQALSHPGMAAASKE  549

Query  465  TFLSLDVLDELPDSVDDIFFTIFEDKFGQGHQRVWKNVKPILEAIVAAAAGSHPLVGERQ  524
              + L VL ELP+++ DI+  IFEDKFGQG  RVW   KP+L+ IV AAAG + LV E Q
Sbjct  550  GAVPLSVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLIVGAAAGPYSLVTEEQ  609

Query  525  IKQRFQLGKEEWRMMKRSFTDIICCGTEGYRIITSSLFAWLIVENRSQ---HFYID  577
             K+ F L  E+ RM++ SF D++      YRI +S+L  WL    RS+   +F ID
Sbjct  610  AKKHFNLTAEDLRMLRHSFVDLVAVRHGAYRIESSALCGWLSDPARSEEQFYFAID  665

>PHALS_06476
Length=726

 Score = 320 bits (819),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 186/498 (37%), Positives = 288/498 (58%), Gaps = 11/498 (2%)

Query  60   FEAVRNEIQDMRNEIQSVRQELLEAIQSTRYDLVKEIIALQGKVTGIGNGLTKIDVKSSP  119
             E + +E+  +++E++++R+E++  +  TRYD++KE+  L+G +  + +  +     S  
Sbjct  154  LERLHSEVLKIKSEVKTIRREVMNELHVTRYDVLKELTLLKGAIAQLASTKSLNSSSSVS  213

Query  120  TGTNENHTTANKTAFSESAEDDEIISRFITPERSTIVADCSYKSGFVTERLNTKDSSFST  179
            +  + +    +    +         +   T +R   +A     +     R     +  + 
Sbjct  214  STDSSSSDPLSSDERAALTRQTPTKTSQATRDR---LAAPRINTNKAPPRAIRASARLTQ  270

Query  180  SVPLDESQLSKPLDKDEFDEMFPCIDCFSDLKSNALKLARGTRVWALDRVKEWIESNFKS  239
              P+ +  LS PL+  + +E FP ID  S+L ++A  L  G+R WAL R++EW+++ F  
Sbjct  271  LAPVADDALSTPLNSQQINESFPLIDFTSELAAHARSLTPGSRSWALTRIQEWLDARFHM  330

Query  240  ENDHILTIIGEGGSGKSTLAGYICQKFDAKLHAYHFCQFdrksrsssrdvvlslvsQFAS  299
             ND +L ++GEGGSGKS   G + Q+F   L A H CQFDRKS+S  R+V+LS+V Q   
Sbjct  331  GNDTLLAVVGEGGSGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSRPRNVLLSMVHQLVD  390

Query  300  KNPLYKRQLTCLNLRYILKESNPLVMANKLLIEPLRAI--PVSNSTRGFVLFDGIDQCLV  357
              PL+K QL  LNLRY+L+E++P ++ANK+LI+PL A+  P  ++   F+L DGIDQC  
Sbjct  391  NLPLFKNQLARLNLRYVLEETDPFLLANKVLIDPLNALEEPTHST---FILIDGIDQCAT  447

Query  358  -ENESNDLLDLISHITQRFPSCIGFVVTSKASPAFDAKFKSKSIIHLHERNGKFMNDSRI  416
              N  N+LL+ IS I    PS +GF+V+SK S          S++    +NG F+ D+  
Sbjct  448  GSNGRNELLEFISQIISLLPSWVGFLVSSKPSSKLAKCLPVSSVLDFSAKNGAFVADASS  507

Query  417  LMENSILNFEPKHTNEACDILMRKSGGNGLYLQFTERALSHPILHGERT--FLSLDVLDE  474
            L+E+    F      EA  +L +KSGGN  YL+FT++ALSHP +    T   + L VL E
Sbjct  508  LVEDISQYFSDDDAVEAKRMLTKKSGGNFAYLEFTKQALSHPGMAVTSTNGVVPLSVLRE  567

Query  475  LPDSVDDIFFTIFEDKFGQGHQRVWKNVKPILEAIVAAAAGSHPLVGERQIKQRFQLGKE  534
            LP+++ DI+  IFEDKFGQGH R W   KP+L+ IV AAAG + LV E Q K++  L  +
Sbjct  568  LPETLYDIYAEIFEDKFGQGHARAWGKAKPLLQLIVGAAAGPYSLVTEEQAKKQLDLNAD  627

Query  535  EWRMMKRSFTDIICCGTE  552
            + RM++RSF DI+    E
Sbjct  628  DLRMLRRSFVDIVAVKHE  645

>HYAP_07104
Length=721

 Score = 314 bits (805),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 183/534 (34%), Positives = 305/534 (57%), Gaps = 30/534 (6%)

Query  58   NQFEAVRNEIQDMRNEIQSVRQELLEAIQSTRYDLVKEIIALQGKVTGIGNGLTKIDVKS  117
            ++ E +R E+ +++ E+ ++RQ ++  +  TRYD++KE+  L+G +  +           
Sbjct  144  SELEQLRFELIEVKQEVAAIRQHVVNELHVTRYDVLKELALLKGAIAQL-----------  192

Query  118  SPTGTNENHTTANKTAFSESAEDD-EIISRFITPERSTIVADCSYKSGFVTERLNT----  172
              TGT    TT+   +   S  +      R     +++ +   + +      R+NT    
Sbjct  193  --TGTFPPPTTSVPLSIQRSVSNPLSSADRGALTRQTSTMTSSATRDRLAASRVNTYKPP  250

Query  173  -----KDSSFSTSVPLDESQLSKPLDKDEFDEMFPCIDCFSDLKSNALKLARGTRVWALD  227
                      +   P+ +S LS PL   + +++FP ID  ++L ++A +L  G+R WAL 
Sbjct  251  PPAARASVRLTQLAPVADSALSTPLSSVQMNDLFPLIDFTTELAAHARRLTPGSRTWALT  310

Query  228  RVKEWIESNFKSENDHILTIIGEGGSGKSTLAGYICQKFDAKLHAYHFCQFdrksrsssr  287
            R +EW+ES FK+  D +L ++GEGGSGKS   G + Q++  +L A H CQFDRK +SS R
Sbjct  311  RAEEWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDRKGKSSPR  370

Query  288  dvvlslvsQFASKNPLYKRQLTCLNLRYILKESNPLVMANKLLIEPLRAI--PVSNSTRG  345
            +V+LS+V Q     PL+K QL  LNL+Y+L+E++P+++A+K+L++PL A+  PV  +   
Sbjct  371  NVLLSVVHQLVVNLPLFKNQLARLNLKYVLEEADPVLLASKVLVDPLNALEDPVDVA---  427

Query  346  FVLFDGIDQCLVENES-NDLLDLISHITQRFPSCIGFVVTSKASPAFDAKFKSKSIIHLH  404
            F+L DGIDQC V     N+LL+ ++ +  + PS +G +V+SK S     +    S++   
Sbjct  428  FMLVDGIDQCNVGPAGRNELLEFLAQLIPQLPSWLGVIVSSKPSSKLAKRLPVSSVLDFS  487

Query  405  ERNGKFMNDSRILMENSILNFEPKHTNEACDILMRKSGGNGLYLQFTERALSHPILHGER  464
             +N  F+ D   L++    +F+ +   EA ++L  KSGGN  YL+FT++ALS      + 
Sbjct  488  AKNEAFVADVSSLVDEIACHFKHEDVEEAKEVLKHKSGGNFAYLEFTKQALSGMASVSKE  547

Query  465  TFLSLDVLDELPDSVDDIFFTIFEDKFGQGHQRVWKNVKPILEAIVAAAAGSHPLVGERQ  524
              +++DVL ELP+++ DI+  IFEDKFG G  RVW   + +L+  + A AG +  V E Q
Sbjct  548  GVVAIDVLRELPETLYDIYAEIFEDKFGHGRARVWSKAEQVLQLAIGATAGPYSPVTEEQ  607

Query  525  IKQRFQLGKEEWRMMKRSFTDIICCGTEGYRIITSSLFAWLIVENRS-QHFYID  577
             ++ F+L  E+ R+++RSF D++      YRI  S+L AWL    R+ + FY +
Sbjct  608  AQEHFRLTTEDLRLLRRSFVDLVAVKHGIYRIENSALCAWLCDPARAEEQFYFN  661

>PYAR_13571
Length=666

 Score = 297 bits (761),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 171/515 (33%), Positives = 289/515 (56%), Gaps = 55/515 (11%)

Query  74   IQSVRQELLEAIQSTRYDLVKEIIALQGKVTGIGNGLTKIDVKSSPTGTNENHTTANKTA  133
            + ++R+E++  + ++RYD++KE+  L+G +T +   + +              T A+K+ 
Sbjct  118  MPAIRREMMNEMHTSRYDVLKEVTMLKGTITQLIETMAR-----------RTTTVASKS-  165

Query  134  FSESAEDDEIISRFITPERSTIVADCSYKSGFVTERLNTKDSSFSTSVPLDESQLSKPLD  193
                           T ER T   D       V   L       +   P+D+S LS PL 
Sbjct  166  ---------------TKERITTTRD-----DMVPPLLRATSVRLTQLAPVDDSALSTPLT  205

Query  194  KDEFDEMFPCIDCFSDLKSNALKLARGTRVWALDRVKEWIESNFKSENDHILTIIGEGGS  253
            +++ DE+FP +D  ++++  A     GTR WA DRV+EW++S F   +D +L ++G+ G+
Sbjct  206  QEQIDELFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDVLLAMVGDAGT  265

Query  254  GKSTLAGYICQKFDAKLHAYHFCQFdrksrsssrdvvlslvsQFASKNPLYKRQLTCLNL  313
            GK+                 HFC+F+RK +SS R+V+LS+V+Q  +  P +K QL  LNL
Sbjct  266  GKT-----------------HFCKFERKGKSSPRNVLLSVVNQLTATLPTFKSQLARLNL  308

Query  314  RYILKESNPLVMANKLLIEPLRAI--PVSNSTRGFVLFDGIDQCLVENESNDLLDLISHI  371
            +Y+L+E++ L +A K+L++PL ++  P+   T  FVL DG+DQC V N  NDLLD +S +
Sbjct  309  KYVLEETDVLALARKVLVDPLASLEEPL---TAKFVLLDGLDQCGVANGYNDLLDFLSVV  365

Query  372  TQRFPSCIGFVVTSKASPAFDAKFKSKSIIHLHERNGKFMNDSRILMENSILNFEPKHTN  431
                PS +GF++T+K SP F  K    S++    +N  ++ND+ +L+ + +  F  +   
Sbjct  366  VPECPSWLGFLITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVAIFPTEDQA  425

Query  432  EACDILMRKSGGNGLYLQFTERALSHPILHGERTFLSLDVLDELPDSVDDIFFTIFEDKF  491
            +A  IL  KS GN  YL+FT +A+S+P +   +  + +DVL +LP S+ +I+  IFEDKF
Sbjct  426  DATQILKTKSCGNYSYLEFTRQAMSNPGMEAPQGSVPVDVLHDLPQSLYEIYEEIFEDKF  485

Query  492  GQGHQRVWKNVKPILEAIVAAAAGSHPLVGERQIKQRFQLGKEEWRMMKRSFTDIICCGT  551
            G+G  R+W+   P+L+ I  AA+G +  + E+ +       K++ RM++R+F DII    
Sbjct  486  GKGRTRLWRKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFIDIISIRH  545

Query  552  EGYRIITSSLFAWLI-VENRSQHFYIDPKAGIKFL  585
              Y I++S+LF WL   + + + +++D    +K L
Sbjct  546  GTYHIVSSALFDWLTDPQRKGEPYHVDVTLHVKVL  580

>PYVX_23590
Length=689

 Score = 249 bits (637),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 175/529 (33%), Positives = 273/529 (52%), Gaps = 79/529 (15%)

Query  60   FEAVRNEIQDMRNEIQSVRQELLEAIQSTRYDLVKEIIALQGKVTGIGNGLTKIDVKSSP  119
              A+R E+ D+R E Q++R+E++  +   RYD++KE+  L+G V        ++    +P
Sbjct  148  LAALRAELADVRAETQAIRREVMNELHVLRYDVLKEVTVLKGAVA-------QLLAALAP  200

Query  120  TGTNENHTTANKTAFSESAEDDEIISRFITP-ERSTIVADCSYKSGFVTERLNTKDSSFS  178
             G +      +  + + +A      S  ++P +R+ I                       
Sbjct  201  GGGDAGSRPGSAGSATSAATTASSSSAELSPADRAAI-------------------GVAP  241

Query  179  TSVPLDESQLSKPLDKDEFDEMFPCIDCFSDLKSNALKLARGTRVWALDRVKEWIESNFK  238
            T  P+D++ LS PL  ++ DE+FP +D  +D+ + A   A GTR WA  RV+EW++S F 
Sbjct  242  TLAPVDDAALSAPLRPEQLDELFPLVDASTDIAAFARARAPGTRDWATARVQEWLDSRFN  301

Query  239  SENDHILTIIGEGGSGKSTLAGYICQKFDAKLHAYHFCQFdrksrsssrdvvlslvsQFA  298
               D +L ++G  G+GKST  G +C      + A HFC+FDRK++S+ R V+LSLV Q  
Sbjct  302  VGQDTLLGVVGGPGTGKSTFCGSVCDMLQGNVLATHFCKFDRKAKSTPRVVLLSLVRQVV  361

Query  299  SKNPLYKRQLTCLNLRYILKESNPLVMANKLLIEPLRAIPVSNSTRGFVLFDGIDQCLVE  358
            +  P +KRQL  LNL+Y+L+E +  V+A K+LI+PL A     + +  VL DG+DQC   
Sbjct  362  ANLPPFKRQLARLNLKYVLEEPDVFVLAGKVLIDPLAACEEPITAKCLVL-DGLDQCKTS  420

Query  359  NES---NDLLDLISHITQRFPSCIGFVVTSKASPAFDAKFKSKSIIHLHERNGKFMNDSR  415
                  N+LL+ ++H+  + PS +G +V+SK +P    + K  S++    +N  F+ D+R
Sbjct  421  RRGGVRNELLEFLAHVVPQLPSWLGVLVSSKPAPELATQLKFTSLLDFSGKNKLFVQDAR  480

Query  416  ILMENSILNFEPKHTNEACDILMRKSGGNGLYLQFTERALSHPIL-HGERTFLSLDVLDE  474
             L+++   NF   H  EA  +L  K+GGN  YL FT +ALS P L  GE   L LD+L +
Sbjct  481  FLVDDIAANFADAHAAEARRLLETKAGGNFAYLDFTRQALSSPGLDDGE---LELDMLHD  537

Query  475  LPDSVDDIFFTIFEDKFGQGHQRVWKNVKPILEAIVAAAAGSHPLVGERQIKQRFQLGKE  534
            LP+S+ +I+  IFED                                            +
Sbjct  538  LPESLYEIYLEIFED-------------------------------------------ND  554

Query  535  EWRMMKRSFTDIICCGTEGYRIITSSLFAWLIVENRS-QHFYIDPKAGI  582
            + R++KRSF DII      YRI +S+LF WL    RS + F+ D  AG+
Sbjct  555  DMRLVKRSFVDIIAVRGGCYRIESSALFEWLSDPARSGESFFFDADAGV  603

>SPRG_06355
Length=713

 Score = 222 bits (565),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 158/572 (28%), Positives = 305/572 (53%), Gaps = 66/572 (12%)

Query  62   AVRNEIQDMRNEIQSVRQELLEAIQSTRYDLVKEIIALQGKVTGIGNGL-TKIDVKSSPT  120
            A+   + +M+  +  +R++++  + +T+YDL+KE+  L+G V  + + +  +    ++P 
Sbjct  141  AMDAAVDEMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMHQQPRAAATPL  200

Query  121  GTNENH-------TTANKTAFSESA--EDDEII------------SRFITPER--STIVA  157
               E+         T +  A SES+  E+ E+             SR  +P +  ST+V 
Sbjct  201  LRTEDRKLSVMSDATVSSEADSESSTLEEPEVFEPNPKVPYLPAASRTPSPPKRESTVVR  260

Query  158  D---CSYKSGFVTERLNTKDSSFS----------TSVPLDESQLSKPLDKDEFDEMFPCI  204
            +    S K    + +L+ + S  S          T  P+ +  L++P + +  ++  P  
Sbjct  261  ESIRASSKLSRESSKLSRESSKISRESSKLFRESTRQPIKDQALTQPWE-NVLNQHLP--  317

Query  205  DCFSDLKSNALKLARGTRVWALDRVKEWIESNFKSENDHILTIIGEGGSGKSTLAGYICQ  264
              F + +  A+++   TR WA+++  +W +    +    +L ++G  G+GKSTL  ++  
Sbjct  318  --FLNTQRPAMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVS  375

Query  265  KFDAKLHAYHFCQFdrksrsssrdvvlslvsQFASKNPLYKRQLTCLNLRYILKESNPLV  324
             +  ++ A HF ++D +  +S+  + L+   Q + K P +++QL  LNL Y+++E +P+V
Sbjct  376  NYPEQIMASHFVRYDERHATSAILMSLAH--QISCKLPDFQQQLVRLNLAYLIQEPDPVV  433

Query  325  MANKLLIEPLRAIPVSNSTRGFVLFDGIDQCLVENESNDLLDLISHITQRFPSCIGFVVT  384
            +A KLLIEPLR++P    ++  VL D +D+        +L+ L++ +   FPS + F+++
Sbjct  434  LATKLLIEPLRSMPAPLESQVIVL-DAVDED-ASTPGTNLISLLADVALEFPSWVLFLLS  491

Query  385  SKASPAFDAKFKSKSIIHLHERNGKFMNDSRILMENSILNFEPKHTNEACDILM---RKS  441
            S+   +      +  ++H H  +  F  D  I ++ S+++   KH  +  +IL     KS
Sbjct  492  SRPVDSVLKALPTHDVLHFHMEHRPFAADCTIAVQ-SLMD---KHGLDDKNILFLLKAKS  547

Query  442  GGNGLYLQFTERALSHPILHGERTFLSLDVLDELPDSVDDIFFTIFEDKFGQGHQRVWKN  501
             G+ LYLQF ++A +  ++H E   +   ++ ELP ++ +I+  +FE+K+G+G +RVW+ 
Sbjct  548  QGSFLYLQFVDQAFA--MIHSE---IDAGMILELPKTLYEIYDQVFEEKYGKGRRRVWQK  602

Query  502  VKPILEAIVAAAAGSH-----PLVGERQIKQRFQLGKEEWRMMKRSFTDIICCGTEG--Y  554
            V+P+LEAIV AA  SH     P V E  ++  F+LG+ +  ++ RSF DI+    E   Y
Sbjct  603  VQPVLEAIVGAATLSHEKNACPFVTESDVQHIFKLGQPDLALIARSFEDIVAVDEETGVY  662

Query  555  RIITSSLFAWLIVENRSQHF-YIDPKAGIKFL  585
            R+ +  LF +L+  +RSQ   +I+ + G+ +L
Sbjct  663  RLQSKGLFDYLVDTSRSQEVAHINVERGVHYL  694

>SDRG_01763
Length=736

 Score = 216 bits (549),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 159/577 (28%), Positives = 295/577 (51%), Gaps = 66/577 (11%)

Query  62   AVRNEIQDMRNEIQSVRQELLEAIQSTRYDLVKEIIALQGKVTGIGNGL-----------  110
            A+   + +M+  +  +R++++  + +T+YDL+KE+  L+G V  + + +           
Sbjct  154  AMDAAVDEMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMHQQSTPRAVAT  213

Query  111  -------TKIDVKSSPTGTNENHTTANKTAFSESAEDDEIISRFIT-------PERSTIV  156
                    K+ V S  T ++E  +  +     E  E +  +            P+R + V
Sbjct  214  PLLRTEDRKLSVMSDATVSSEADSEDSTHEEPEVFEPNPKVPYLPAASRTPSPPKRESTV  273

Query  157  ADCSYKSGFVTERLNTKDSSFSTSVPLDESQLSKPLDKDEFDEMF--PCID---------  205
               S ++     R ++K S  S+ +  + S+LS+   K  F E    P  D         
Sbjct  274  FRESTRASSKLSRESSKLSRESSKLSRESSKLSRESSKLLFRESTRQPIKDQALTQPWEN  333

Query  206  ------CFSDLKSNALKLARGTRVWALDRVKEWIESNFKSENDHILTIIGEGGSGKSTLA  259
                   F + +  A+++   TR WA+++  +W +    +    +L ++G  G+GKSTL 
Sbjct  334  VLNQHLPFLNTQRPAMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLL  393

Query  260  GYICQKFDAKLHAYHFCQFdrksrsssrdvvlslvsQFASKNPLYKRQLTCLNLRYILKE  319
             ++   +  ++ A HF ++    R +   +++SL  Q + K P Y++QL  LNL Y+++E
Sbjct  394  SHLVSNYPEQIMASHFVRY--DERHAPSAILMSLAHQISCKLPDYQQQLVRLNLPYLIQE  451

Query  320  SNPLVMANKLLIEPLRAIPVSNSTRGFVLFDGIDQCLVENESNDLLDLISHITQRFPSCI  379
             +P+V+A KLLIEPLR++P    ++  VL D +D+  V     +L+ L++ +   FPS +
Sbjct  452  PDPIVLATKLLIEPLRSMPAPLESQVIVL-DAVDED-VSTPGANLISLLADVALEFPSWV  509

Query  380  GFVVTSKASPAFDAKFKSKSIIHLHERNGKFMNDSRILMENSILNFEPKHTNEACDILM-  438
             F+++S+   +      +  ++H H  +  F  D  I ++ S+++   KH  +  +IL  
Sbjct  510  LFLLSSRLVESVLKALPAHDVLHFHMEHRPFAADCTIAVQ-SVMD---KHGLDDKNILFL  565

Query  439  --RKSGGNGLYLQFTERALSHPILHGERTFLSLDVLDELPDSVDDIFFTIFEDKFGQGHQ  496
               KS G+ LYLQF ++A S  ++H E   +   ++ ELP ++ +I+  +FE+K+G+G +
Sbjct  566  LKAKSQGSFLYLQFVDQAFS--MIHSE---IDAGMILELPKTLHEIYDQVFEEKYGKGRR  620

Query  497  RVWKNVKPILEAIVAAAAGSH-----PLVGERQIKQRFQLGKEEWRMMKRSFTDIICC--  549
            RVW+ V+ +LEAIV AA  SH     P V E  ++  F+LG+ +  ++ RSF DI+    
Sbjct  621  RVWQKVQAVLEAIVGAATISHEKNACPFVTESDVQHIFKLGQPDLALIARSFEDIVTVDE  680

Query  550  GTEGYRIITSSLFAWLIVENRSQHF-YIDPKAGIKFL  585
             T  YR+ +  LF +L+   RSQ   +I+ + GI +L
Sbjct  681  DTGVYRLQSKGLFDYLVDTARSQEVTHINVERGIHYL  717

>SPRG_12621
Length=1003

 Score = 81.3 bits (199),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 88/351 (25%), Positives = 152/351 (43%), Gaps = 25/351 (7%)

Query  171  NTKDSSFSTSVPLDESQLSKPLDKDEFD-EMFPCIDCFSDLKSNALKLARGTRVWALDRV  229
            +  D+ +   +    + L   LD D     +F     FS  ++N        R W LD++
Sbjct  410  SVNDAKYPQRLAQIATALRGKLDHDGLQARLFSIFSPFS-FQTNKYTQGFAGREWVLDQL  468

Query  230  KEWIESNFKSENDHILTIIGEGGSGKSTLAGYICQKFDAKLHAYHFCQFdrksrsssrdv  289
             +W     K  +D +  + G+ G+GKS LA YI Q    ++ A+H    + +   S R  
Sbjct  469  DQW-----KQTHDQVFWVTGQIGTGKSALAAYIIQS-RPEVRAFHLVCKEDEQTQSHRRC  522

Query  290  vlslvsQFASKNPLYKRQLTCLN-LRYILKESNPLVMANKLLIEPLRAIPVSNSTRGFVL  348
            VLSL  Q  ++ P Y   L   + L  ++  S  + + + LL+ PLRAI    +T   +L
Sbjct  523  VLSLAYQLTTQLPEYASFLQQGSPLEEVVPVSTVVELLDILLVAPLRAIAEPATTPLVIL  582

Query  349  FDGIDQCLVENES-NDLLDLISHITQRFPSCIGFVVTSKASPAFDAKFKS-KSIIHLHER  406
             DG+D      E+ N L+  +  + Q+ PS +  ++TS+  P    K +     I L + 
Sbjct  583  LDGLDSLEDTQETDNCLVSALPALLQKLPSWVRVILTSREDPVVMRKLQGFAPQIALDKC  642

Query  407  NGKFMNDSRILMENSILNFEPKHT-----NEACDILMRKSGGNGLYLQFTERALSHPILH  461
                  D    ++ ++L + P  T           +  ++ G  LY      ALS     
Sbjct  643  ADHSRQDIMSYLQKALLPYLPSTTAGVVPEATLQFIAGRAEGLFLYASHIVHALS-----  697

Query  462  GERTFLSLDVLDELPDSVDDIFFTIFEDKFGQGHQRVWKNVKPILEAIVAA  512
              +  L+LD L+  P  +       FE +F   H +  ++++P+LE + AA
Sbjct  698  --QHRLTLDNLEGFPTGMGGYLRQFFESQFTPEHYK--EHIRPLLEVLCAA  744

>SDRG_04575
Length=1003

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 82/312 (26%), Positives = 138/312 (44%), Gaps = 38/312 (12%)

Query  222  RVWALDRVKEWIESNFKSENDHILTIIGEGGSGKSTLAGYICQKFDAKLHAYHFCQFdrk  281
            R W L ++ +W     K  +D +  I G+ G+GKS LA YI Q    ++ A+H    + +
Sbjct  448  REWVLHQLDQW-----KQTHDQVFWITGQIGTGKSALAAYIIQS-RPEIRAFHLVCKEDE  501

Query  282  srsssrdvvlslvsQFASKNPLYKRQLTCLN-LRYILKESNPLVMANKLLIEPLRAIPVS  340
               S R  +LSL  Q  ++ P Y   L   + L  ++  S  + + + LL+ PL AI   
Sbjct  502  QTQSHRRCILSLAYQLTTQLPEYASFLQQGSPLEEVVPVSTVVELLDILLVAPLSAIAEP  561

Query  341  NSTRGFVLFDGIDQCLVENES-NDLLDLISHITQRFPSCIGFVVTSKASPAFDAKFKS--  397
             +T   +L DG+D      E+ N L+  +  + Q+ PS +  ++TS+  P    K +   
Sbjct  562  ATTPLVILLDGLDSLEDTQETDNCLVSALPGLLQKLPSWVRVILTSREDPVVMRKLQGFT  621

Query  398  -------------KSIIHLHERN-GKFMNDSRILMENSILNFEPKHTNEAC---DILMRK  440
                         + I++  +R    ++   R     S L   PK   +A    D+L+R 
Sbjct  622  PQIALDKCVDNSRQDIMNYLQRALVPYLPSVRHRRRCSSLRGAPKVERDATTHRDLLLRI  681

Query  441  SGGNGLYLQFTERALSHPILHGERTFLSLDVLDELPDSVDDIFFTIFEDKFGQGHQRVWK  500
              G  LY      ALS       +  L+LD L+  P  +       FE +F   H +  +
Sbjct  682  --GLFLYASHIVHALS-------QHRLTLDHLEGFPTGMGGYLRQFFESQFTPEHYK--E  730

Query  501  NVKPILEAIVAA  512
            +++P+LE + AA
Sbjct  731  HIRPLLEVLCAA  742

>H310_08292
Length=1007

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 98/433 (23%), Positives = 173/433 (40%), Gaps = 52/433 (12%)

Query  171  NTKDSSFSTSVPLDESQLSKPLDKD-EFDEMFPCIDCFSDLKSNALKLARG--TRVWALD  227
               D  ++  +P   + L   LD D +   +F     FS  ++   K  +G   R W +D
Sbjct  402  TVNDVKYAVRMPQLVTALRGNLDHDGQQARLFSIFSPFS-FQAEIAKFTQGFAGREWVMD  460

Query  228  RVKEWIESNFKSENDHILTIIGEGGSGKSTLAGYICQKFDAKLHAYHFCQFdrksrsssr  287
            ++ +W     K+       + G+ G+GK+ LA YI Q    ++ A+H    D +   + R
Sbjct  461  QLTQW-----KASASQTFWVTGQIGTGKTALAAYIIQS-QPEVRAFHLVSKDDEQTQNPR  514

Query  288  dvvlslvsQFASKNPLYKRQL-TCLNLRYILKESNPLVMANKLLIEPLRAIPVSNSTRGF  346
              +LSL  Q  ++ P Y   L     L  I+  S+   +   LL+ PL AI    +    
Sbjct  515  RCILSLAYQLTTQLPAYAAFLQQGEPLEEIVAVSSVTELVTTLLVVPLNAIAQPTTVPLV  574

Query  347  VLFDGIDQCL-VENESNDLLDLISHITQRFPSCIGFVVTSKASPAFDAKFKS--------  397
            +L DG+D         N  +  +  + ++ PS +  + TS+  P+   K +         
Sbjct  575  ILLDGLDAFQDAAALDNCFVSSLVALVRKLPSWVRMIWTSREDPSVMRKLQGLVPQVALD  634

Query  398  KSIIHLHERNGKFMNDSRILM----ENSILNFEPKHTNEACDILMRKSGGNGLYLQFTER  453
            K +        K++  + +      E +++  E  H       ++ +S G  LY      
Sbjct  635  KCVDQSSADMLKYLQAALVPFVRPDEGAVVPLETLHA------IVARSEGLFLYASHIVH  688

Query  454  ALSHPILHGERTFLSLDVLDELPDSVDDIFFTIFEDKFGQGHQRVWKNVKPILEAIVAA-  512
            A     LH +R  L+LD L+  P  +       FED+F   H     +++P+LE + AA 
Sbjct  689  A-----LHQKR--LTLDKLESFPVGMGGYLRQFFEDQFSAHHYET--SIRPLLEVLCAAL  739

Query  513  ----AAGSHPLVGERQIKQRFQLGKEEWRMMKRSFTDIICCGTEGYRIITSSLFAWLIVE  568
                 A  H ++       R  LG  +  +      DI        +   +S+F WL   
Sbjct  740  EPMPMAMLHDVMKWDTYSHRDCLGAFKSLLYVSESDDI--------KPFHTSVFEWLQDA  791

Query  569  NRSQHFYIDPKAG  581
            N +  F++  + G
Sbjct  792  NAAGRFFVRVEHG  804

>H257_01934
Length=1022

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 78/298 (26%), Positives = 131/298 (44%), Gaps = 20/298 (7%)

Query  222  RVWALDRVKEWIESNFKSENDHILTIIGEGGSGKSTLAGYICQKFDAKLHAYHFCQFdrk  281
            R W L    EW+ S   S    +  + G  GSGK+ LA +I Q    ++ A+H    + +
Sbjct  463  RAWVLHEFDEWVTSP-PSNARRVFLLTGVIGSGKTALAAHIIQN-RPEVVAFHLASHEGE  520

Query  282  srsssrdvvlslvsQFASKNPLYKRQLTCLN--LRYILKESNPLVMANKLLIEPLRAIPV  339
               + R  VL+LV Q  ++ P Y   L      L   +   N   +  +LLI PL  I  
Sbjct  521  QTQNGRRCVLNLVYQLTTQLPAYANVLKSQKEPLEETVFVGNLADLVQELLIAPLERIAT  580

Query  340  SNSTRGFVLFDGIDQCLVENESNDLLDLISHITQRFPSCIGFVVTSKASPAFDAKFKSKS  399
              ST   +L DGI+ C    + N L+ +++    R+P+ + FV TS+  P   +  ++  
Sbjct  581  PPSTM-VILIDGIE-CFPCADDN-LVAILTASLNRWPAWMRFVFTSREDPRVLSLLQAYM  637

Query  400  I--IHLHERNGKFMNDSRILMENSI---LNFEPKHTNEACDILMRKSGGNGLYLQFTERA  454
            +  I L     +   D R  ++ ++    +  P       D+L+ ++ G  LY     R 
Sbjct  638  LPPIALDLACAQSKRDVRQYLDTALGSHFDISPPMPPHVIDLLVDRTQGLFLY----ARH  693

Query  455  LSHPILHGERTFLSLDVLDELPDSVDDIFFTIFEDKFGQGHQRVWKNVKPILEAIVAA  512
            L   I  G+    +LD LD +P ++       F  +F     +   +V+P+LE + AA
Sbjct  694  LVDSISSGQ---WNLDNLDNVPTTMGGFLHQNFATQFPVV-DKYKVDVRPVLEVVCAA  747

>H257_11773
Length=1026

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 82/350 (23%), Positives = 148/350 (42%), Gaps = 27/350 (8%)

Query  174  DSSFSTSVPLDESQLSKPLDKD-EFDEMFPCIDCFSDLKSNALKLARG--TRVWALDRVK  230
            D  ++  +P   + L   LD D +   +F     FS  ++   K  +G   R W +D++ 
Sbjct  420  DVKYAVRLPQLVTALRGNLDHDGQQARLFSIFSPFS-FQAEISKFTQGFAGREWVMDQLT  478

Query  231  EWIESNFKSENDHILTIIGEGGSGKSTLAGYICQKFDAKLHAYHFCQFdrksrsssrdvv  290
            EW     K+ +     I G+ G+GK+ +A  + Q    ++ A+H    + +   + R  V
Sbjct  479  EW-----KASSSQTFWITGQIGTGKTAVAASVIQN-QPEVRAFHLVSKEDEQTQNHRRCV  532

Query  291  lslvsQFASKNPLYKRQLTCLN--LRYILKESNPLVMANKLLIEPLRAIPVSNSTRGFVL  348
            LSL  Q  ++ P Y   L   +  L  I+  S    + + LL+ PL AI   ++    +L
Sbjct  533  LSLAYQLTTQLPDYAAFLQQGDQPLEEIVSVSCVAELVHSLLVVPLNAIAQPSTVPLVIL  592

Query  349  FDGIDQCLVENE-SNDLLDLISHITQRFPSCIGFVVTSKASPAFDAKFKS-KSIIHL---  403
             DG+D     N   N  +  ++   +  P  + +V+TS+  P+   K +     + L   
Sbjct  593  IDGLDAFQDSNAVENCFVSSLAAAVRNLPPWVRWVLTSREDPSVMQKLQGLVPQVALDKC  652

Query  404  -HERNGKFMNDSRILMENSILNFEPKHTNEACDILMRKSGGNGLYLQFTERALSHPILHG  462
             H+     +   ++ +   + N +          ++ +S G  LY      ALS      
Sbjct  653  GHQTRDDMLKYLQLALVQFVANADKDVPAATLRFIVERSEGLFLYASHIVNALS------  706

Query  463  ERTFLSLDVLDELPDSVDDIFFTIFEDKFGQGHQRVWKNVKPILEAIVAA  512
             +  L+LD L+  P  +       FED+F   H     +V+P+LE + AA
Sbjct  707  -QKRLTLDKLESFPVGMGGYLRQYFEDQFTALHYET--SVRPLLEVLCAA  753

>PHYSO_470533
Length=1084

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 97/422 (23%), Positives = 174/422 (41%), Gaps = 82/422 (19%)

Query  222  RVWALDRVKEWIESNFKSE---------NDHILTIIGEGGSGKSTLAGYICQKFDAKLHA  272
            R W  +R ++W++ +             N  +  ++G+ GSGK+++A  + Q    ++ A
Sbjct  472  REWLFERFQQWVQGSTTLSTSTQTGELINRRVFWLVGQIGSGKTSVAAQMVQTC-PEIAA  530

Query  273  YHFCQFdrksrsssrdvvlslvsQFASKNPLYKRQLTCLN-LRYILKESNPLVMANKLLI  331
            +HF + + +   ++R  VLSL  Q  ++ P Y   L     L  ++  ++ + + ++LLI
Sbjct  531  FHFARQEDEQTHNARRCVLSLAYQLTTQLPEYAHYLQSHEPLEEMVPVASFVELVSQLLI  590

Query  332  EPLRAIPVSNSTRGFVLF-DGIDQCLVENESND----------------LLDLISHITQR  374
             PL AI    + +  VL  DGI + L+ N S+                 L+ ++  +  R
Sbjct  591  GPLNAIARPTTYKSLVLLIDGI-EWLIPNSSSSAPSMPTLSGGSKDEECLVSMLPALASR  649

Query  375  FPSCIGFVVTSKASPAFDAK---FKSKSII--HLHERNG----KFMNDSRILMENSILNF  425
             P  +  VV S+  P   +K   F+   +I  H    N     +++N S   +  S ++F
Sbjct  650  LPDWVRVVVLSREDPPVLSKLHAFEPADVIIDHFQHENDHDIRRYLNLSLSKLPLSEVDF  709

Query  426  EPKHTNEACDI---------------LMRKSGGNGLYLQFTERALSHPILHGERTFLSLD  470
              K + +A D+               + R+S G  LY     +A++          L L 
Sbjct  710  A-KASEQAVDVPANNHEFGLEQVVELIARRSEGLFLYAVNVVQAIT-------EGRLRLH  761

Query  471  VLDELPDSVDDIFFTIFEDKFGQGHQRVWKNVKPILEAIVAAAAGSHPLVGERQIKQRFQ  530
             L ELP  +       F   F   H    + V+P+LE ++ AA    PL    ++     
Sbjct  762  ELAELPVGMGAYLQQFFASHFSD-HDMYKQRVRPVLE-VLCAAYEPLPLATLARVL----  815

Query  531  LGKEEWRMMKR----SFTDIICCGTEGY-------RIITSSLFAWLIVENRSQHFYIDPK  579
                EW + ++    S    + C   GY       R   SS+  W+   N S  F++D  
Sbjct  816  ----EWDVYEQRDASSVLGSLFCIEAGYDANSQLLRPFHSSVLDWIQDSNSSGDFFVDVA  871

Query  580  AG  581
            +G
Sbjct  872  SG  873

>PYIR_14107
Length=1176

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 81/349 (23%), Positives = 144/349 (41%), Gaps = 72/349 (21%)

Query  222  RVWALDRVKEWIESNFKSENDHILTIIGEGGSGKSTLAGYICQKFDAKLHAYHFCQFdrk  281
            R W   +++ WI S   ++   +  + G+ GSGK+ LA  + Q    ++ A+HF   + +
Sbjct  550  REWLFMQLENWIASPTATQ---VFWVTGQIGSGKTALAARMVQVI-PEIAAFHFALQEDE  605

Query  282  srsssrdvvlslvsQFASKNPLYKRQLTCLN-LRYILKESNPLVMANKLLIEPLRAIPVS  340
               ++R  VLSL  Q  ++ P Y   L     L  I+  SN   +  +LL+EPL  I   
Sbjct  606  QTQNARRCVLSLAYQLTTQLPQYALFLQSREPLEEIVPVSNFATLVTRLLVEPLNEIARP  665

Query  341  NSTRGFVLF-DGIDQ-------------------------------CLVENESND--LLD  366
             ST+  VL  DG++                                C   + S D  L+ 
Sbjct  666  QSTKPLVLLIDGLEHLSSGKNSQLMTPGTSMGRPSFARSSGSNFGDCCNSSPSGDECLVS  725

Query  367  LISHITQRFPSCIGFVVTSKASPAFDAKFK--SKSIIHLHERNGKFMNDSRILMENSILN  424
             +  +  R P+ +  V+ S+  PA  AK +  + SI+ L     +   D +  +EN +  
Sbjct  726  ALPSLVARLPNWVRVVLLSRLDPAIVAKLQGYTPSIV-LDSLKSESQQDIKRYVENMLGE  784

Query  425  ---------------------FEPKHTNEACDILMRKSGGNGLYLQFTERALSHPILHGE  463
                                 F  K + E  D+++++S G  LY     +++       E
Sbjct  785  SPATTLRRGIYGSASSTGASVFSNKLSPEQVDLIVKRSEGLFLYAVNIVQSI-------E  837

Query  464  RTFLSLDVLDELPDSVDDIFFTIFEDKFGQGHQRVWKNVKPILEAIVAA  512
               L++D L+ LP  +   F   F+  F +  Q+   +++P+LE + A+
Sbjct  838  EKRLAVDQLESLPIGMGGYFRQFFDGHFDE--QQYQDSIRPVLEVLCAS  884

>PYU1_G002110
Length=999

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 91/390 (23%), Positives = 165/390 (42%), Gaps = 53/390 (14%)

Query  222  RVWALDRVKEWIESNFKSENDHILTIIGEGGSGKSTLAGYICQKFDAKLHAYHFCQFdrk  281
            R W + ++ +WI+S   S+   +  + G+ GSGK+ LA  + Q    ++ A+HF   + +
Sbjct  432  RKWLIAQLTKWIDSPTASQ---MFWVTGQIGSGKTALAARLVQTI-PEIKAFHFAFEEDE  487

Query  282  srsssrdvvlslvsQFASKNPLYKRQLTCLNLRYILKESNPLVMANK----LLIEPLRAI  337
               ++R  VLSL  Q  ++    K     L  R  L+E  P+   N+    LLI+PL  I
Sbjct  488  QTQNARRCVLSLAYQLTTQ---LKDYAAFLQAREPLEELVPVSTFNELVTHLLIKPLNEI  544

Query  338  P--VSNSTRGFVLFDGIDQCLVENESND---------------LLDLISHITQRFPSCIG  380
                S +T   +L DG++  L + +S+                L+  +  +  + P  + 
Sbjct  545  AQLQSQNTPLVLLIDGLEN-LSDGKSDVSSLPVMTSRQSFAQCLVSALPSLVSQLPKWVR  603

Query  381  FVVTSKASPAFDAK---FKSKSIIHLHERNGK-----FMNDSRILMENSILNFEPKHTNE  432
             +V S+  PA +AK   F    ++  + +  K     F+  S     ++ L+       +
Sbjct  604  VIVLSRNDPAINAKLQNFTPNIVLEAYVKENKEDIKQFIEKSLCSSASTGLSSGKTLPPD  663

Query  433  ACDILMRKSGGNGLYLQFTERALSHPILHGERTFLSLDVLDELPDSVDDIFFTIFEDKFG  492
              D+++ +S G  LY     ++L       E+ F    V   LP  ++   +  F   FG
Sbjct  664  QIDLIVERSEGLFLYAANVVQSLE------EKWF---AVGQSLPIGMNGYLYDFFVSHFG  714

Query  493  QGHQRVWKNVKPILEAIVAAAAGSHPLVGERQIKQRFQLGKEEWRMMKRSFTDIICCGTE  552
                +  + ++P+LE + AA     PL     I    +L   E + +  +F  ++  G +
Sbjct  715  AKQYK--RLIRPVLEVLCAAF---EPL-SLPTIASILKLQTNEQQEIATAFGSLLSIGAD  768

Query  553  G-YRIITSSLFAWLIVENRSQHFYIDPKAG  581
            G  R   SS+  W+        FY+D   G
Sbjct  769  GSVRPFHSSVLNWVQELQSVDPFYVDVATG  798

>PYAP_22230
Length=1116

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 91/418 (22%), Positives = 164/418 (39%), Gaps = 91/418 (22%)

Query  222  RVWALDRVKEWIESNFKSENDHILTIIGEGGSGKSTLAGYICQKFDAKLHAYHFCQFdrk  281
            R W L+ +++WI +   S    +  + G+ GSGK+++A  + Q    ++ A+HF   D  
Sbjct  496  RAWLLESIRQWINTPVTS-GSKVFWVTGQIGSGKTSVAARMVQLM-PEIAAFHFALQDDD  553

Query  282  srsssrdvvlslvsQFASKNPLYKRQL-TCLNLRYILKESNPLVMANKLLIEPLRAIPVS  340
                +R  VLSL  Q  ++ P Y   L T   L  I+  S+   +   LL+ PL AI   
Sbjct  554  QTQLARRCVLSLAYQLTTQLPEYAVFLQTGDPLEEIVPVSSVQALLTHLLVNPLNAIARP  613

Query  341  NSTRGFVLF-DGIDQCLVENE---------------------------------SND--L  364
             S +  VL  DG++  +  N+                                 S+D  L
Sbjct  614  KSDKPVVLLIDGLEHLVSTNDNVAGGPPALRPSLGRGTGSTNSTTASLCDESSGSSDECL  673

Query  365  LDLISHITQRFPSCIGFVVTSKASPAFDAKFK--SKSI-IHLHERNGKFMNDSRILMENS  421
            + L+  +  R P  +  ++ S+  P+   K +  + SI +  HER  +   D R  +E +
Sbjct  674  VSLLPSLISRLPLWVRVILLSREDPSILLKLQVYTPSIALDRHERENE--ADIREFVEMA  731

Query  422  ILNFEPKHTN---------------------------------EACDILMRKSGGNGLYL  448
            + + +P+ ++                                 E  +++ ++S G  LY 
Sbjct  732  LCSPDPQSSHISRTVQVAPPIRHRSPSITALSVSDNTPRKISAEQVEVITKRSEGLFLYA  791

Query  449  QFTERALSHPILHGERTFLSLDVLDELPDSVDDIFFTIFEDKFGQGHQRVWKNVKPILEA  508
                +A+       E   L++D L+ LP  +       FE  F     +    ++P+LE 
Sbjct  792  ANIVQAI-------EEGRLAVDQLETLPVGLGGYLRQFFESHFDDATYKT--KIRPVLEV  842

Query  509  IVAAAAGSHPLVGERQIKQRFQLGKEEWRMMKRSFTDIICCGTEGY-RIITSSLFAWL  565
            + AA     P+     +   F     E + M  SF+ ++    + Y R   SS+  W+
Sbjct  843  LCAA---YEPMTTA-MLASIFHWSTYEQQEMASSFSALLFVSDDDYVRPFHSSVLEWV  896

>PPTG_11365
Length=1106

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 71/339 (21%), Positives = 136/339 (40%), Gaps = 57/339 (17%)

Query  222  RVWALDRVKEWIESNFKSE------NDHILTIIGEGGSGKSTLAGYICQKFDAKLHAYHF  275
            R W  ++ + W++ +  S       N  +  ++G+ GSGK+++A  + Q    ++ A+H 
Sbjct  503  REWLFEQFQRWVQGSAASSSTRELSNQRVFWVVGQIGSGKTSVAACMVQSC-PEIAAFHL  561

Query  276  CQFdrksrsssrdvvlslvsQFASKNPLYKRQLTCLN-LRYILKESNPLVMANKLLIEPL  334
               + +   ++R  +LSL  Q  ++ P Y   L     L  ++  ++ + +   LLI PL
Sbjct  562  ATQEDEQTHNARRCILSLAYQLTTQLPEYAHYLQSHEPLEEMVPVASFVELVTHLLIGPL  621

Query  335  RAIPVSNSTRGFVLF-DGIDQCLVENESNDL-----------------LDLISHITQRFP  376
             AI   +  +  VL  DG++  +  + S+ +                 + ++  +  R P
Sbjct  622  TAIARPSKYKSLVLLIDGVEWLIPASSSSQMPPFSGGSWRENKDEECFVSMLPMLVSRLP  681

Query  377  SCIGFVVTSKASPAFDAKFKS-----KSIIHLHERNG----KFMNDSRILMENSILNFEP  427
              +  V+ S+  P   +K ++      +I      N     +++N S   ++ S + FE 
Sbjct  682  EWVRIVLLSREEPPVLSKLRAFDPPDVTIEQFKHENDQDIRRYINHSLSKLQLSEVEFEK  741

Query  428  KHTN--------------EACDILMRKSGGNGLYLQFTERALSHPILHGERTFLSLDVLD  473
                              +  +++ R+S G  LY     +A+S   LH       L  L 
Sbjct  742  AAAQIGTDSGNNHEFGMEQVVELIARRSEGLFLYAVNVVQAISEGRLH-------LHELA  794

Query  474  ELPDSVDDIFFTIFEDKFGQGHQRVWKNVKPILEAIVAA  512
            ELP  +       F   F   H      V+P+LE   AA
Sbjct  795  ELPVGMGAYLQQFFASHFAD-HDMYKHRVRPVLEVCCAA  832

>PITG_17250
Length=1046

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 93/406 (23%), Positives = 160/406 (39%), Gaps = 58/406 (14%)

Query  222  RVWALDRVKEWIESNFKS----ENDHILTIIGEGGSGKSTLAGYICQKFDAKLHAYHFCQ  277
            R W     + W++ +  S     N  +  +IG+ GSGKS++A  + Q    ++ A+HF  
Sbjct  450  REWLFQLFQRWVQGSAASTRELSNQRVFWVIGQIGSGKSSVAACMVQAC-PEIAAFHFAT  508

Query  278  FdrksrsssrdvvlslvsQFASKNPLYKRQLTCLN-LRYILKESNPLVMANKLLIEPLRA  336
             + +   ++R  VLSL  Q  ++ P Y   L     L  ++  ++ + +   LLI PL A
Sbjct  509  QEDEQTHNARRCVLSLAYQLTTQLPEYAHYLQSHEPLEEMVPVASFVELVTHLLIGPLNA  568

Query  337  IPVSNSTRGFVLF-DGIDQCLVEN----------ESND---LLDLISHITQRFPSCIGFV  382
            I   +  +  VL  DG++  L  +          ES D   L+ ++  +  R P  +  V
Sbjct  569  IARPSKYKSLVLLIDGVEWLLPASCTPVNGGSWRESKDEECLVSMLPMLVSRLPEWVRIV  628

Query  383  VTSKASPAFDAKFKSKSIIHLHERNGKFMNDSRI---------LMENSILNFEPKHTN--  431
            + S+  P   +K  +     +     K  ND  I          +  S ++FE       
Sbjct  629  LLSREEPPVLSKLHAFDPPDVIIEQFKLQNDQDIRRFISSSLSKLNLSDVDFEQASAQIG  688

Query  432  -----------EACDILMRKSGGNGLYLQFTERALSHPILHGERTFLSLDVLDELPDSVD  480
                       +  +++ R+S G  LY     +A+S          L L  L ELP  + 
Sbjct  689  SGSDTGEFGMEQVVELIARRSEGLFLYAVNVVQAIS-------EGRLRLHELAELPVGMG  741

Query  481  DIFFTIFEDKFGQGHQRVWKNVKPILEAIVAAAAGSHPLVG-ERQIKQRFQLGKEEWRMM  539
                  F   F   H      ++P+LE +  AA    PL    R ++      ++   M+
Sbjct  742  AYLHQFFASHFAD-HDVYKHRIRPVLE-VCCAAYEPLPLATLARVLEWDVYEQRDAAAML  799

Query  540  KRSFTDIICCG----TEGYRIITSSLFAWLIVENRSQHFYIDPKAG  581
               F+  I  G     +  R   SS+  W+   N S  F++D  +G
Sbjct  800  GSLFS--IEAGHDPEAQLLRPFHSSVLDWVRDSNSSGVFFVDVASG  843

>PYVX_21513
Length=1446

 Score = 52.8 bits (125),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 79/349 (23%), Positives = 136/349 (39%), Gaps = 74/349 (21%)

Query  222  RVWALDRVKEWIESNFKSENDHILTIIGEGGSGKSTLAGYICQKFDAKLHAYHFCQFdrk  281
            R W   RV++WI  +    +  +  I G+ GSGK+++A  + Q F  ++ A+HF   +  
Sbjct  438  RDWLFKRVQQWINDSSSGTDHRVFWITGQIGSGKTSVAARMVQTF-PEIAAFHFALQEDD  496

Query  282  srsssrdvvlslvsQFASKNPLYKRQLTCLNLRYILKESNPL----VMANKLLIEPLRAI  337
                +R  VLSL  Q  ++ P Y      L  R  L+E  P+     +   LL+EPL  I
Sbjct  497  QTHIARRCVLSLAYQLTTQLPEYG---VFLQSREPLEEIVPVSTFHTLVTHLLVEPLNTI  553

Query  338  PVSNSTRGFVLFDGIDQCLVENES-----------------NDLLDLISHITQRFPSCIG  380
                     +L DG+ +C+V   +                   L+ ++  +  R PS + 
Sbjct  554  KRPAKPL-ILLIDGL-ECIVSGATLSAPGLSLGGPPPAVLDGCLVTMLPSLVARLPSWVR  611

Query  381  FVVTSKASPAFDAKFK----SKSIIHLHERN----GKFMND-------------------  413
             V+ S+       + +    S  I H  + N     KF+                     
Sbjct  612  LVLLSREDHDVMTRLQTYIPSVVIDHFAQENECDIKKFVGSALAPKKSLADIVEAATAET  671

Query  414  ---SRILMENSILNF------EPKHTNEACDILMRKSGGNGLYLQFTERALSHPILHG-E  463
               SR+      ++F       P  T E  +++ R++ G  LY        +  I+ G E
Sbjct  672  SGRSRLTTLARHVSFIRSPRNRPGATTEQIEMIARRAEGLFLY--------AANIVQGIE  723

Query  464  RTFLSLDVLDELPDSVDDIFFTIFEDKFGQGHQRVWKNVKPILEAIVAA  512
               ++L+ LD+LP  +       F+  F     +    ++P LE + AA
Sbjct  724  EGRVALNELDKLPTGMGGCLRQFFDSHFDDNTYKT--TIRPALEVLCAA  770

>PPTG_03602
Length=382

 Score = 35.4 bits (80),  Expect = 0.83, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 23/42 (55%), Gaps = 0/42 (0%)

Query  476  PDSVDDIFFTIFEDKFGQGHQRVWKNVKPILEAIVAAAAGSH  517
            P  +D +  +IF   FGQ  QR  K +  +LE IV+ A+  H
Sbjct  112  PSDIDRVHNSIFNRLFGQNGQRATKTISKLLEGIVSRASMPH  153

Lambda      K        H        a         alpha
   0.319    0.135    0.393    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 45060397200

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40