Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
CCA188991475634334317290.0
CCI451231475630130112312e-170
CCI451271609872022027766e-103
PYIR_13451147563593537301e-93
PYU1_G001735147563423317262e-93
PYAP_17762147563483226778e-86
PHYSO_471523147563483296682e-84
PHALS_06478147563453406663e-84
PPTG_17127147563513406639e-84
PYIW_19971147563483386578e-83
PITG_18456147563513446551e-82
PHYCA_556162147563513296525e-82
PHYRA_81100147563493306509e-82
PYVX_18171147562943345902e-73
PHYKE_8393147563263435202e-62
PYAR_13570147563223195141e-61
SDRG_01781147563353324071e-45
SPRG_06336147563353324071e-45
H310_09223147563333333546e-38
H257_06294147563583553461e-36
PHYRA_849161612815411111377e-08
PHYSO_3617471612815231111342e-07
HYAP_086451612815141111314e-07
PPTG_188981612815591111288e-07
PITG_205621612815591111289e-07
PYAR_23286161286071101271e-06
PYU1_G0063471612810951111271e-06
H310_002311612814951581271e-06
PHYKE_19901612814991111217e-06
H257_067221612814821691208e-06
PYIW_17381161289521101181e-05
SDRG_127631251091317351144e-05
PYIR_215891612815681101136e-05
PYVX_204381612813461101136e-05
CCA18875161281514361092e-04
PYAP_169971612810181101092e-04
CCI44752161281526361092e-04
SPRG_060591251091312351092e-04
SPRG_06058161281258411092e-04
H310_002301251091248351073e-04
H257_067211251091238351055e-04
SDRG_12762161281392351056e-04
PHYKE_24791445917132960.002
PYU1_G00106314459783321010.002
PYAP_1729014459835321000.002
PHYKE_5678241780934990.003
PHALS_065331445993032990.003
PHYRA_778341445993632980.004
PYVX_135741445995032980.004
PITG_180671445992432970.004
PPTG_134011445992732970.004
PYIR_153091445993732970.005
PYIW_131721445993932970.005
PYAR_199141445978832970.005
PHYCA_50311215292621432930.006
PITG_11303931829330940.008
CCI412251445998132950.008
PYVX_18338241774676950.009
CCA21715241778258950.009
CCA2186015507878258950.009
CCA164871445997532950.009
PHYSO_344112241781334940.010
PHYCA_506137241781034940.011
PPTG_05519241781034940.011
PITG_02762241781034940.011
PYIW_18480241775534940.011
PHYRA_79281241780934940.011
PYAP_22646241781534940.012
HYAP_08026241779834940.012
CCI1048915870977760930.016
CCI4245715292690632930.016
PYIR_13120241781460930.017
H257_0336112342869964920.017
PYU1_G004386241783734910.024
SPRG_1702213189210758840.030
PHALS_03645241783034900.030
PYAR_19883241783334900.033
CCA1710215292688432900.039
PYIR_1745395112619133900.040
SPRG_119001660550880.049
H310_070709639680125880.050
H310_063781445983732880.061
CCI40991241780126870.072
H257_135671445983632870.073
SDRG_03175640393448870.084
SPRG_01654640392348870.084
H257_013088632897111870.090
PYIR_226673199749227860.10
PYU1_G0092499511258048860.12
PHYSO_3436291445997723850.13
SDRG_05150241778758840.18
PHALS_06336185251150840.18
CCA190339511188332840.19
SPRG_08346241779758840.20
PYAR_1869095112455117840.20
PITG_02109185352253830.21
PPTG_14630185339853820.23
PHALS_06568185338846820.26
SPRG_0275212342883155820.30
H257_039319639695115820.30
SDRG_1448712342896455820.31
H310_01921185334153810.35
SDRG_03531122272255106800.38
H310_066668632887111810.42
CCI39615813036191800.42
PPTG_045531431390423810.44
SDRG_088001445988132810.46
PHYRA_735351431387523810.48
H310_140199204683121800.49
H257_03363185331647790.49
PYAP_1738598995123651810.51
PITG_178931431374723800.52
PYAP_1629795112466114810.52
PYU1_G01285918501183136800.54
PYU1_G0032291681050800.58
PHYSO_5561641431376523800.60
HYAP_08248749078427790.65
SDRG_021352194430632780.65
SDRG_14486185330854780.69
SPRG_02753185330954780.74
CCI458959511172132790.75
H310_07701241781134790.78
H257_07514241781034790.81
CCI393672885204647790.82
PYIR_1511813479122285790.85
SPRG_054491445972332780.86
PYU1_G0095089576532867770.86
SDRG_062881664136780.87
SPRG_143129639661115780.89
PHYKE_4910185237540770.93
PYVX_145276030126953781.1
CCA191181109212544731.1
SDRG_08236863286471771.2
PHYRA_7881516919137771.2
CCI4623515267115554771.3
PYIW_1891113479119649771.4
PYAP_1863615267100931771.5
PYIW_169871526782131761.5
H310_0880316916204761.6
PHYKE_491118534631671.6
PHYRA_7353469686121023761.7
SPRG_01860863267471761.7
PYIR_23012863296574761.7
SDRG_014071526781531761.7
SDRG_0008012454429839751.8
PPTG_1075537972347761.8
PITG_0041637969847761.8
PHYRA_8254315267119931761.8
PPTG_1937115267119531761.8
H257_030931526797531761.8
PYU1_G0088481526776531761.8
PYIW_211089511259348761.8
H257_051751643067869761.9
PYAR_1546315267109131761.9
H310_048431526796831761.9
H310_046671643068069751.9
PHYSO_54459815267116331761.9
SPRG_00364122272255107742.0
H310_06667138868896117752.0
CCA155132885134148762.0
H257_06469219447619682.0
PHYRA_8204086321054128752.0
PHYSO_478611185352253752.0
PITG_1921315267120131752.1
CCA1802315267113831752.1
SPRG_008901526788331752.2
PYIR_1838215267115431752.2
PYVX_1331215267101631752.3
PYIW_178181850118832752.4
PHALS_035401690428742.6
H257_081821685949742.6
PHALS_0409815267118331752.7
PYU1_G01126161471328124752.7
PHYCA_504801185339853742.7
PHALS_125031151734031732.8
HYAP_0930413479114430742.9
HYAP_061012885984129743.0
CCA190971856688107743.2
CCA24531185337431733.3
SDRG_1428614313670124733.4
SPRG_091281431362030733.4
CCI47145185339053733.5
SDRG_05567819598034733.6
SPRG_06021819598334733.6
CCA2551013479113930733.6
HYAP_0445715267120331733.7
SPRG_14955749063531733.8
CCI434561109212629693.8
PHYCA_5642968632957132734.0
PYU1_G01227415835873131734.0
PHYKE_7856288534620724.2
PHYSO_558498863296776734.3
PYVX_233491431392423734.3
SDRG_14070749063031724.3
HYAP_112953199689235724.5
PYIR_144941681928724.5
PYIR_15898304118321724.7
H257_0130913886889559725.0
PYIR_2458885060909130725.0
SDRG_056081109212123685.1
PITG_0002016927137725.1
SPRG_16312131322261114715.3
PYIR_2337215835141545725.4
PYVX_1917215419140876725.5
PPTG_1898913479121330725.6
H257_098231431365426725.6
SPRG_025021109212123685.7
PHYRA_8194413479114997725.8
H257_02642640397536725.9
PHYKE_1044863252176716.0
PHYSO_563553749079727716.0
PHALS_0793013479120030726.1
PHYCA_5399813199712228716.1
PYVX_1308413479126730716.3
H257_007291109212123676.4
CCA22367319988530716.4
PHYSO_5522473199746228716.4
H257_124762098661124716.5
PHYSO_52993195112211136716.7
H310_010941109212123676.8
PYAR_192918506071120716.9
PYAP_24144158351022166717.1
HYAP_137571151726231707.2
PYAR_1612089651057113717.2
PYAP_234788506089720717.3
PHYRA_944092885127020717.5
H310_0091295112182123717.5
PYIR_13555185335553707.6
H310_030253199645126707.6
PYAP_167348195131468717.6
PHYRA_73430185339553707.7
PITG_033182885134320717.8
PYU1_G0007249278718920687.8
SPRG_0088912251899448708.0
PPTG_160442885137820718.0
PHYSO_2484812885128320718.0
PYU1_G012870185335253708.1
PHYKE_66621526776531708.1
H310_14473749061330708.5
CCI4379313479111730708.5
PHYKE_55881675128708.6
PYAR_1349181951080123708.7
SDRG_0140812251891631708.8
PPTG_166591691628709.1
CCA250928130357111699.3
H310_029338195105321709.4
PYAR_21162304113521709.4
PHALS_066369511238631709.5
PITG_1157895112131124709.5
PYU1_G00742385060928237010.0
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= CCA18899

Length=343
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

CCA18899                                                              670        0.0   
CCI45123                                                              478        2e-170
CCI45127                                                              303        6e-103
PYIR_13451                                                            285        1e-93 
PYU1_G001735                                                          284        2e-93 
PYAP_17762                                                            265        8e-86 
PHYSO_471523                                                          261        2e-84 
PHALS_06478                                                           261        3e-84 
PPTG_17127                                                            259        9e-84 
PYIW_19971                                                            257        8e-83 
PITG_18456                                                            256        1e-82 
PHYCA_556162                                                          255        5e-82 
PHYRA_81100                                                           254        9e-82 
PYVX_18171                                                            231        2e-73 
PHYKE_8393                                                            204        2e-62 
PYAR_13570                                                            202        1e-61 
SDRG_01781                                                            161        1e-45 
SPRG_06336                                                            161        1e-45 
H310_09223                                                            140        6e-38 
H257_06294                                                            137        1e-36 
PHYRA_84916                                                           57.4       7e-08 
PHYSO_361747                                                          56.2       2e-07 
HYAP_08645                                                            55.1       4e-07 
PPTG_18898                                                            53.9       8e-07 
PITG_20562                                                            53.9       9e-07 
PYAR_23286                                                            53.5       1e-06 
PYU1_G006347                                                          53.5       1e-06 
H310_00231                                                            53.5       1e-06 
PHYKE_1990                                                            51.2       7e-06 
H257_06722                                                            50.8       8e-06 
PYIW_17381                                                            50.1       1e-05 
SDRG_12763                                                            48.5       4e-05 
PYIR_21589                                                            48.1       6e-05 
PYVX_20438                                                            48.1       6e-05 
CCA18875                                                              46.6       2e-04 
PYAP_16997                                                            46.6       2e-04 
CCI44752                                                              46.6       2e-04 
SPRG_06059                                                            46.6       2e-04 
SPRG_06058                                                            46.6       2e-04 
H310_00230                                                            45.8       3e-04 
H257_06721                                                            45.1       5e-04 
SDRG_12762                                                            45.1       6e-04 
PHYKE_2479                                                            41.6       0.002 
PYU1_G001063                                                          43.5       0.002 
PYAP_17290                                                            43.1       0.002 
PHYKE_5678                                                            42.7       0.003 
PHALS_06533                                                           42.7       0.003 
PHYRA_77834                                                           42.4       0.004 
PYVX_13574                                                            42.4       0.004 
PITG_18067                                                            42.0       0.004 
PPTG_13401                                                            42.0       0.004 
PYIR_15309                                                            42.0       0.005 
PYIW_13172                                                            42.0       0.005 
PYAR_19914                                                            42.0       0.005 
PHYCA_503112                                                          40.4       0.006 
PITG_11303                                                            40.8       0.008 
CCI41225                                                              41.2       0.008 
PYVX_18338                                                            41.2       0.009 
CCA21715                                                              41.2       0.009 
CCA21860                                                              41.2       0.009 
CCA16487                                                              41.2       0.009 
PHYSO_344112                                                          40.8       0.010 
PHYCA_506137                                                          40.8       0.011 
PPTG_05519                                                            40.8       0.011 
PITG_02762                                                            40.8       0.011 
PYIW_18480                                                            40.8       0.011 
PHYRA_79281                                                           40.8       0.011 
PYAP_22646                                                            40.8       0.012 
HYAP_08026                                                            40.8       0.012 
CCI10489                                                              40.4       0.016 
CCI42457                                                              40.4       0.016 
PYIR_13120                                                            40.4       0.017 
H257_03361                                                            40.0       0.017 
PYU1_G004386                                                          39.7       0.024 
SPRG_17022                                                            37.0       0.030 
PHALS_03645                                                           39.3       0.030 
PYAR_19883                                                            39.3       0.033 
CCA17102                                                              39.3       0.039 
PYIR_17453                                                            39.3       0.040 
SPRG_11900                                                            38.5       0.049 
H310_07070                                                            38.5       0.050 
H310_06378                                                            38.5       0.061 
CCI40991                                                              38.1       0.072 
H257_13567                                                            38.1       0.073 
SDRG_03175                                                            38.1       0.084 
SPRG_01654                                                            38.1       0.084 
H257_01308                                                            38.1       0.090 
PYIR_22667                                                            37.7       0.10  
PYU1_G009249                                                          37.7       0.12  
PHYSO_343629                                                          37.4       0.13  
SDRG_05150                                                            37.0       0.18  
PHALS_06336                                                           37.0       0.18  
CCA19033                                                              37.0       0.19  
SPRG_08346                                                            37.0       0.20  
PYAR_18690                                                            37.0       0.20  
PITG_02109                                                            36.6       0.21  
PPTG_14630                                                            36.2       0.23  
PHALS_06568                                                           36.2       0.26  
SPRG_02752                                                            36.2       0.30  
H257_03931                                                            36.2       0.30  
SDRG_14487                                                            36.2       0.31  
H310_01921                                                            35.8       0.35  
SDRG_03531                                                            35.4       0.38  
H310_06666                                                            35.8       0.42  
CCI39615                                                              35.4       0.42  
PPTG_04553                                                            35.8       0.44  
SDRG_08800                                                            35.8       0.46  
PHYRA_73535                                                           35.8       0.48  
H310_14019                                                            35.4       0.49  
H257_03363                                                            35.0       0.49  
PYAP_17385                                                            35.8       0.51  
PITG_17893                                                            35.4       0.52  
PYAP_16297                                                            35.8       0.52  
PYU1_G012859                                                          35.4       0.54  
PYU1_G003229                                                          35.4       0.58  
PHYSO_556164                                                          35.4       0.60  
HYAP_08248                                                            35.0       0.65  
SDRG_02135                                                            34.7       0.65  
SDRG_14486                                                            34.7       0.69  
SPRG_02753                                                            34.7       0.74  
CCI45895                                                              35.0       0.75  
H310_07701                                                            35.0       0.78  
H257_07514                                                            35.0       0.81  
CCI39367                                                              35.0       0.82  
PYIR_15118                                                            35.0       0.85  
SPRG_05449                                                            34.7       0.86  
PYU1_G009508                                                          34.3       0.86  
SDRG_06288                                                            34.7       0.87  
SPRG_14312                                                            34.7       0.89  
PHYKE_4910                                                            34.3       0.93  
PYVX_14527                                                            34.7       1.1   
CCA19118                                                              32.7       1.1   
SDRG_08236                                                            34.3       1.2   
PHYRA_78815                                                           34.3       1.2   
CCI46235                                                              34.3       1.3   
PYIW_18911                                                            34.3       1.4   
PYAP_18636                                                            34.3       1.5   
PYIW_16987                                                            33.9       1.5   
H310_08803                                                            33.9       1.6   
PHYKE_4911                                                            30.4       1.6   
PHYRA_73534                                                           33.9       1.7   
SPRG_01860                                                            33.9       1.7   
PYIR_23012                                                            33.9       1.7   
SDRG_01407                                                            33.9       1.7   
SDRG_00080                                                            33.5       1.8   
PPTG_10755                                                            33.9       1.8   
PITG_00416                                                            33.9       1.8   
PHYRA_82543                                                           33.9       1.8   
PPTG_19371                                                            33.9       1.8   
H257_03093                                                            33.9       1.8   
PYU1_G008848                                                          33.9       1.8   
PYIW_21108                                                            33.9       1.8   
H257_05175                                                            33.9       1.9   
PYAR_15463                                                            33.9       1.9   
H310_04843                                                            33.9       1.9   
H310_04667                                                            33.5       1.9   
PHYSO_544598                                                          33.9       1.9   
SPRG_00364                                                            33.1       2.0   
H310_06667                                                            33.5       2.0   
CCA15513                                                              33.9       2.0   
H257_06469                                                            30.8       2.0   
PHYRA_82040                                                           33.5       2.0   
PHYSO_478611                                                          33.5       2.0   
PITG_19213                                                            33.5       2.1   
CCA18023                                                              33.5       2.1   
SPRG_00890                                                            33.5       2.2   
PYIR_18382                                                            33.5       2.2   
PYVX_13312                                                            33.5       2.3   
PYIW_17818                                                            33.5       2.4   
PHALS_03540                                                           33.1       2.6   
H257_08182                                                            33.1       2.6   
PHALS_04098                                                           33.5       2.7   
PYU1_G011261                                                          33.5       2.7   
PHYCA_504801                                                          33.1       2.7   
PHALS_12503                                                           32.7       2.8   
HYAP_09304                                                            33.1       2.9   
HYAP_06101                                                            33.1       3.0   
CCA19097                                                              33.1       3.2   
CCA24531                                                              32.7       3.3   
SDRG_14286                                                            32.7       3.4   
SPRG_09128                                                            32.7       3.4   
CCI47145                                                              32.7       3.5   
SDRG_05567                                                            32.7       3.6   
SPRG_06021                                                            32.7       3.6   
CCA25510                                                              32.7       3.6   
HYAP_04457                                                            32.7       3.7   
SPRG_14955                                                            32.7       3.8   
CCI43456                                                              31.2       3.8   
PHYCA_564296                                                          32.7       4.0   
PYU1_G012274                                                          32.7       4.0   
PHYKE_7856                                                            32.3       4.2   
PHYSO_558498                                                          32.7       4.3   
PYVX_23349                                                            32.7       4.3   
SDRG_14070                                                            32.3       4.3   
HYAP_11295                                                            32.3       4.5   
PYIR_14494                                                            32.3       4.5   
PYIR_15898                                                            32.3       4.7   
H257_01309                                                            32.3       5.0   
PYIR_24588                                                            32.3       5.0   
SDRG_05608                                                            30.8       5.1   
PITG_00020                                                            32.3       5.1   
SPRG_16312                                                            32.0       5.3   
PYIR_23372                                                            32.3       5.4   
PYVX_19172                                                            32.3       5.5   
PPTG_18989                                                            32.3       5.6   
H257_09823                                                            32.3       5.6   
SPRG_02502                                                            30.8       5.7   
PHYRA_81944                                                           32.3       5.8   
H257_02642                                                            32.3       5.9   
PHYKE_1044                                                            32.0       6.0   
PHYSO_563553                                                          32.0       6.0   
PHALS_07930                                                           32.3       6.1   
PHYCA_539981                                                          32.0       6.1   
PYVX_13084                                                            32.0       6.3   
H257_00729                                                            30.4       6.4   
CCA22367                                                              32.0       6.4   
PHYSO_552247                                                          32.0       6.4   
H257_12476                                                            32.0       6.5   
PHYSO_529931                                                          32.0       6.7   
H310_01094                                                            30.4       6.8   
PYAR_19291                                                            32.0       6.9   
PYAP_24144                                                            32.0       7.1   
HYAP_13757                                                            31.6       7.2   
PYAR_16120                                                            32.0       7.2   
PYAP_23478                                                            32.0       7.3   
PHYRA_94409                                                           32.0       7.5   
H310_00912                                                            32.0       7.5   
PYIR_13555                                                            31.6       7.6   
H310_03025                                                            31.6       7.6   
PYAP_16734                                                            32.0       7.6   
PHYRA_73430                                                           31.6       7.7   
PITG_03318                                                            32.0       7.8   
PYU1_G000724                                                          30.8       7.8   
SPRG_00889                                                            31.6       8.0   
PPTG_16044                                                            32.0       8.0   
PHYSO_248481                                                          32.0       8.0   
PYU1_G012870                                                          31.6       8.1   
PHYKE_6662                                                            31.6       8.1   
H310_14473                                                            31.6       8.5   
CCI43793                                                              31.6       8.5   
PHYKE_5588                                                            31.6       8.6   
PYAR_13491                                                            31.6       8.7   
SDRG_01408                                                            31.6       8.8   
PPTG_16659                                                            31.6       9.1   
CCA25092                                                              31.2       9.3   
H310_02933                                                            31.6       9.4   
PYAR_21162                                                            31.6       9.4   
PHALS_06636                                                           31.6       9.5   
PITG_11578                                                            31.6       9.5   
PYU1_G007423                                                          31.6       10.0  

>CCA18899
Length=343

 Score = 670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/343 (100%), Positives = 343/343 (100%), Gaps = 0/343 (0%)

Query  1    MLPNINEQHLARYTPTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNA  60
            MLPNINEQHLARYTPTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYESKDSSKSKNA
Sbjct  1    MLPNINEQHLARYTPTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYESKDSSKSKNA  60

Query  61   TPKGSFILQSAEKHEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQW  120
            TPKGSFILQSAEKHEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQW
Sbjct  61   TPKGSFILQSAEKHEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQW  120

Query  121  LDVINNGLKASKCMAREAFMAEMDTTKSVLGFSYIGTTSKQQIQVLKSKKCDYIHEALQQ  180
            LDVINNGLKASKCMAREAFMAEMDTTKSVLGFSYIGTTSKQQIQVLKSKKCDYIHEALQQ
Sbjct  121  LDVINNGLKASKCMAREAFMAEMDTTKSVLGFSYIGTTSKQQIQVLKSKKCDYIHEALQQ  180

Query  181  IEMAKSAGNAACDEIVSQGEQLGKVEQNLSTIQNDLNHSEKLIKSIRHPLRYFFSRSRPH  240
            IEMAKSAGNAACDEIVSQGEQLGKVEQNLSTIQNDLNHSEKLIKSIRHPLRYFFSRSRPH
Sbjct  181  IEMAKSAGNAACDEIVSQGEQLGKVEQNLSTIQNDLNHSEKLIKSIRHPLRYFFSRSRPH  240

Query  241  DRATisksssihrshhhPGILHKTKKDRNVDHLAEEIRVPTNDIEKLAMALKDLEVQAQL  300
            DRATISKSSSIHRSHHHPGILHKTKKDRNVDHLAEEIRVPTNDIEKLAMALKDLEVQAQL
Sbjct  241  DRATISKSSSIHRSHHHPGILHKTKKDRNVDHLAEEIRVPTNDIEKLAMALKDLEVQAQL  300

Query  301  INSEAVKSNEQIARIEGQLSGINDRIQAQTSQVITSSGKQNLF  343
            INSEAVKSNEQIARIEGQLSGINDRIQAQTSQVITSSGKQNLF
Sbjct  301  INSEAVKSNEQIARIEGQLSGINDRIQAQTSQVITSSGKQNLF  343

>CCI45123
Length=301

 Score = 478 bits (1231),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 238/301 (79%), Positives = 271/301 (90%), Gaps = 1/301 (0%)

Query  44   MQVSYYEskdsskskNATPKGSFILQSAEKHEYWISQMVTGSVKEKPFGFKMVGHAPKQG  103
            MQVSYYESKDS K++NATPKGSFILQ+ EKHEYWIS+MVTGSVKE+PFGFKMVGHAPKQG
Sbjct  1    MQVSYYESKDSYKNRNATPKGSFILQNVEKHEYWISRMVTGSVKERPFGFKMVGHAPKQG  60

Query  104  YIELDVFVDSSSDMDQWLDVINNGLKASKCMAREAFMAEMDTTKSVLGFSYIGTTSKQQI  163
            Y+ELDVFVDS S+MDQWLDVINNGLKA+K MAREAFMAEMDTTK VLGFS+ GTTSKQQ+
Sbjct  61   YVELDVFVDSLSNMDQWLDVINNGLKANKRMAREAFMAEMDTTKGVLGFSFAGTTSKQQV  120

Query  164  QVLKSKKCDYIHEALQQIEMAKSAGNAACDEIVSQGEQLGKVEQNLSTIQNDLNHSEKLI  223
            + LKS+K DYIHEALQQIEMAKSAG+AACDEIV+QGEQLGKVEQNLS I++DLNHSEKLI
Sbjct  121  KELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQLGKVEQNLSNIESDLNHSEKLI  180

Query  224  KSIRHPLRYFFSRSRPHDR-ATisksssihrshhhPGILHKTKKDRNVDHLAEEIRVPTN  282
            KSIRHPLRYFFS++  H++ A    +++    HH  GILH  K D  ++H+AEEI VPTN
Sbjct  181  KSIRHPLRYFFSKTHHHEKDAMSKNNTNHRSHHHQTGILHMRKNDGKIEHVAEEICVPTN  240

Query  283  DIEKLAMALKDLEVQAQLINSEAVKSNEQIARIEGQLSGINDRIQAQTSQVITSSGKQNL  342
            D+EKLAMALK+LEVQAQLINSEAVKSN+QI RIEGQLSGINDRIQ+QT+QV+ SSGK+NL
Sbjct  241  DLEKLAMALKELEVQAQLINSEAVKSNDQITRIEGQLSGINDRIQSQTTQVVASSGKKNL  300

Query  343  F  343
            F
Sbjct  301  F  301

>CCI45127
Length=202

 Score = 303 bits (776),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 176/202 (87%), Gaps = 1/202 (0%)

Query  143  MDTTKSVLGFSYIGTTSKQQIQVLKSKKCDYIHEALQQIEMAKSAGNAACDEIVSQGEQL  202
            MDTTK VLGFS+ GTTSKQQ++ LKS+K DYIHEALQQIEMAKSAG+AACDEIV+QGEQL
Sbjct  1    MDTTKGVLGFSFAGTTSKQQVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQL  60

Query  203  GKVEQNLSTIQNDLNHSEKLIKSIRHPLRYFFSRSRPHDR-ATisksssihrshhhPGIL  261
            GKVEQNLS I++DLNHSEKLIKSIRHPLRYFFS++  H++ A    +++    HH  GIL
Sbjct  61   GKVEQNLSNIESDLNHSEKLIKSIRHPLRYFFSKTHHHEKDAMSKNNTNHRSHHHQTGIL  120

Query  262  HKTKKDRNVDHLAEEIRVPTNDIEKLAMALKDLEVQAQLINSEAVKSNEQIARIEGQLSG  321
            H  K D  ++H+AEEI VPTND+EKLAMALK+LEVQAQLINSEAVKSN+QI RIEGQLSG
Sbjct  121  HMRKNDGKIEHVAEEICVPTNDLEKLAMALKELEVQAQLINSEAVKSNDQITRIEGQLSG  180

Query  322  INDRIQAQTSQVITSSGKQNLF  343
            INDRIQ+QT+QV+ SSGK+NLF
Sbjct  181  INDRIQSQTTQVVASSGKKNLF  202

>PYIR_13451
Length=359

 Score = 285 bits (730),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 156/353 (44%), Positives = 225/353 (64%), Gaps = 37/353 (10%)

Query  12   RYTPTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNA-------TPKG  64
            ++ PTSCEGYVTKRGHFRKSWRVRYLV +G N+QV+YYES+D+SK  ++        PKG
Sbjct  23   KFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDASKGSSSSGGTGVPVPKG  82

Query  65   SFILQSAEKHEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVI  124
            SF + S EKHEYW+  M     +EKPFGFK+VGHAPK+GYIELD+FV+S  D+++W++V+
Sbjct  83   SFYVSSVEKHEYWVGVM---GGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVV  139

Query  125  NNGLKASKCMAREAFMAEMDTTKSVLGFSYIGTTSKQQIQVLKSKKCDYIHEALQQIEMA  184
             N L A+K  +R     +  TTK++ GFS    + + Q++ L + K D + +AL++IE A
Sbjct  140  QNALDAAKKRSRTGGFQDNSTTKTMFGFS-ASASPQLQVKKLAATKEDLLRDALREIEGA  198

Query  185  KSAGNAACDEIVSQGEQLGKVEQNLSTIQNDLNHSEKLIKSIRHPLRYFFS-----RSRP  239
            K  G  A +EIV QGE+L  VE +L  ++ DL+H++KL++ ++ P+ + FS     +  P
Sbjct  199  KLIGREAVNEIVVQGEKLDMVESDLGKVEGDLDHADKLLRHMKRPMLHLFSGDERVKQSP  258

Query  240  H--------DRATisksssihrshhhPG-ILHKTKKDRNVDHLAEEIRVPTNDIEKLAMA  290
            H        DRA+  ++          G  +H  + D              +D+EKLA+A
Sbjct  259  HTGGASGHTDRASHGQTPGTTNGGTAGGQQIHGQRND------------ALSDLEKLALA  306

Query  291  LKDLEVQAQLINSEAVKSNEQIARIEGQLSGINDRIQAQTSQVITSSGKQNLF  343
            L +LE QA L+N+EAVKS EQIAR+E +L+ +NDR+Q QT +   +    NLF
Sbjct  307  LGELEEQANLMNAEAVKSTEQIARVEQRLTAVNDRVQTQTKKANATMKAGNLF  359

>PYU1_G001735
Length=342

 Score = 284 bits (726),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 150/331 (45%), Positives = 215/331 (65%), Gaps = 11/331 (3%)

Query  15   PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEKH  74
            PTSCEGYVTKRGHFRKSWRVRYLV +G ++QVSY+ES+D++ +    PKGSF + S EKH
Sbjct  21   PTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKH  80

Query  75   EYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLKASKCM  134
            EYWI  M     KEKPFGFK+VGHAP +GYIELD+FV+S  D+++WL+V+ N L A+K +
Sbjct  81   EYWIGVM---GGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKL  137

Query  135  AREAFMAEMDTTKSVLGFSYIGTTSKQQIQV--LKSKKCDYIHEALQQIEMAKSAGNAAC  192
             R+      D+TKS+ GF   G +   Q+QV  L + K + + EAL++IE AK  G  A 
Sbjct  138  TRKGM---TDSTKSMFGF---GASISPQLQVKKLAATKEELLREALREIEGAKLIGREAV  191

Query  193  DEIVSQGEQLGKVEQNLSTIQNDLNHSEKLIKSIRHPLRYFFSRSRPHDRATisksssih  252
            +EIVSQGE+L +VE +L  ++ DL+H++KL++ ++ P+ + FS      +   + +++  
Sbjct  192  NEIVSQGEKLDQVENDLGHVEGDLDHADKLLRHLKSPVLHVFSNDNRQKKGAPTAATASA  251

Query  253  rshhhPGILHKTKKDRNVDHLAEEIRVPTNDIEKLAMALKDLEVQAQLINSEAVKSNEQI  312
                       +  +  +           ND+E LA+AL +LE QA L+N+EA +S EQI
Sbjct  252  SGGASATTSPVSGTEGQLHAKITGGGGTLNDLEMLALALSELEEQANLMNAEAARSTEQI  311

Query  313  ARIEGQLSGINDRIQAQTSQVITSSGKQNLF  343
            ARIE +L+ +NDR+Q QT +   +    NLF
Sbjct  312  ARIEERLTSVNDRVQHQTKKATATMKAGNLF  342

>PYAP_17762
Length=348

 Score = 265 bits (677),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 137/322 (43%), Positives = 209/322 (65%), Gaps = 6/322 (2%)

Query  15   PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEKH  74
            PTSCEGYVTKRGHFRKSWRVR+LV++G ++ VSYY+SK+ +++  A PKGSF L S EKH
Sbjct  29   PTSCEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKH  88

Query  75   EYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLKASKCM  134
            EY++  +     +EKPFGFKMVGHAP++GY+ELD+FV++  D+++WL+V  N L A+K +
Sbjct  89   EYYVGVL---GAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKL  145

Query  135  AREAFMAEMDTTKSVLGFSYIGTTSKQQIQVLKSKKCDYIHEALQQIEMAKSAGNAACDE  194
             R     E    KS+ GFS   T+ +QQ++ + + K   + +A+++IE AK  G +AC E
Sbjct  146  TRTG-QPEALAPKSLFGFS-PATSPQQQMKKMTATKEQMLKQAIEEIESAKLIGRSACQE  203

Query  195  IVSQGEQLGKVEQNLSTIQNDLNHSEKLIKSIRHPLRYFFSRSRPHDRATisksssihrs  254
            I  QGE+L  + Q L+ ++ DL++++KL++ +++P  + FS S   DRA  +  +     
Sbjct  204  IFIQGERLDHIGQELAHVEGDLDYADKLLRHMKNPGLHMFS-SDARDRAKNTGRTKPSSR  262

Query  255  hhhPGILHKTKKDRNVDHLAEEIRVPTNDIEKLAMALKDLEVQAQLINSEAVKSNEQIAR  314
                 +  +T+     D        P +DIE+LA  L +LE QA L+N EA+K   Q+ R
Sbjct  263  DTPSAVSEETRAAILSDSHDAVGGAPLSDIERLASLLGELEQQATLLNEEAIKGTAQVER  322

Query  315  IEGQLSGINDRIQAQTSQVITS  336
            +  QL+ +N+R++AQT +   S
Sbjct  323  VGEQLAHVNERVKAQTRKANAS  344

>PHYSO_471523
Length=348

 Score = 261 bits (668),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 142/329 (43%), Positives = 204/329 (62%), Gaps = 21/329 (6%)

Query  15   PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskds---skskNATPKGSFILQSA  71
            PTSCEGYVTKRGHFRKSWRVR+LV+ G N+ VSYYES+ +      + + PKGSF L S 
Sbjct  20   PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSI  79

Query  72   EKHEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLKAS  131
            E HEY +  M      EKPFGFKMVGHAP++GY+ELDVFV++ +D ++WL+V  N L A 
Sbjct  80   EPHEYVVGVM---GAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNALSAK  136

Query  132  KCMAREAFMAEMDTT-KSVLGFSY-----IGTTSKQQIQVLKSKKCDYIHEALQQIEMAK  185
            + + R+A    +    K++ GF+         + ++Q+Q L   + + + +AL+ IE AK
Sbjct  137  RQLTRQAIDQSVSPNRKNLFGFNISLSPQPNMSPQKQMQTLTKSRDELLSDALRDIEAAK  196

Query  186  SAGNAACDEIVSQGEQLGKVEQNLSTIQNDLNHSEKLIKSIRHPLRYFFS-RSRPHDRAT  244
              G  AC+EIV+QGE+L  +EQ+LS I  DL+  +KL++ ++ P  + FS  SRP   A+
Sbjct  197  QVGREACNEIVTQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSPTLHLFSDDSRPKASAS  256

Query  245  isksssihrshhhPGILHKTKKDRNVDHLAEEIRVPTNDIEKLAMALKDLEVQAQLINSE  304
             + S    +    P  L        +D + +      +D+E+LA AL +LEVQA+L+N E
Sbjct  257  KASSPQRSQQSGRPPRLPPA-----MDSIND---AGVSDLERLAQALGELEVQAELLNGE  308

Query  305  AVKSNEQIARIEGQLSGINDRIQAQTSQV  333
            A +  +QI RIE QLS +  R++ QT Q 
Sbjct  309  AGRGTQQIERIEHQLSNVTARVEKQTKQA  337

>PHALS_06478
Length=345

 Score = 261 bits (666),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 148/340 (44%), Positives = 208/340 (61%), Gaps = 25/340 (7%)

Query  15   PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNA---TPKGSFILQSA  71
            PTSCEGYVTKRGHFRKSWRVR+LV+ G N+QV+YYES+ +    N     PKGSF L + 
Sbjct  20   PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNI  79

Query  72   EKHEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLKAS  131
            E HEY I  M      ++PFGFKMVGHAP++G++ELDVFV++ +D ++WL+V  N LKA 
Sbjct  80   EPHEYVIGVM---GAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAK  136

Query  132  KCMAREAFMAEMDTT-KSVLGFSYIGTT-----SKQQIQVLKSKKCDYIHEALQQIEMAK  185
            + + R+A    +    K + GFS   +T      ++Q+Q L + K   + EAL++IE AK
Sbjct  137  RQLTRQAIDQSVSPNKKKLFGFSVPSSTQPVMSPQKQMQTLATSKEGLLLEALREIEAAK  196

Query  186  SAGNAACDEIVSQGEQLGKVEQNLSTIQNDLNHSEKLIKSIRHPLRYFFS-RSRPHDRAT  244
              G  AC+EIV+QGE+L  +EQ+LS I  DL+  +KL+  ++ P  +FFS  +RP     
Sbjct  197  LVGREACNEIVNQGEKLDVIEQDLSAIDRDLDFGDKLLHRLKSPTLHFFSDDTRP-----  251

Query  245  isksssihrshhhPGILHKTKKDRNVDHLAEEIRVPTNDIEKLAMALKDLEVQAQLINSE  304
                        HP     T   R +  +        +D+++LA AL +LEVQA+L+NSE
Sbjct  252  ------KVPLGDHPHHSGSTSPSRLIPAIEITRDAGVSDLQRLAQALGELEVQAELLNSE  305

Query  305  AVKSNEQIARIEGQLSGINDRIQAQTSQ-VITSSGKQNLF  343
            +  S++QI RIE  LS + +R++ QT Q V T S    LF
Sbjct  306  SGHSSQQIERIEHHLSHVTERVEKQTKQAVATLSAGPRLF  345

>PPTG_17127
Length=351

 Score = 259 bits (663),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 148/340 (44%), Positives = 208/340 (61%), Gaps = 19/340 (6%)

Query  15   PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskds---skskNATPKGSFILQSA  71
            PTSCEGYVTKRGHFRKSWRVR+LV+ G N+QVSYYES+ +      + + PKGSF L S 
Sbjct  20   PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSI  79

Query  72   EKHEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLKAS  131
            E HEY +  M      +KPFGFKMVGHAPK+GY+ELDVFVD+ +D ++WL+V  N L   
Sbjct  80   EPHEYVVGVM---GAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVK  136

Query  132  KCMAREAFMAEMDTTKSVL-GFSYI-----GTTSKQQIQVLKSKKCDYIHEALQQIEMAK  185
            + + R+A    +   K  L GFS         + ++Q+Q L   K + + EAL+++E AK
Sbjct  137  RQLTRQAIDQSVSPNKKTLFGFSVALSPQPAMSPQKQMQTLAKSKDELLSEALRELEAAK  196

Query  186  SAGNAACDEIVSQGEQLGKVEQNLSTIQNDLNHSEKLIKSIRHPLRYFFS-RSRPHDRAT  244
              G  AC+EIV QGE+L  +EQ+LS I  DL+  +KL++ ++ P  + FS  SRP  ++T
Sbjct  197  LVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFGDKLLRRLKSPTLHLFSDDSRP--KST  254

Query  245  isksssihrshhhPGILHKTKKDRNVDHLAEEIRVPTNDIEKLAMALKDLEVQAQLINSE  304
                 S  +  H  G    ++     D  ++      +D+E+LA AL +LEVQA+++N E
Sbjct  255  GGSKGSSPQRFHQSGGSSPSRLPPAFDTSSD---AGGSDLERLAQALGELEVQAEMLNGE  311

Query  305  AVKSNEQIARIEGQLSGINDRIQAQTSQV-ITSSGKQNLF  343
            A  S++QI RIE  L+ +  R++ QT Q   T S    LF
Sbjct  312  ASHSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  351

>PYIW_19971
Length=348

 Score = 257 bits (657),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 142/338 (42%), Positives = 207/338 (61%), Gaps = 16/338 (5%)

Query  12   RYTPTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSA  71
            ++  TSCEGYVTKRGHFRKSWRVRYLV +      +  ++     +  ATPKGSF + S 
Sbjct  21   KFKATSCEGYVTKRGHFRKSWRVRYLVFN-----GADLQAAGGGGASPATPKGSFFVSSV  75

Query  72   EKHEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLKAS  131
            EKHEYW+  M     +EKPFGFK+VGHAPK+GYIELD+FV++  D+++W++V+ N L A+
Sbjct  76   EKHEYWVGVM---GGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAA  132

Query  132  KCMAREAFMAEMDTTKSVLGFSYIGTTSKQ-QIQVLKSKKCDYIHEALQQIEMAKSAGNA  190
            K   R    A+  TTK++ GFS   T S Q Q++ L + K + + +AL++IE AK  G  
Sbjct  133  KKHTRTPGAADSSTTKNMFGFS--ATVSPQLQVKKLAATKEELLRDALREIEGAKLIGRE  190

Query  191  ACDEIVSQGEQLGKVEQNLSTIQNDLNHSEKLIKSIRHPLRYFFS---RSRP--HDRATi  245
            A  +I  QG +L  +E +L  +++DL+H  KL+  ++ P+ + FS   RS+P  H   + 
Sbjct  191  AVSDIKGQGGKLNMIEDDLGKVESDLDHGGKLLNHMKRPMLHLFSNDNRSKPNAHHSGSH  250

Query  246  sksssihrshhhPGILHKTKKDRNVDHLAEEIRVPTNDIEKLAMALKDLEVQAQLINSEA  305
            S     H   H        +      H  ++     +D+E+L +AL +LE QA  +N+EA
Sbjct  251  SDHKDGHSGAHPSSGGSSAETATGAQHHQQQDTSVMSDLERLVLALGELEEQATAMNAEA  310

Query  306  VKSNEQIARIEGQLSGINDRIQAQTSQVITSSGKQNLF  343
            VKS EQIAR+E +L+ +NDR+QAQT +   +    NLF
Sbjct  311  VKSTEQIARVEQRLTAVNDRVQAQTKKATATMKAGNLF  348

>PITG_18456
Length=351

 Score = 256 bits (655),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 146/344 (42%), Positives = 208/344 (60%), Gaps = 27/344 (8%)

Query  15   PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskds---skskNATPKGSFILQSA  71
            PTSCEGYVTKRGHFRKSWRVR+LV+ G N+QVSYYES+ +      + + PKG F L S 
Sbjct  20   PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSI  79

Query  72   EKHEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLKAS  131
            E HEY +  M      +KPFGFKMVGHAPK+GY+ELDVFVD+ +D ++WL+V  N L A 
Sbjct  80   EPHEYVVGVM---GAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALGAK  136

Query  132  KCMAREAFMAEMDT-TKSVLGFSY-----IGTTSKQQIQVLKSKKCDYIHEALQQIEMAK  185
            + + R+A    +    K++ GFS         + ++QIQ L   K + + +AL+++E AK
Sbjct  137  RQLTRQAIDQSVSPGKKNLFGFSVSLSPQPAMSPQKQIQTLSKSKDELLSQALRELEAAK  196

Query  186  SAGNAACDEIVSQGEQLGKVEQNLSTIQNDLNHSEKLIKSIRHPLRYFFS-RSRPHDRAT  244
              G  AC+EIV QGE+L  +EQ+LS I  DL+  +KL++ ++ P  + FS  SRP    +
Sbjct  197  LVGREACNEIVVQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSPTLHLFSDDSRPKSTGS  256

Query  245  isksssihrshhhPGILHKTKKDRNVDHLAEEIRVPTN----DIEKLAMALKDLEVQAQL  300
                         P   H++    +   L   + + ++    D+E+LA AL +LEVQA+L
Sbjct  257  --------SKGSSPQRSHQSGGS-SPTRLPPALEISSDAGVSDLERLAQALGELEVQAEL  307

Query  301  INSEAVKSNEQIARIEGQLSGINDRIQAQTSQV-ITSSGKQNLF  343
            +N EA +S++QI RIE  L+ +  R++ QT Q   T S    LF
Sbjct  308  LNGEAGRSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  351

>PHYCA_556162
Length=351

 Score = 255 bits (652),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 143/329 (43%), Positives = 203/329 (62%), Gaps = 18/329 (5%)

Query  15   PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskds---skskNATPKGSFILQSA  71
            PTSCEGYVTKRGHFRKSWRVR+LV+ G N+QV+YYES+ +   +  + + PKGSF L S 
Sbjct  20   PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSI  79

Query  72   EKHEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLKAS  131
            E HEY +  M       KPFGFKMVGHAPK+GY+ELDVFV++  D ++WL+V  N L A 
Sbjct  80   EPHEYVVGVMGAAG---KPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALSAK  136

Query  132  KCMAREAFMAEMDTT-KSVLGFSY-----IGTTSKQQIQVLKSKKCDYIHEALQQIEMAK  185
            + + R+A    +    K++ GFS         + ++Q+Q L   K D + +AL+ IE AK
Sbjct  137  RQLTRQAIDQSVSPNKKNLFGFSVSLSPQPALSPQKQMQTLTKNKDDLLSDALRDIEAAK  196

Query  186  SAGNAACDEIVSQGEQLGKVEQNLSTIQNDLNHSEKLIKSIRHPLRYFFSR-SRPHDRAT  244
              G  AC+EIV QGE+L  +EQ+LS I  DL+  +KL++ ++ P  + FS  SRP  ++T
Sbjct  197  QIGREACNEIVIQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSPTLHMFSNDSRP--KST  254

Query  245  isksssihrshhhPGILHKTKKDRNVDHLAEEIRVPTNDIEKLAMALKDLEVQAQLINSE  304
             S  ++  +     G    T+  +  +     I    +D+E+LA AL +LE+QA+L+N E
Sbjct  255  SSSKANSPQRSQQSGGSSPTRLAQAAE---SRIDPGASDLERLAQALGELELQAELLNDE  311

Query  305  AVKSNEQIARIEGQLSGINDRIQAQTSQV  333
            A  S +QI  IE  LS +  R++ QT Q 
Sbjct  312  AGHSTQQIQTIEHHLSTVTGRVEKQTKQA  340

>PHYRA_81100
Length=349

 Score = 254 bits (650),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 142/330 (43%), Positives = 198/330 (60%), Gaps = 22/330 (7%)

Query  15   PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNA---TPKGSFILQSA  71
            PTSCEGYVTKRGHFRKSWRVR+LV+ G N+Q+SYYES+ +     A    PKGSF L S 
Sbjct  20   PTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSI  79

Query  72   EKHEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLKAS  131
            E HEY +  M       KPFGFKM+GHAPK+GY+ELDVFV++  D ++WL+V  N L A 
Sbjct  80   EPHEYVVGVMGAAG---KPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAK  136

Query  132  KCMAREAFMAEMDTT-KSVLGFSYIGT-----TSKQQIQVLKSKKCDYIHEALQQIEMAK  185
            + + R+A    + +  K++ GF    +     T ++Q+Q L   K + +  AL+ IE AK
Sbjct  137  RQLTRQAIDQSVSSNKKNLFGFGVSLSPQPLMTPQKQMQTLTQNKDELLSGALRDIEAAK  196

Query  186  SAGNAACDEIVSQGEQLGKVEQNLSTIQNDLNHSEKLIKSIRHPLRYFFS-RSRPHDRAT  244
              G  AC+EIV QGE+L  +EQ+L  I  DL+  +KL++ ++ P  + FS  SRP   A+
Sbjct  197  LVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFGDKLLRRLKSPTLHLFSDDSRPKSTAS  256

Query  245  is-ksssihrshhhPGILHKTKKDRNVDHLAEEIRVPTNDIEKLAMALKDLEVQAQLINS  303
                     +S   P  L    +  N            +D+E+LA AL +LEVQA+++N 
Sbjct  257  KGHSPQRSQQSGGSPSRLPPAMETIN--------DAGVSDLERLAQALGELEVQAEILNG  308

Query  304  EAVKSNEQIARIEGQLSGINDRIQAQTSQV  333
            EA +S +QI R+E QLS +  R++ QT Q 
Sbjct  309  EAGRSTQQIERVEHQLSNVTARVEKQTKQA  338

>PYVX_18171
Length=294

 Score = 231 bits (590),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 134/334 (40%), Positives = 196/334 (59%), Gaps = 55/334 (16%)

Query  15   PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEKH  74
            PTSCEGYVTKRGHFRKSWRVRYLV+ G +++V+Y+ESK + ++  A  KG F L S +KH
Sbjct  11   PTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQN-GAASKGEFYLSSIDKH  69

Query  75   EYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLKASKCM  134
             Y    M     +EKPFGFKMVGHAPK+GY ELD+FV++ +D+ +WL+V +N L+++  M
Sbjct  70   AYVAGGMGAVGAQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNALESAAAM  129

Query  135  AREAF--MAEMDTTKSVLGFSYIGTTSKQQIQVLKSKKCDYIHEALQQIEMAKSAGNAAC  192
            +R+A        TTKS+ GFS   T+ +QQ++ +   K + + +AL+++E AK  G  AC
Sbjct  130  SRKAAGDGGGSATTKSLFGFSTT-TSPQQQLKAMSVSKDELLKDALRELEGAKLIGREAC  188

Query  193  DEIVSQGEQLGKVEQNLSTIQNDLNHSEKLIKSIRHPLRYFFSRSRPHDRATisksssih  252
             E+V QGE+L  +E NL  I++DL++ +KL++ ++ P                       
Sbjct  189  TEMVVQGEKLDGIEANLGGIESDLDYGDKLLRRLKSP-----------------------  225

Query  253  rshhhPGILHKTKKDRNVDHLAEEIRVPTNDIEKLAMALKDLEVQAQLINSEAVKSNEQI  312
                   +LH          LA ++R P +  + L+ A        QL       S +QI
Sbjct  226  -------VLH---------LLARDLRRPPSPTKTLSNAGDGRAALEQL-------STQQI  262

Query  313  ARIEGQLSGINDRIQAQTSQVITSSGKQ---NLF  343
            ARIE +L+ +NDR+Q QT Q   +SG Q   N+F
Sbjct  263  ARIEERLTTVNDRVQRQTKQA--TSGIQRGGNIF  294

>PHYKE_8393
Length=326

 Score = 204 bits (520),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 131/343 (38%), Positives = 183/343 (53%), Gaps = 50/343 (15%)

Query  15   PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATP--KGSFILQSAE  72
            PTSCEGYVTKRGHF                                TP  KGSF L +  
Sbjct  20   PTSCEGYVTKRGHF------------------------PCHPPHGETPAHKGSFYLSNIA  55

Query  73   KHEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLKASK  132
             HEY +  M      +KPFGFKMVGHAP++GY+ELDVFV++ SD ++WL+V  N L A +
Sbjct  56   PHEYVVGVM---GAADKPFGFKMVGHAPRKGYVELDVFVETLSDRNKWLEVARNALGAKR  112

Query  133  CMAREAFMAEMDTT-KSVLGFSYIGT-----TSKQQIQVLKSKKCDYIHEALQQIEMAKS  186
             + R+A    +  T K + GF    +       ++QIQ L   K + + EAL+++E AK 
Sbjct  113  QIMRQAIDQSVSPTKKGMFGFGLSLSPQPLVPPQKQIQALTHNKEELLAEALRELEAAKM  172

Query  187  AGNAACDEIVSQGEQLGKVEQNLSTIQNDLNHSEKLIKSIRHPLRYFFS-RSRPHDRATi  245
             G  AC+EIV QGE+L  VE +L  I  DL+  +KL++ +++P  + FS  +RP   A  
Sbjct  173  VGREACNEIVVQGEKLDSVEHDLHAIDRDLDFGDKLLRRLKNPTLHLFSDDTRPKSHAN-  231

Query  246  sksssihrshhhPGILHKTKKDRNVDHLAEEI----RVPTNDIEKLAMALKDLEVQAQLI  301
                    +   P   H++    N  HL   +        +D+E+LA AL +LE+QA+L+
Sbjct  232  -------SNESSPQRTHQSAGS-NPIHLPFSMGSANDADASDLERLAHALGELELQAELL  283

Query  302  NSEAVKSNEQIARIEGQLSGINDRIQAQTSQV-ITSSGKQNLF  343
            N EA +S +QIARIE QLS +  R++ QT Q   T S    LF
Sbjct  284  NGEAGRSTQQIARIEQQLSNVTARVEKQTKQASATLSAGPRLF  326

>PYAR_13570
Length=322

 Score = 202 bits (514),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 125/319 (39%), Positives = 193/319 (61%), Gaps = 25/319 (8%)

Query  31   SWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEKHEYWISQMVTGSVKEKP  90
            SWRVRYLV++G ++ VSY++SKD +++  A+PKGSF L S EKHEY +   V G+ K KP
Sbjct  8    SWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVG--VLGAQK-KP  64

Query  91   FGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLKASKCMAREAFMAEMDTTKSVL  150
            FGFKMVGHAP++GY+ELD+FV+S  D+ +WL+V  + L A+K + R   +++  +TKS+ 
Sbjct  65   FGFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSG-LSDAASTKSLF  123

Query  151  GFSYIGTTSKQQIQVLKSKKCDYIHEALQQIEMAKSAGNAACDEIVSQG-----------  199
            GFS   T+ ++QIQ L + K + + +A+ +IE AK  G  AC EIV QG           
Sbjct  124  GFS-PATSPQKQIQKLSASKEELLKQAIDEIESAKLMGREACQEIVVQGVRKRGRLTSGF  182

Query  200  ----EQLGKVEQNLSTIQNDLNHSEKLIKSIRHPLRYFFSR-SRPHDRATisksssihrs  254
                E+L  +E  L  +  DL++ +KL+  ++ PL Y FS  +R  + A+ + S    + 
Sbjct  183  SLHAEKLDHIESELQRVDADLDYGDKLLSHLKSPLLYLFSSDARDKNSASPAHSPVKSKQ  242

Query  255  hhhPGILHKTKKDRNVDHLAEEIRVPTNDIEKLAMALKDLEVQAQLINSEAVKSNEQIAR  314
                         + V+  + E+    +D+E+LA+ L +LE QA L+N EAV+   Q+ R
Sbjct  243  SALSSAARADALGQGVERASGEM----SDMERLALLLGELEAQATLLNEEAVRGTTQVER  298

Query  315  IEGQLSGINDRIQAQTSQV  333
            +   L+ IN+R+Q QT + 
Sbjct  299  VGDALAHINERVQNQTKKA  317

>SDRG_01781
Length=335

 Score = 161 bits (407),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 111/332 (33%), Positives = 177/332 (53%), Gaps = 18/332 (5%)

Query  10   LARYTPTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQ  69
            L  +  TSCEGYVTKRGH  KSWR RY+V+ G  ++VSY++SK   KS     KGSFIL 
Sbjct  5    LTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILA  64

Query  70   SAEKHEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLK  129
              EKH+Y       G V  KP+GFK+VGHAP  GY E  V+V+++ D  QWL+V +N L 
Sbjct  65   EIEKHDYSDE---GGGV--KPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL-  118

Query  130  ASKCMAREAFMAEMDTTKSVLGF---SYIGTTSKQQIQVLKSKKCDYIHEALQQIEMAKS  186
              K +A +A   +  T  ++LG    S   T++  Q++ +   K + + +A+  +E A++
Sbjct  119  -GKNVAPQASADQRAT--ALLGHRAASGFLTSAPVQLRNVNKTKEELLRKAIVTLEHART  175

Query  187  AGNAACDEIVSQGEQLGKVEQNLSTIQNDLNHSEKLIKSIRHPLRYFFSRSRPHDRATis  246
             G+    E+    E L   E N+  +  +L+  + +IK +  P  Y+FS S+   +    
Sbjct  176  VGDNTVSEMGHNAEMLDIAEANMDYVGTELDRGDNIIKKMTSPFFYYFSSSKSKKKGA-G  234

Query  247  ksssihrshhhPGILHKTKKDRNVDHLAEEIRVPTND-----IEKLAMALKDLEVQAQLI  301
               S     H P     +  ++       +   PT D     +++L+  L  LEV A  I
Sbjct  235  SPKSKSARSHLPQTPMNSPTNKKPSGPTSKTGGPTTDAGDDELDQLSKILASLEVHANTI  294

Query  302  NSEAVKSNEQIARIEGQLSGINDRIQAQTSQV  333
            ++E  ++ EQI RI+ ++   ++R+  Q+++V
Sbjct  295  STEVERTTEQIDRIQKKMVEADERVVEQSAKV  326

>SPRG_06336
Length=335

 Score = 161 bits (407),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 112/332 (34%), Positives = 177/332 (53%), Gaps = 18/332 (5%)

Query  10   LARYTPTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQ  69
            L  +  TSCEGYVTKRGH  KSWR RY+V+ G  ++VSYY+SK   KS     KGSFIL 
Sbjct  5    LTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILA  64

Query  70   SAEKHEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLK  129
              EKH+Y       G V  KP+GFK+VGHAP  GY E  V+V+++ D  QWL+V +N L 
Sbjct  65   EIEKHDYSDE---GGGV--KPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL-  118

Query  130  ASKCMAREAFMAEMDTTKSVLGF---SYIGTTSKQQIQVLKSKKCDYIHEALQQIEMAKS  186
              K +  +A + +     ++LG    S   T++  Q++ +   K + + +A+  +E A++
Sbjct  119  -GKNVTPQASVDQR--ASALLGHRAPSGFLTSAPVQLRNVNKTKEELLRKAIVTLEHART  175

Query  187  AGNAACDEIVSQGEQLGKVEQNLSTIQNDLNHSEKLIKSIRHPLRYFFSRSRPHDRATis  246
             G+    E+    E L   E N+  ++ +L+  + +IK +  P  Y+FS S+   + T  
Sbjct  176  VGDNTVSEMGHNAEMLDIAEANMDYVETELDRGDNIIKKMTSPFFYYFSSSKSKKKGT-G  234

Query  247  ksssihrshhhPGILHKTKKDRNVDHLAEEIRVPTND-----IEKLAMALKDLEVQAQLI  301
               S     H P     +   +     A +    T D     +++L+  L  LEV A  I
Sbjct  235  SPKSKSARSHQPQTPMNSPTHKKSSGPASKAGGATTDAGDDELDQLSKILASLEVHANTI  294

Query  302  NSEAVKSNEQIARIEGQLSGINDRIQAQTSQV  333
            ++E  ++ EQI RI+ ++   ++RI  Q+++V
Sbjct  295  STEVERTTEQIDRIQKKMVEADERIVEQSAKV  326

>H310_09223
Length=333

 Score = 140 bits (354),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 102/333 (31%), Positives = 164/333 (49%), Gaps = 20/333 (6%)

Query  9    HLARYTPTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFIL  68
            +L++   TSCEGYVTKRGH  K+W+ RY+V+ G  + V+YY+        N  PKGSF+L
Sbjct  4    NLSKIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYD-SKEIYKSNGPPKGSFVL  62

Query  69   QSAEKHEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGL  128
               EK +        GSV  KPFGFK +GH P QGY E  VFV++  D  +WL+V +N L
Sbjct  63   SECEKQDLSDE---GGSV--KPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNAL  117

Query  129  KASKCMAREAFMAEMDTTKSVLGFSYIGTTSKQQIQVLKSKKCDYIHEALQQ-IEMAKSA  187
              +  +   +    M++          G     + Q+   KK    HE LQQ I  AK A
Sbjct  118  GKTTYIPSPS----MESHGGAGHKESAGLMISLEAQIKNVKKTS--HELLQQAINDAKEA  171

Query  188  ---GNAACDEIVSQGEQLGKVEQNLSTIQNDLNHSEKLIKSIRHPLRYFFSRSRPHDRAT  244
               G+A  DE+  Q E L   E  +  +   ++ +E L KSI+HP+ Y F+      ++ 
Sbjct  172  DRIGDATVDEMAYQEEVLNDAENTVDAMGKQMDRAEDLGKSIKHPILYKFTHIFSRKKSK  231

Query  245  isksssihrshhhPGILHKTKKDRNVD---HLAE-EIRVPTNDIEKLAMALKDLEVQAQL  300
              K  +  +          ++  R V    H  + + +   + +++L+  L  L   A  
Sbjct  232  RGKRGASSKKRGGGKSTRSSRVPRGVQVKLHPPQPQPKQEEDQLDELSKILAKLGQTADT  291

Query  301  INSEAVKSNEQIARIEGQLSGINDRIQAQTSQV  333
            I+    ++ EQ+ RI+ +++ +++R+  +   V
Sbjct  292  ISDITTRTTEQVDRIDQKVTSVDERVTKEAKLV  324

>H257_06294
Length=358

 Score = 137 bits (346),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 100/355 (28%), Positives = 175/355 (49%), Gaps = 39/355 (11%)

Query  9    HLARYTPTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFIL  68
            +L++   TSCEGYVTKRGH  KSW+ RY+V++G  + VSYY+      +    PKGSF+L
Sbjct  4    NLSKIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYD-SKEIYTSKGHPKGSFVL  62

Query  69   QSAEKHEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGL  128
               EK +     +       KPFGFK +GH P QGY E  V+V+S  D  +WL+V +N L
Sbjct  63   SECEKQD-----LSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNAL  117

Query  129  ----KASKCMAR--EAFMAEMDTTKSV---------LGFSYIG--------TTSKQQIQV  165
                   K M++  E     +    SV         +  + +G         + + Q++ 
Sbjct  118  GKNSSPQKSMSQRIEEITGPLLPCASVQLNCPRRDMIHITTLGHKESAGLMQSLEAQMKN  177

Query  166  LKSKKCDYIHEALQQIEMAKSAGNAACDEIVSQGEQLGKVEQNLSTIQNDLNHSEKLIKS  225
            +K    + + +A+   + A   G+A  +E+V Q + L   E  + T+   ++H+E L +S
Sbjct  178  VKKTSQELLQQAINDAKEADRIGDATVNEMVYQEDVLNDAEGTVDTMGRQMDHAEDLGRS  237

Query  226  IRHPLRY----FFSRSRPHDRATi-sksssihrshhhPGILHKTK-KDRNVDHLAEEIRV  279
            ++HP+ Y     F+R + + +    SK+            + + K +     H A +   
Sbjct  238  LKHPILYKLTHLFTRKKSYKKGGRGSKTRKGGAKASRSSRVSRVKLQPPQQQHAAAQ---  294

Query  280  PTND-IEKLAMALKDLEVQAQLINSEAVKSNEQIARIEGQLSGINDRIQAQTSQV  333
            P +D +++L+  L  L   A  I+    ++ EQ+ RI+ +++ ++DR++ +   V
Sbjct  295  PEDDQLDQLSKILAKLGQTADTISDITARTTEQVDRIDQKVTSVDDRVKKEAKLV  349

>PHYRA_84916
Length=1541

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 55/111 (50%), Gaps = 18/111 (16%)

Query  15   PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEKH  74
            P SC GY+TK+GH RKSW+ RY ++ G    +SYY   D + +    P    +++  +K 
Sbjct  402  PVSCAGYLTKQGHKRKSWKKRYFILRGNT--ISYYSDYDMANNTKGKPLAEVLVEDVQK-  458

Query  75   EYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVIN  125
              W  +         PFGF  + +     Y    V+ D+  + ++W++ +N
Sbjct  459  --WDGE---------PFGFMFMTNEQVPYY----VYADNDRERNKWMNALN  494

 Score = 40.8 bits (94),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 17/24 (71%), Gaps = 0/24 (0%)

Query  18   CEGYVTKRGHFRKSWRVRYLVISG  41
            CEGY+TKRGH   +W+ RY  + G
Sbjct  210  CEGYLTKRGHLFTNWKTRYFTLRG  233

 Score = 39.7 bits (91),  Expect = 0.025, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 22/29 (76%), Gaps = 0/29 (0%)

Query  17   SCEGYVTKRGHFRKSWRVRYLVISGVNMQ  45
            SCEGY+TKRGH   S R+ Y V++G +++
Sbjct  304  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR  332

>PHYSO_361747
Length=1523

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/111 (28%), Positives = 54/111 (49%), Gaps = 18/111 (16%)

Query  15   PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEKH  74
            P SC GY+TK+GH RKSW+ RY ++ G    +SYY   D + +    P    +++  +K 
Sbjct  411  PVSCAGYLTKQGHKRKSWKKRYFILRG--NAISYYSDYDMANNSKGKPLAEVLVEDVQK-  467

Query  75   EYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVIN  125
              W  +         PFGF  +        +   V+ D+  + ++W++ +N
Sbjct  468  --WDGE---------PFGFMFM----TTEQVPYYVYADNDRERNKWMNALN  503

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 37/129 (29%), Positives = 57/129 (44%), Gaps = 25/129 (19%)

Query  14   TPTS--CEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSA  71
            TPT   CEGY+TKRGH   +W+ RY  + G  ++  YY S++ SK   A         S 
Sbjct  213  TPTEIRCEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSSEEKSKKYGAVTVEKVATWSG  270

Query  72   EKHEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLKAS  131
            E H                 GF    +  KQ  I   V+  S S+  +WL V+   +  +
Sbjct  271  EAH-----------------GFMF--YTTKQ--IPYYVYASSESERSRWLRVLKEYMVET  309

Query  132  KCMAREAFM  140
            + ++ E ++
Sbjct  310  EEVSCEGYL  318

 Score = 39.7 bits (91),  Expect = 0.028, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 22/29 (76%), Gaps = 0/29 (0%)

Query  17   SCEGYVTKRGHFRKSWRVRYLVISGVNMQ  45
            SCEGY+TKRGH   S R+ Y V++G +++
Sbjct  313  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR  341

>HYAP_08645
Length=1514

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 56/111 (50%), Gaps = 18/111 (16%)

Query  15   PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEKH  74
            P SC GY+TK+GH RKSW+ RY ++ G N+ +SYY   D + +    P    +++  +  
Sbjct  305  PVSCAGYLTKQGHKRKSWKKRYFILRG-NL-ISYYSDYDMANNTKGRPLAEVLVEDVQS-  361

Query  75   EYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVIN  125
              W  +         PFGF  + +     Y    V+ D+  + ++W++ +N
Sbjct  362  --WDGE---------PFGFMFMTNEQVPYY----VYADNDRERNKWMNALN  397

 Score = 42.0 bits (97),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 56/129 (43%), Gaps = 25/129 (19%)

Query  14   TPTS--CEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSA  71
            TPT   CEGY+TKRGH   +W+ RY  + G  ++  YY  ++ SK   A         S 
Sbjct  107  TPTEIRCEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSGEEKSKKYGAVTVEKVATWSG  164

Query  72   EKHEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLKAS  131
            E H                 GF    +  KQ  I   V+  S S+  +WL  + + +  +
Sbjct  165  EAH-----------------GFMF--YTTKQ--IPYYVYASSESERSRWLRALKDFMVET  203

Query  132  KCMAREAFM  140
            + ++ E ++
Sbjct  204  EEVSCEGYL  212

 Score = 39.7 bits (91),  Expect = 0.031, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 22/29 (76%), Gaps = 0/29 (0%)

Query  17   SCEGYVTKRGHFRKSWRVRYLVISGVNMQ  45
            SCEGY+TKRGH   S R+ Y V++G +++
Sbjct  207  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR  235

>PPTG_18898
Length=1559

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/111 (28%), Positives = 54/111 (49%), Gaps = 18/111 (16%)

Query  15   PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEKH  74
            P SC GY+TK+GH RKSW+ RY ++ G    +SYY   D + +    P    +++  +K 
Sbjct  405  PVSCAGYLTKQGHKRKSWKKRYFILRGNT--ISYYSDYDMANNAKGKPLAEVLVEDVQK-  461

Query  75   EYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVIN  125
              W  +         PFGF  + +     Y    V+ D+  +  +W++ ++
Sbjct  462  --WDGE---------PFGFMFMTNEQVPYY----VYADNDRERTKWMNALH  497

 Score = 41.2 bits (95),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (67%), Gaps = 2/30 (7%)

Query  14   TPTS--CEGYVTKRGHFRKSWRVRYLVISG  41
            TPT   CEGY+TKRGH   +W+ RY  + G
Sbjct  207  TPTEIKCEGYLTKRGHVFTNWKTRYFTLRG  236

 Score = 40.0 bits (92),  Expect = 0.024, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 22/29 (76%), Gaps = 0/29 (0%)

Query  17   SCEGYVTKRGHFRKSWRVRYLVISGVNMQ  45
            SCEGY+TKRGH   S R+ Y V++G +++
Sbjct  307  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR  335

>PITG_20562
Length=1559

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 31/111 (28%), Positives = 54/111 (49%), Gaps = 18/111 (16%)

Query  15   PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEKH  74
            P SC GY+TK+GH RKSW+ RY ++ G    +SYY   D + +    P    +++  +K 
Sbjct  406  PVSCAGYLTKQGHKRKSWKKRYFILRGNT--ISYYSDYDMANNAKGKPLAEVLVEDVQK-  462

Query  75   EYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVIN  125
              W  +         PFGF  + +     Y    V+ D+  +  +W++ ++
Sbjct  463  --WDGE---------PFGFMFMTNEQVPYY----VYADNDRERTKWMNALH  498

 Score = 41.2 bits (95),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (67%), Gaps = 2/30 (7%)

Query  14   TPTS--CEGYVTKRGHFRKSWRVRYLVISG  41
            TPT   CEGY+TKRGH   +W+ RY  + G
Sbjct  208  TPTEIKCEGYLTKRGHVFTNWKTRYFTLRG  237

 Score = 39.7 bits (91),  Expect = 0.028, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 22/29 (76%), Gaps = 0/29 (0%)

Query  17   SCEGYVTKRGHFRKSWRVRYLVISGVNMQ  45
            SCEGY+TKRGH   S R+ Y V++G +++
Sbjct  308  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR  336

>PYAR_23286
Length=607

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 54/110 (49%), Gaps = 18/110 (16%)

Query  15   PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEKH  74
            P +C GY+TK+GH RKSW+ RY V+ G +  VSYY   D++ S    P    +++  ++ 
Sbjct  386  PIACSGYLTKQGHKRKSWKKRYFVLRGSS--VSYYTDYDTANSPKGKPLAEVVIEDVQR-  442

Query  75   EYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVI  124
              W  +         PFGF  +        I   V+ D+  +  +W++ +
Sbjct  443  --WDGE---------PFGFMFM----TSEQIPYYVYADNERERTKWMNAL  477

 Score = 39.7 bits (91),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 19/24 (79%), Gaps = 0/24 (0%)

Query  18   CEGYVTKRGHFRKSWRVRYLVISG  41
            CEG++TKRGH   +W++RY V+ G
Sbjct  194  CEGFLTKRGHVFTNWKMRYFVLRG  217

 Score = 35.0 bits (79),  Expect = 0.65, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 21/29 (72%), Gaps = 0/29 (0%)

Query  17   SCEGYVTKRGHFRKSWRVRYLVISGVNMQ  45
            +CEGY+T+RGH   S R  Y V++G +++
Sbjct  288  TCEGYLTRRGHLVPSQRHAYYVLNGTSLR  316

>PYU1_G006347
Length=1095

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 55/111 (50%), Gaps = 18/111 (16%)

Query  15   PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEKH  74
            P SC GY+TK+GH RKSW+ RY ++ G N+ +SYY   D + S    P     ++  +K 
Sbjct  392  PVSCAGYLTKQGHKRKSWKKRYFILRG-NL-ISYYSDYDLANSAKGKPLAEVAVEDVQK-  448

Query  75   EYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVIN  125
              W  +         PFGF  +        +   V+ D+  + ++W++ ++
Sbjct  449  --WDGE---------PFGFMFM----TSEQVPYYVYADNDRERNKWMNALS  484

 Score = 40.0 bits (92),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 18/24 (75%), Gaps = 0/24 (0%)

Query  18   CEGYVTKRGHFRKSWRVRYLVISG  41
            CEG++TKRGH   +W+ RY V+ G
Sbjct  200  CEGFLTKRGHVFTNWKTRYFVLRG  223

 Score = 38.9 bits (89),  Expect = 0.050, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 22/29 (76%), Gaps = 0/29 (0%)

Query  17   SCEGYVTKRGHFRKSWRVRYLVISGVNMQ  45
            SCEGY+T+RGH   S R+ Y V++G +++
Sbjct  294  SCEGYLTRRGHLVPSQRMAYYVLNGASLR  322

>H310_00231
Length=1495

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/158 (26%), Positives = 69/158 (44%), Gaps = 25/158 (16%)

Query  15   PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEKH  74
            P +C G++TK+GH RKSW+ RY V+ G  +  +YY   D+S  +++ P G   ++     
Sbjct  349  PIACAGWLTKQGHKRKSWKKRYFVLRGTTL--AYYTDFDASNMRHSRPLGEVTVREVST-  405

Query  75   EYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLKAS---  131
              W  +         P GF  V        +   VF D+  D  +WL  +    ++S   
Sbjct  406  --WDGE---------PGGFMFV----TNDNVPYYVFADNERDQAKWLTALRKLFESSTSV  450

Query  132  ----KCMAREAFMAEMDTTKSVLGFSYIGTTSKQQIQV  165
                K   R A++          GF+  GT++++  Q 
Sbjct  451  EEPEKTCPRCAYVLTGSRFCGACGFNLRGTSNERSRQT  488

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 23/28 (82%), Gaps = 0/28 (0%)

Query  18   CEGYVTKRGHFRKSWRVRYLVISGVNMQ  45
            CEGY+TKRGH   S+R+RY V+SG +M+
Sbjct  251  CEGYLTKRGHLVPSYRMRYFVLSGASMK  278

 Score = 34.3 bits (77),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 20/30 (67%), Gaps = 1/30 (3%)

Query  20   GYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
            GY+TKRGH   +W+ R+ V+     ++SYY
Sbjct  157  GYLTKRGHVVTNWKTRFFVLR-AGGRLSYY  185

>PHYKE_1990
Length=1499

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 53/111 (48%), Gaps = 18/111 (16%)

Query  15   PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEKH  74
            P +C GY+TK+GH RKSW+ RY ++ G    +SYY   D + +         +++  ++ 
Sbjct  403  PVACAGYLTKQGHKRKSWKKRYFILRGST--ISYYSDYDMANNSKGKALAEVLVEDVQR-  459

Query  75   EYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVIN  125
              W  +         PFGF  +       Y    V+ D+  + ++W++ +N
Sbjct  460  --WDGE---------PFGFMFMTSEQVPYY----VYADNDRERNKWMNALN  495

 Score = 40.4 bits (93),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 17/24 (71%), Gaps = 0/24 (0%)

Query  18   CEGYVTKRGHFRKSWRVRYLVISG  41
            CEGY+TKRGH   +W+ RY  + G
Sbjct  211  CEGYLTKRGHLFTNWKTRYFTLRG  234

 Score = 39.7 bits (91),  Expect = 0.027, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 22/29 (76%), Gaps = 0/29 (0%)

Query  17   SCEGYVTKRGHFRKSWRVRYLVISGVNMQ  45
            SCEGY+TKRGH   S R+ Y V++G +++
Sbjct  305  SCEGYLTKRGHLVPSQRMAYYVLNGASLR  333

>H257_06722
Length=1482

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 72/169 (43%), Gaps = 28/169 (17%)

Query  15   PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEKH  74
            P +C G++TK+GH RKSW+ RY V+ G  +  +YY   D+S  ++  P G   ++     
Sbjct  349  PIACAGWLTKQGHKRKSWKKRYFVLRGNTL--AYYTDFDASNLRHGKPLGEVTVREVSA-  405

Query  75   EYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLKASKCM  134
              W  +         P GF  + +     Y    VF D+  D  +WL  +    +++  M
Sbjct  406  --WDGE---------PSGFMFITNDSVPYY----VFADNDRDQAKWLAALRKLFESATSM  450

Query  135  -------AREAFMAEMDTTKSVLGFSYIGTT---SKQQIQVLKSKKCDY  173
                    R A++          GF+  GT+   S+Q  Q L     D+
Sbjct  451  EEPDKTCPRCAYVLTGSRFCGACGFNLRGTSNERSRQASQPLVVPSDDF  499

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 23/32 (72%), Gaps = 2/32 (6%)

Query  18   CEGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
            CEGY+TKRGH   S+R+RY V+ G  ++  YY
Sbjct  251  CEGYLTKRGHLVPSYRMRYFVLCGSTIK--YY  280

 Score = 34.3 bits (77),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 20/32 (63%), Gaps = 1/32 (3%)

Query  18   CEGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
              GY+TKRGH   +W+ R+ V+     ++SYY
Sbjct  155  ASGYLTKRGHVVTNWKTRFFVLR-AGGRLSYY  185

>PYIW_17381
Length=952

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 54/110 (49%), Gaps = 18/110 (16%)

Query  15   PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEKH  74
            P SC GY+TK+GH RKSW+ RY ++ G N+ ++Y+   D + S    P     ++  +K 
Sbjct  403  PVSCAGYLTKQGHKRKSWKKRYFILRG-NL-IAYFTDYDIANSAKGKPLAEVTVEDVQK-  459

Query  75   EYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVI  124
              W  +         PFGF  +        +   V+ D+  + ++W++ +
Sbjct  460  --WDGE---------PFGFMFM----TSEQVPYYVYADNDRERNKWMNAL  494

 Score = 40.4 bits (93),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 18/24 (75%), Gaps = 0/24 (0%)

Query  18   CEGYVTKRGHFRKSWRVRYLVISG  41
            CEG++TKRGH   +W+ RY V+ G
Sbjct  211  CEGFLTKRGHVFTTWKTRYFVLRG  234

 Score = 37.4 bits (85),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 21/28 (75%), Gaps = 0/28 (0%)

Query  18   CEGYVTKRGHFRKSWRVRYLVISGVNMQ  45
            CEGY+T+RGH   S R+ Y V++G +++
Sbjct  306  CEGYLTRRGHLVPSQRMAYYVLNGTSLR  333

>SDRG_12763
Length=1317

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 25/35 (71%), Gaps = 2/35 (6%)

Query  15   PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
            P SC GY+TK+GH RKSW+ RY V+ G  +  SYY
Sbjct  221  PISCAGYLTKQGHRRKSWKRRYFVLRGATL--SYY  253

 Score = 35.8 bits (81),  Expect = 0.42, Method: Compositional matrix adjust.
 Identities = 39/164 (24%), Positives = 64/164 (39%), Gaps = 28/164 (17%)

Query  18   CEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEKHEYW  77
            C GY+TKRGH   +W+ R+ V+    +   Y +     K       G   L      EY+
Sbjct  10   CAGYLTKRGHVVTNWKTRFFVLRPHAILCYYADDSMVKKL------GQVHLVKVAPWEYF  63

Query  78   ISQMVTGSVK------EKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWL----DVINNG  127
             +      +K      E  FGF M     +  Y    V+ + +++  +WL    D+    
Sbjct  64   SATTGNSVLKSARGSDEMKFGF-MFFTTKRVAYY---VYANVNAERQRWLLALQDLYVVT  119

Query  128  LKASKCMAREAFMAEMDTTKSVLGFSYIGTTSKQQIQVLKSKKC  171
              A+ C   E ++     TK   GFS++ +  K  +      KC
Sbjct  120  SNATDC---EGYL-----TKRTPGFSFLSSRPKYYVLTGTLLKC  155

>PYIR_21589
Length=1568

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 53/110 (48%), Gaps = 18/110 (16%)

Query  15   PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEKH  74
            P SC GY+TK+GH RKSW+ RY ++ G N+ ++YY   D + S          ++  +K 
Sbjct  403  PVSCAGYLTKQGHKRKSWKKRYFILRG-NL-IAYYPDYDLANSAKGRALAEVTVEDVQK-  459

Query  75   EYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVI  124
              W  +         PFGF  +        +   V+ D+  + ++W++ +
Sbjct  460  --WDGE---------PFGFMFM----TSEQVPYYVYADNDRERNKWMNAL  494

 Score = 40.4 bits (93),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 18/24 (75%), Gaps = 0/24 (0%)

Query  18   CEGYVTKRGHFRKSWRVRYLVISG  41
            CEG++TKRGH   +W+ RY V+ G
Sbjct  211  CEGFLTKRGHVFTTWKTRYFVLRG  234

 Score = 38.5 bits (88),  Expect = 0.061, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 22/29 (76%), Gaps = 0/29 (0%)

Query  17   SCEGYVTKRGHFRKSWRVRYLVISGVNMQ  45
            SCEGY+T+RGH   S R+ Y V++G +++
Sbjct  305  SCEGYLTRRGHLVPSQRMAYYVLNGTSLR  333

>PYVX_20438
Length=1346

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/110 (25%), Positives = 52/110 (47%), Gaps = 18/110 (16%)

Query  15   PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEKH  74
            P +C GY+TK+GH RKSW+ RY ++ G +  +SY+      +  N+    +    + E  
Sbjct  316  PVACAGYLTKQGHKRKSWKKRYFILRGTS--ISYF---ADFEMANSAKGKALAEVTVEDV  370

Query  75   EYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVI  124
            + W  +         PFGF  +        +   V+ D+  + ++W++ +
Sbjct  371  QRWDGE---------PFGFMFM----TSEQVPYYVYADNDRERNKWMNAL  407

 Score = 40.0 bits (92),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 17/24 (71%), Gaps = 0/24 (0%)

Query  18   CEGYVTKRGHFRKSWRVRYLVISG  41
            CEGY+TKRGH   +W+ RY  + G
Sbjct  123  CEGYLTKRGHVFTNWKTRYFTLRG  146

 Score = 39.3 bits (90),  Expect = 0.042, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 21/29 (72%), Gaps = 0/29 (0%)

Query  17   SCEGYVTKRGHFRKSWRVRYLVISGVNMQ  45
            SCEGY+TKRGH   S R+ Y V++G  ++
Sbjct  218  SCEGYLTKRGHLVPSQRMAYYVLTGTMLR  246

>CCA18875
Length=1514

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 28/36 (78%), Gaps = 2/36 (6%)

Query  15   PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYE  50
            P +C GY+TK+GH RKSW+ RY ++ G N+ +SYY+
Sbjct  415  PVTCAGYLTKQGHKRKSWKKRYFILRG-NI-ISYYQ  448

 Score = 38.5 bits (88),  Expect = 0.057, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 21/29 (72%), Gaps = 0/29 (0%)

Query  17   SCEGYVTKRGHFRKSWRVRYLVISGVNMQ  45
            +CEGY+T+RGH   S RV Y V+SG  ++
Sbjct  316  TCEGYLTRRGHLVPSQRVCYYVLSGTCLR  344

 Score = 38.1 bits (87),  Expect = 0.095, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%), Gaps = 0/28 (0%)

Query  14   TPTSCEGYVTKRGHFRKSWRVRYLVISG  41
            T  + EGY+TKRGH   +W+ R+ V+SG
Sbjct  218  TEITYEGYLTKRGHVFTNWKTRFFVLSG  245

>PYAP_16997
Length=1018

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 52/110 (47%), Gaps = 18/110 (16%)

Query  15   PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEKH  74
            P +C GY+TK+GH RKSW+ RY V+ G    ++Y+   D++ S         I++  ++ 
Sbjct  399  PIACSGYLTKQGHKRKSWKKRYFVLRG--NSITYFTDFDTANSNKGKALAEVIVEDVQR-  455

Query  75   EYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVI  124
              W  +         PFGF  +        +   V+ D+  +  +W++ +
Sbjct  456  --WDGE---------PFGFMFM----TSEQVPYYVYADNERERGKWMNAL  490

 Score = 40.8 bits (94),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 20/25 (80%), Gaps = 0/25 (0%)

Query  17   SCEGYVTKRGHFRKSWRVRYLVISG  41
            +CEG++TKRGH   +W++RY V+ G
Sbjct  206  ACEGFLTKRGHVFTNWKMRYFVLRG  230

 Score = 35.8 bits (81),  Expect = 0.38, Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 21/29 (72%), Gaps = 0/29 (0%)

Query  17   SCEGYVTKRGHFRKSWRVRYLVISGVNMQ  45
            +CEG++T+RGH   S R  Y V++G +++
Sbjct  301  TCEGFLTRRGHLVPSQRFAYYVLNGTSLR  329

>CCI44752
Length=1526

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 28/36 (78%), Gaps = 2/36 (6%)

Query  15   PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYE  50
            P +C GY+TK+GH RKSW+ RY ++ G N+ +SYY+
Sbjct  415  PVACAGYLTKQGHKRKSWKKRYFILRG-NI-ISYYQ  448

 Score = 38.9 bits (89),  Expect = 0.056, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 21/29 (72%), Gaps = 0/29 (0%)

Query  17   SCEGYVTKRGHFRKSWRVRYLVISGVNMQ  45
            +CEGY+T+RGH   S RV Y V+SG  ++
Sbjct  316  TCEGYLTRRGHLVPSQRVCYYVLSGTYLR  344

 Score = 38.1 bits (87),  Expect = 0.087, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%), Gaps = 0/28 (0%)

Query  14   TPTSCEGYVTKRGHFRKSWRVRYLVISG  41
            T  + EGY+TKRGH   +W+ R+ V+SG
Sbjct  218  TEITYEGYLTKRGHVFTNWKTRFFVLSG  245

>SPRG_06059
Length=1312

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 2/35 (6%)

Query  15   PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
            P SC GY+TK+GH RKSW+ RY V+ G  +  +YY
Sbjct  223  PISCAGYLTKQGHRRKSWKRRYFVLRGGTL--AYY  255

 Score = 37.0 bits (84),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 64/165 (39%), Gaps = 30/165 (18%)

Query  18   CEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEKHEYW  77
            C GY+TKRGH   +W+ R+ V+    +   Y +         A   G   L      EY 
Sbjct  12   CAGYLTKRGHVVTNWKTRFFVLRPHAILCYYADESM------AKKLGQVHLVKVAPWEY-  64

Query  78   ISQMVTGSV-------KEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWL----DVINN  126
            +S     S+        E  FGF M     +  Y    V+ + +++  +WL    D+   
Sbjct  65   VSATTANSILKSTRGSDEMKFGF-MFFTTKRVAYY---VYANVNAERQKWLLALQDLYVV  120

Query  127  GLKASKCMAREAFMAEMDTTKSVLGFSYIGTTSKQQIQVLKSKKC  171
               A+ C   E ++     TK   GFS++ +  K  +      KC
Sbjct  121  TSNATDC---EGYL-----TKRTPGFSFLSSRPKYYVLTGTLLKC  157

>SPRG_06058
Length=1258

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 26/41 (63%), Gaps = 4/41 (10%)

Query  9   HLARYTPTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
           H AR  P  CEGY+TKRGH   S+R+RY V+ G    V YY
Sbjct  40  HCAR--PVDCEGYLTKRGHLVPSYRLRYFVMCG--SVVKYY  76

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 25/35 (71%), Gaps = 2/35 (6%)

Query  15   PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
            P +C G++TK+GH RKSW+ RY V+ G  +  SYY
Sbjct  146  PVACAGWLTKQGHKRKSWKKRYFVLRGTVL--SYY  178

>H310_00230
Length=1248

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 2/35 (6%)

Query  15   PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
            P +C GY+TK+GH RKSW+ RY V+ G  +  SYY
Sbjct  223  PIACAGYLTKQGHKRKSWKRRYFVLRGALL--SYY  255

 Score = 39.3 bits (90),  Expect = 0.036, Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 23/33 (70%), Gaps = 1/33 (3%)

Query  18  CEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYE  50
           C GY+TKRGH   +W++R+ V+   +  +SYYE
Sbjct  12  CSGYLTKRGHVVTNWKMRFFVLRP-HANLSYYE  43

>H257_06721
Length=1238

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 2/35 (6%)

Query  15   PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
            P +C GY+TK+GH RKSW+ RY V+ G  +  SYY
Sbjct  229  PIACAGYLTKQGHKRKSWKKRYFVLRGSLL--SYY  261

 Score = 40.4 bits (93),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 23/33 (70%), Gaps = 1/33 (3%)

Query  18  CEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYE  50
           C GY+TKRGH   +W++RY V+   +  +SYYE
Sbjct  14  CRGYLTKRGHVVTNWKMRYFVLR-PHASLSYYE  45

>SDRG_12762
Length=1392

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 23/35 (66%), Gaps = 2/35 (6%)

Query  15   PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
            P  CEGY+TKRGH   S+R+RY V+ G    V YY
Sbjct  255  PVDCEGYLTKRGHLVPSYRLRYFVMCG--SVVKYY  287

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 25/35 (71%), Gaps = 2/35 (6%)

Query  15   PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
            P +C G++TK+GH RKSW+ RY V+ G  +  SY+
Sbjct  357  PVACAGWLTKQGHKRKSWKKRYFVLRGTVL--SYF  389

 Score = 32.0 bits (71),  Expect = 7.8, Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 1/30 (3%)

Query  20   GYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
            GY+TKRGH   +W+ R+  +     ++SYY
Sbjct  164  GYLTKRGHVITNWKTRFFALRSQG-RLSYY  192

>PHYKE_2479
Length=171

 Score = 41.6 bits (96),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 25/32 (78%), Gaps = 2/32 (6%)

Query  19   EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYE  50
            EGYVTKRGH  ++W++R+  + G N+ VSYYE
Sbjct  76   EGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYE  105

>PYU1_G001063
Length=783

 Score = 43.5 bits (101),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 23/32 (72%), Gaps = 2/32 (6%)

Query  19   EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYE  50
            EGYVTKRGH  ++W+ R+  + G N+  SYYE
Sbjct  147  EGYVTKRGHLVRNWKNRFFTLEGTNL--SYYE  176

>PYAP_17290
Length=835

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 2/32 (6%)

Query  19   EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYE  50
            EGYVTKRGH  ++W++R+  + G N+  SYYE
Sbjct  153  EGYVTKRGHLVRNWKMRFFTLEGNNL--SYYE  182

>PHYKE_5678
Length=809

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 23/34 (68%), Gaps = 2/34 (6%)

Query  16   TSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
            T  EGY+ K+GH  +SWR RY V+SGV    SYY
Sbjct  100  TDWEGYIWKQGHVVRSWRYRYAVLSGVTF--SYY  131

>PHALS_06533
Length=930

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 25/32 (78%), Gaps = 2/32 (6%)

Query  19   EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYE  50
            EGYVTKRGH  ++W++R+  + G N+ VSYYE
Sbjct  111  EGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYE  140

>PHYRA_77834
Length=936

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 25/32 (78%), Gaps = 2/32 (6%)

Query  19   EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYE  50
            EGYVTKRGH  ++W++R+  + G N+ VSYYE
Sbjct  119  EGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYE  148

>PYVX_13574
Length=950

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 25/32 (78%), Gaps = 2/32 (6%)

Query  19   EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYE  50
            EGYVTKRGH  ++W++R+  + G N+ VSYYE
Sbjct  159  EGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYE  188

>PITG_18067
Length=924

 Score = 42.0 bits (97),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 25/32 (78%), Gaps = 2/32 (6%)

Query  19   EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYE  50
            EGYVTKRGH  ++W++R+  + G N+ VSYYE
Sbjct  109  EGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYE  138

>PPTG_13401
Length=927

 Score = 42.0 bits (97),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 25/32 (78%), Gaps = 2/32 (6%)

Query  19   EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYE  50
            EGYVTKRGH  ++W++R+  + G N+ VSYYE
Sbjct  109  EGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYE  138

>PYIR_15309
Length=937

 Score = 42.0 bits (97),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 23/32 (72%), Gaps = 2/32 (6%)

Query  19   EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYE  50
            EGYVTKRGH  ++W+ R+  + G N+  SYYE
Sbjct  148  EGYVTKRGHLVRNWKNRFFTLEGNNL--SYYE  177

>PYIW_13172
Length=939

 Score = 42.0 bits (97),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 23/32 (72%), Gaps = 2/32 (6%)

Query  19   EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYE  50
            EGYVTKRGH  ++W+ R+  + G N+  SYYE
Sbjct  150  EGYVTKRGHLVRNWKNRFFTLEGNNL--SYYE  179

>PYAR_19914
Length=788

 Score = 42.0 bits (97),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 23/32 (72%), Gaps = 2/32 (6%)

Query  19   EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYE  50
            EGYVTKRGH  ++W+ R+  + G N+  SYYE
Sbjct  146  EGYVTKRGHLVRNWKNRFFTLEGNNL--SYYE  175

>PHYCA_503112
Length=214

 Score = 40.4 bits (93),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 24/32 (75%), Gaps = 2/32 (6%)

Query  19   EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYE  50
            EGYVTKRGH  ++W+ R+  + G N+ VSYYE
Sbjct  117  EGYVTKRGHLVRNWKSRFFTLEG-NL-VSYYE  146

>PITG_11303
Length=293

 Score = 40.8 bits (94),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (67%), Gaps = 2/30 (7%)

Query  14   TPTS--CEGYVTKRGHFRKSWRVRYLVISG  41
            TPT   CEGY+TKRGH   +W+ RY  + G
Sbjct  208  TPTEIKCEGYLTKRGHVFTNWKTRYFTLRG  237

>CCI41225
Length=981

 Score = 41.2 bits (95),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 24/32 (75%), Gaps = 2/32 (6%)

Query  19   EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYE  50
            EGYVTKRGH  ++W++R+  + G   ++SYYE
Sbjct  140  EGYVTKRGHLVRNWKMRFFTLEG--NRLSYYE  169

>PYVX_18338
Length=746

 Score = 41.2 bits (95),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 41/76 (54%), Gaps = 8/76 (11%)

Query  16   TSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKG-----SFILQS  70
            T  EGY+ K+GH  +SWR RY V+SG     SYY SKD +       +G     +   +S
Sbjct  79   TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDVATLDTEKYRGRVTAFAMYTRS  136

Query  71   AEKHEYWISQMVTGSV  86
              + E WI +MVT +V
Sbjct  137  PVECEIWI-KMVTQAV  151

>CCA21715
Length=782

 Score = 41.2 bits (95),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 33/58 (57%), Gaps = 2/58 (3%)

Query  16   TSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEK  73
            T  EGY+ K+GH  +SWR RY V+SG     SYY SK+ + +     +G   +  AE+
Sbjct  106  TDWEGYIWKQGHVVRSWRYRYAVLSGTCF--SYYSSKEIAMADTERYRGRVTVTGAER  161

>CCA21860
Length=782

 Score = 41.2 bits (95),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 33/58 (57%), Gaps = 2/58 (3%)

Query  16   TSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEK  73
            T  EGY+ K+GH  +SWR RY V+SG     SYY SK+ + +     +G   +  AE+
Sbjct  106  TDWEGYIWKQGHVVRSWRYRYAVLSGTCF--SYYSSKEIAMADTERYRGRVTVTGAER  161

>CCA16487
Length=975

 Score = 41.2 bits (95),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 24/32 (75%), Gaps = 2/32 (6%)

Query  19   EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYE  50
            EGYVTKRGH  ++W++R+  + G   ++SYYE
Sbjct  138  EGYVTKRGHLVRNWKMRFFTLEG--NRLSYYE  167

>PHYSO_344112
Length=813

 Score = 40.8 bits (94),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  16   TSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
            T  EGY+ K+GH  +SWR RY V+SG     SYY
Sbjct  101  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYY  132

>PHYCA_506137
Length=810

 Score = 40.8 bits (94),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  16   TSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
            T  EGY+ K+GH  +SWR RY V+SG     SYY
Sbjct  101  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYY  132

>PPTG_05519
Length=810

 Score = 40.8 bits (94),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  16   TSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
            T  EGY+ K+GH  +SWR RY V+SG     SYY
Sbjct  101  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYY  132

>PITG_02762
Length=810

 Score = 40.8 bits (94),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  16   TSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
            T  EGY+ K+GH  +SWR RY V+SG     SYY
Sbjct  101  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYY  132

>PYIW_18480
Length=755

 Score = 40.8 bits (94),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  16  TSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
           T  EGYV K+GH  +SWR RY ++SG     SYY
Sbjct  50  TDWEGYVWKQGHVVRSWRYRYAILSGTTF--SYY  81

>PHYRA_79281
Length=809

 Score = 40.8 bits (94),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  16   TSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
            T  EGY+ K+GH  +SWR RY V+SG     SYY
Sbjct  100  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYY  131

>PYAP_22646
Length=815

 Score = 40.8 bits (94),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  16   TSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
            T  EGY+ K+GH  +SWR RY ++SG     SYY
Sbjct  100  TDWEGYIWKQGHVVRSWRYRYAILSGTTF--SYY  131

>HYAP_08026
Length=798

 Score = 40.8 bits (94),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  16   TSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
            T  EGY+ K+GH  +SWR RY V+SG     SYY
Sbjct  88   TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYY  119

>CCI10489
Length=777

 Score = 40.4 bits (93),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query  16   TSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEKHE  75
            T  EGY+ KRGH  +SWR R+ V+SG  +  SYY SK+ +       +G   + +A   E
Sbjct  104  TDWEGYIWKRGHVVRSWRHRFAVLSGTCL--SYYTSKEVAMLNTEKYRGRVTVTAARNDE  161

>CCI42457
Length=906

 Score = 40.4 bits (93),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 23/32 (72%), Gaps = 2/32 (6%)

Query  19   EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYE  50
            EGYV KRGH  ++W++R+  + G   +VSYYE
Sbjct  130  EGYVIKRGHLVRNWKMRFFTLEG--NRVSYYE  159

>PYIR_13120
Length=814

 Score = 40.4 bits (93),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 32/60 (53%), Gaps = 2/60 (3%)

Query  16   TSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEKHE  75
            T  EGY+ K+GH  +SWR RY ++SG     SYY SK+ +       +G   +  A K E
Sbjct  104  TDWEGYLWKQGHVVRSWRYRYAILSGTTF--SYYVSKEVAMVDTEKFRGRVTVTGARKDE  161

>H257_03361
Length=699

 Score = 40.0 bits (92),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 21/64 (33%), Positives = 37/64 (58%), Gaps = 4/64 (6%)

Query  19  EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEKHEYWI  78
           +G++ K+G    SW+ RYLV+SG N  +SY++      +  A  KGSF+L   + ++ + 
Sbjct  11  QGWIQKQGSVVPSWKKRYLVLSGQN--ISYFD--KEVSNPRAKEKGSFVLAGVQPNKSYD  66

Query  79  SQMV  82
           + M 
Sbjct  67  NGMT  70

>PYU1_G004386
Length=837

 Score = 39.7 bits (91),  Expect = 0.024, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  16   TSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
            T  EGY+ K+GH  +SWR RY ++SG     SYY
Sbjct  136  TDWEGYLWKQGHVVRSWRYRYAILSGTTF--SYY  167

>SPRG_17022
Length=107

 Score = 37.0 bits (84),  Expect = 0.030, Method: Composition-based stats.
 Identities = 22/58 (38%), Positives = 34/58 (59%), Gaps = 2/58 (3%)

Query  16  TSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEK  73
           T  EGY+ K+GH  ++WR RY V+SG     +YY SK+++ +     KG   +  A+K
Sbjct  32  TDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKEAASADLEKYKGRVTVTGAKK  87

>PHALS_03645
Length=830

 Score = 39.3 bits (90),  Expect = 0.030, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  16   TSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
            T  EGY+ K+GH  +SWR RY V+SG     SYY
Sbjct  101  TDWEGYIWKQGHVVRSWRYRYAVLSGTIF--SYY  132

>PYAR_19883
Length=833

 Score = 39.3 bits (90),  Expect = 0.033, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  16   TSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
            T  EGY+ K+GH  ++WR RY ++SG     SYY
Sbjct  100  TDWEGYIWKQGHVVRNWRYRYAILSGTTF--SYY  131

>CCA17102
Length=884

 Score = 39.3 bits (90),  Expect = 0.039, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 23/32 (72%), Gaps = 2/32 (6%)

Query  19   EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYE  50
            EGYV KRGH  ++W++R+  + G   ++SYYE
Sbjct  110  EGYVIKRGHLVRNWKMRFFTLEG--NRLSYYE  139

>PYIR_17453
Length=2619

 Score = 39.3 bits (90),  Expect = 0.040, Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 61/133 (46%), Gaps = 19/133 (14%)

Query  18    CEGYVTKRGHFR-KSWRVRYLVISGVNMQVSYYEskdsskskNATPKG---SFILQSAEK  73
             CEGYV  R HF   +WR R+ V+    + +  Y    ++ S+    K      ++   + 
Sbjct  2160  CEGYVRVRHHFLGAAWRERFAVLEDTRLYL--YPDTSAALSEGREQKALEKHDLIAVKKW  2217

Query  74    HEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLK----  129
             H  + + +  GS +   FGF++   A   GY+E  V ++   +  +WL  I N +     
Sbjct  2218  HPTYSTNLGNGSSR---FGFRVENEA--GGYLECTVIIE--DEQTKWLAAITNAVSEIST  2270

Query  130   --ASKCMAREAFM  140
               +SK M R+A +
Sbjct  2271  HVSSKVMTRDAAL  2283

 Score = 33.9 bits (76),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query  19    EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSF  66
             EGY+ KRGH   S R RY V+  V   + Y+ + + S++    P GSF
Sbjct  1222  EGYLVKRGHLIPSMRKRYCVL--VKNTLEYFATHEDSRNPAIRPHGSF  1267

>SPRG_11900
Length=605

 Score = 38.5 bits (88),  Expect = 0.049, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 7/50 (14%)

Query  15   PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKG  64
            P  C GY+ K+G   K+WR RY  I GV+ Q+SY +      +  A PKG
Sbjct  235  PRLC-GYLLKKGRTVKAWRKRYFSIDGVSNQLSYSD------ADGAPPKG  277

 Score = 34.3 bits (77),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 4/50 (8%)

Query  19  EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFIL  68
            G+V K+G   KSW+ R+LV+ G    V+YY+   S    N   KGS +L
Sbjct  6   SGFVFKQGALIKSWKKRFLVVQG--RHVTYYD--RSVHEPNPREKGSLVL  51

>H310_07070
Length=680

 Score = 38.5 bits (88),  Expect = 0.050, Method: Compositional matrix adjust.
 Identities = 32/125 (26%), Positives = 61/125 (49%), Gaps = 15/125 (12%)

Query  4    NINEQHLAR-YTPTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATP  62
            N++++H +  Y PTS  G + K+ +  K+W+ R++V+ G +M   YY     + S+   P
Sbjct  106  NVDDRHDSDFYAPTSKSGVLVKQANHLKNWKKRFMVLRGQSM--FYY--VSGTTSEETYP  161

Query  63   KGSFILQSAEKHEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLD  122
            +G   L   + H   +S+       +K F F+ + H     Y  L +   + +D+ QW+ 
Sbjct  162  RGVISLSGVDVHPLDVSKF------KKQFCFE-ISHP---NYRSLYMVAKNDADLVQWMS  211

Query  123  VINNG  127
             I + 
Sbjct  212  SIKSA  216

>H310_06378
Length=837

 Score = 38.5 bits (88),  Expect = 0.061, Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 24/32 (75%), Gaps = 2/32 (6%)

Query  19  EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYE  50
           EG+V K+GH  ++W+VRY  + G N+ +SYYE
Sbjct  59  EGFVQKKGHLVRNWKVRYFTLEG-NL-LSYYE  88

>CCI40991
Length=801

 Score = 38.1 bits (87),  Expect = 0.072, Method: Compositional matrix adjust.
 Identities = 15/26 (58%), Positives = 19/26 (73%), Gaps = 0/26 (0%)

Query  16   TSCEGYVTKRGHFRKSWRVRYLVISG  41
            T  EGY+ K+GH  +SWR RY V+SG
Sbjct  106  TDWEGYIWKQGHVVRSWRYRYAVLSG  131

>H257_13567
Length=836

 Score = 38.1 bits (87),  Expect = 0.073, Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 24/32 (75%), Gaps = 2/32 (6%)

Query  19  EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYE  50
           EG+V K+GH  ++W+VRY  + G N+ +SYYE
Sbjct  61  EGFVQKKGHLVRNWKVRYFTLEG-NL-LSYYE  90

>SDRG_03175
Length=934

 Score = 38.1 bits (87),  Expect = 0.084, Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 30/48 (63%), Gaps = 3/48 (6%)

Query  3   PNINEQHLARYTPTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYE  50
           P+  ++HL +  P   EGY+ KRG +   W   Y+V+SGV++  +Y++
Sbjct  11  PSATDRHL-QALPLRWEGYLRKRGDWLPRWDTYYVVLSGVDL--AYFD  55

>SPRG_01654
Length=923

 Score = 38.1 bits (87),  Expect = 0.084, Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 30/48 (63%), Gaps = 3/48 (6%)

Query  3   PNINEQHLARYTPTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYE  50
           P+  ++HL +  P   EGY+ KRG +   W   Y+V+SGV++  +Y++
Sbjct  11  PSATDRHL-QALPLRWEGYLRKRGDWLPRWDTYYVVLSGVDL--TYFD  55

>H257_01308
Length=897

 Score = 38.1 bits (87),  Expect = 0.090, Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 45/111 (41%), Gaps = 16/111 (14%)

Query  19   EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEKHEYWI  78
            EGY+ K+G   K W+ R+ V  G ++  SYY +K   K     P  S  +Q     E W 
Sbjct  24   EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYSTKLEKKPNAVIPLESATVQDGGTSETWN  81

Query  79   SQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLK  129
            S  +  +       + + G              D    + QWLDV++  +K
Sbjct  82   SPRIYLTDGTSGTMYCLSG--------------DEGDVVSQWLDVLDRAVK  118

>PYIR_22667
Length=749

 Score = 37.7 bits (86),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 55/227 (24%), Positives = 96/227 (42%), Gaps = 34/227 (15%)

Query  15   PTS---CEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSA  71
            PTS    EG + KRGH  K+W+ R+  I     ++ YY             KGS  L+S 
Sbjct  398  PTSYIHMEGCLLKRGHVNKNWKNRFFRIE--KGELRYYTENQEEL------KGSVPLKST  449

Query  72   EKHEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLKAS  131
                  +S  +      + + F +     + G  E+ +   + S M +W++ I       
Sbjct  450  -----IVSPGMAQCSDGRKYYFVLTS---RDGKFEMHLNAHNESSMHKWIEAIQE-----  496

Query  132  KCMAREAFMAEMDTTKSVLGFSYIGTTSKQ----QIQVLKSKKCDYIHEALQQIEMAKSA  187
               A+ A    +   ++V G + +   +++    +I+VL SK  D   E  ++ E A   
Sbjct  497  ---AQTALGRTVGAKETVSGLALVVKRAEEIPLAKIEVLYSKPRDITVELERRTE-ALVV  552

Query  188  GNAACDEIVSQGEQLGKVEQNLSTIQNDLNHSEKLIKSIRHPLRYFF  234
              A  D+ V  G QL  V++  S ++   + S  L++S   PL+  F
Sbjct  553  TKAPKDD-VPVGSQLIAVDRR-SILREAYSESRALLRSSNFPLKLEF  597

>PYU1_G009249
Length=2580

 Score = 37.7 bits (86),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 27/48 (56%), Gaps = 0/48 (0%)

Query  19    EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSF  66
             EGY+ KRGH   S R RY V+      + YY + + S++ +  P GSF
Sbjct  1179  EGYLVKRGHLIPSMRKRYCVLLKRGNTLEYYATHEDSRNPSVAPHGSF  1226

>PHYSO_343629
Length=977

 Score = 37.4 bits (85),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 18/23 (78%), Gaps = 0/23 (0%)

Query  19   EGYVTKRGHFRKSWRVRYLVISG  41
            EGYVTKRGH  ++W++R+  + G
Sbjct  130  EGYVTKRGHLVRNWKMRFFTLEG  152

>SDRG_05150
Length=787

 Score = 37.0 bits (84),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 34/58 (59%), Gaps = 2/58 (3%)

Query  16  TSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEK  73
           T  EGY+ K+GH  ++WR RY V+SG     +YY SK+++ +     KG   +  A+K
Sbjct  32  TDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKEAASADLEKYKGRVTVTGAKK  87

>PHALS_06336
Length=511

 Score = 37.0 bits (84),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query  1    MLPNINEQHLARYTPTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYE  50
            ML  I  + + R  P +  G+V K G   +SW+ R+LV  G   +++YY+
Sbjct  117  MLSIIQIREMGREDPATYAGWVFKEGSLVRSWKKRFLVCKGA--ELAYYK  164

>CCA19033
Length=1883

 Score = 37.0 bits (84),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 20/32 (63%), Gaps = 0/32 (0%)

Query  19    EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYE  50
             EGY+ KRGH   S R RY V+  VN  + Y+E
Sbjct  1021  EGYLLKRGHRIPSMRKRYFVLQSVNETLRYFE  1052

>SPRG_08346
Length=797

 Score = 37.0 bits (84),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 34/58 (59%), Gaps = 2/58 (3%)

Query  16  TSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEK  73
           T  EGY+ K+GH  ++WR RY V+SG     +YY SK+++ +     KG   +  A+K
Sbjct  32  TDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKEAASADLEKYKGRVTVTGAKK  87

>PYAR_18690
Length=2455

 Score = 37.0 bits (84),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 53/117 (45%), Gaps = 11/117 (9%)

Query  19    EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEKHEYWI  78
             EGY+ KRGH   S R RY V+   N+   Y   +DS  S  + P GSF ++       W 
Sbjct  1138  EGYLVKRGHLVPSMRKRYCVLVK-NVLTYYLTQEDSRNSDTSQPLGSFRVEIVSD---WH  1193

Query  79    SQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLKASKCMA  135
              +    + +   FG ++  H  K  +     F  SS +  QW+   ++G+  S+  A
Sbjct  1194  GKTAMQTYE---FGMELETHDGKTFFCA--AF--SSEEKTQWIRAFHHGIAISRAEA  1243

>PITG_02109
Length=522

 Score = 36.6 bits (83),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 33/53 (62%), Gaps = 4/53 (8%)

Query  20   GYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAE  72
            G+V K+G   K+W+ R++V+SG   Q++YY+   S  +    PKGSF + + E
Sbjct  138  GWVYKQGSLVKNWKKRFMVLSG--RQLTYYD--TSKLNPTVKPKGSFQVITVE  186

>PPTG_14630
Length=398

 Score = 36.2 bits (82),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 32/53 (60%), Gaps = 4/53 (8%)

Query  20  GYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAE  72
           G+V K+G   K+W+ R++V+SG   Q++YY+   S       PKGSF + + E
Sbjct  12  GWVYKQGSLVKNWKKRFMVLSG--RQLTYYD--TSKLVPTVKPKGSFQVITVE  60

>PHALS_06568
Length=388

 Score = 36.2 bits (82),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 29/46 (63%), Gaps = 4/46 (9%)

Query  20  GYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGS  65
           G+V K+G   KSW+ RY+V+SG   Q++YY+   +   +   PKGS
Sbjct  12  GWVYKQGSIVKSWKKRYMVLSG--RQLTYYD--TAKVDQKVKPKGS  53

>SPRG_02752
Length=831

 Score = 36.2 bits (82),  Expect = 0.30, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 31/55 (56%), Gaps = 4/55 (7%)

Query  19  EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEK  73
           EG++ K+G    +W+ RY+V+ G    ++YY+      +  A  KG+F L + E+
Sbjct  7   EGWIYKQGSLMPTWKKRYMVLKG--RHIAYYD--KEVTNPRAKEKGTFTLAAVER  57

 Score = 31.6 bits (70),  Expect = 8.3, Method: Compositional matrix adjust.
 Identities = 12/31 (39%), Positives = 21/31 (68%), Gaps = 2/31 (6%)

Query  20   GYVTKRGHFRKSWRVRYLVISGVNMQVSYYE  50
            G++ K G   KSW+ R+ V+SG ++  +YY+
Sbjct  134  GWLEKEGQNVKSWKKRFFVLSGTDL--TYYD  162

>H257_03931
Length=695

 Score = 36.2 bits (82),  Expect = 0.30, Method: Compositional matrix adjust.
 Identities = 32/115 (28%), Positives = 53/115 (46%), Gaps = 14/115 (12%)

Query  13   YTPTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAE  72
            Y PTS  G + K+ +  K+W+ R++V+ G +M   YY     + S+   P+G   L   +
Sbjct  106  YAPTSKSGVLVKQANHLKNWKKRFMVLRGQSM--FYY--VSGTSSEETFPRGVISLSGVD  161

Query  73   KHEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNG  127
             H      + T   K K F F+ + H     Y  L +   + +D+ QWL  I + 
Sbjct  162  VHP-----LDTAKFK-KQFCFE-ISHP---NYRSLYMVAKNEADLVQWLSSIKSA  206

>SDRG_14487
Length=964

 Score = 36.2 bits (82),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 31/55 (56%), Gaps = 4/55 (7%)

Query  19  EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEK  73
           EG++ K+G    +W+ RY+V+ G    ++YY+      +  A  KG+F L + E+
Sbjct  7   EGWIYKQGSLMPTWKKRYMVLKG--RHIAYYD--KEVSNPRAKEKGTFTLAAVER  57

 Score = 31.6 bits (70),  Expect = 8.3, Method: Compositional matrix adjust.
 Identities = 12/31 (39%), Positives = 21/31 (68%), Gaps = 2/31 (6%)

Query  20   GYVTKRGHFRKSWRVRYLVISGVNMQVSYYE  50
            G++ K G   KSW+ R+ V+SG ++  +YY+
Sbjct  133  GWLEKEGQNVKSWKKRFFVLSGTDL--TYYD  161

>H310_01921
Length=341

 Score = 35.8 bits (81),  Expect = 0.35, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 31/53 (58%), Gaps = 4/53 (8%)

Query  20  GYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAE  72
           G+V K+G   KSW+ RY+V+   N Q++Y+E        N+  KGSF + + E
Sbjct  24  GWVYKQGSMIKSWKKRYMVLK--NKQLTYFE--SEKVEGNSKAKGSFQVITVE  72

>SDRG_03531
Length=255

 Score = 35.4 bits (80),  Expect = 0.38, Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 45/106 (42%), Gaps = 22/106 (21%)

Query  20   GYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEKHEYWIS  79
            G+V KRG   +SW+ RY V+      ++YY+       +    KG  ++QS E       
Sbjct  166  GWVEKRGAVMRSWKRRYFVLR--ENVLAYYD----INLEGQPKKGGDLVQSIE-------  212

Query  80   QMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVIN  125
               T +VK     FKMV      G      F +++ D  QWL   N
Sbjct  213  ---TSTVKPNGLEFKMVSGRSLVG------FTETTDDHVQWLLAAN  249

>H310_06666
Length=887

 Score = 35.8 bits (81),  Expect = 0.42, Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 45/111 (41%), Gaps = 16/111 (14%)

Query  19   EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEKHEYWI  78
            EGY+ K+G   K W+ R+ V  G ++  SYY SK   K     P  S  +Q     E W 
Sbjct  24   EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYSSKLEKKPNAVIPLESATVQDGGTSETWN  81

Query  79   SQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLK  129
            S  +  +       + + G              D    + QWL+V++  +K
Sbjct  82   SPRIYLTDGTSGTMYCLSG--------------DEGDVVSQWLEVLDRAVK  118

>CCI39615
Length=361

 Score = 35.4 bits (80),  Expect = 0.42, Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 41/91 (45%), Gaps = 18/91 (20%)

Query  167  KSKKCDYIHEALQQIEMAKSAGNAACDEIVSQGEQLGKVEQNLS---------------T  211
            K++  DY ++    IE+ +      C+ +V   + LG    NLS               T
Sbjct  159  KNEPVDYCNKCRDYIELRRPQSGRDCNSVVGYNKGLGVHVMNLSDRCFEEALPMRAAYGT  218

Query  212  IQNDLNHSEKLIKSIRHPLR---YFFSRSRP  239
              ++L HS K++  ++HPLR   +F  + +P
Sbjct  219  ALHELGHSLKMLHELQHPLRTVLFFLDKIKP  249

>PPTG_04553
Length=904

 Score = 35.8 bits (81),  Expect = 0.44, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 17/23 (74%), Gaps = 0/23 (0%)

Query  17   SCEGYVTKRGHFRKSWRVRYLVI  39
            S  G++ KRGH RK+W+ RY V+
Sbjct  361  SMSGWLRKRGHVRKNWKARYFVL  383

>SDRG_08800
Length=881

 Score = 35.8 bits (81),  Expect = 0.46, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 24/32 (75%), Gaps = 2/32 (6%)

Query  19  EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYE  50
           EG+V+K+GH  ++W++RY  +   N+ +SYYE
Sbjct  66  EGFVSKKGHLVRNWKLRYFTLES-NL-LSYYE  95

>PHYRA_73535
Length=875

 Score = 35.8 bits (81),  Expect = 0.48, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 17/23 (74%), Gaps = 0/23 (0%)

Query  17   SCEGYVTKRGHFRKSWRVRYLVI  39
            S  G++ KRGH RK+W+ RY V+
Sbjct  339  SMSGWLRKRGHVRKNWKARYFVL  361

>H310_14019
Length=683

 Score = 35.4 bits (80),  Expect = 0.49, Method: Compositional matrix adjust.
 Identities = 31/121 (26%), Positives = 55/121 (45%), Gaps = 25/121 (21%)

Query  4    NINEQHLARYTPTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPK  63
            ++NE+H  R +  S EG++ KRG   K+W+ RY  ++G   ++ Y E         A PK
Sbjct  159  DVNERH-RRASMRSFEGWLLKRGQRVKNWKRRYFTLNG--QELKYME------GPGAKPK  209

Query  64   GSFILQSAEKHEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDV  123
            G  ++   +K            + E P+    +   P +    LDV  +S+ + + W+  
Sbjct  210  GYGMVVGVKK------------LHELPYALS-ISIVPNR---TLDVQAESTDEQEAWMQR  253

Query  124  I  124
            I
Sbjct  254  I  254

 Score = 32.3 bits (72),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 19/28 (68%), Gaps = 0/28 (0%)

Query  14   TPTSCEGYVTKRGHFRKSWRVRYLVISG  41
            T T+CEG++ K+G   K+W+ R+  + G
Sbjct  340  TATTCEGWLYKQGSLVKNWKKRWFTLLG  367

>H257_03363
Length=316

 Score = 35.0 bits (79),  Expect = 0.49, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 29/47 (62%), Gaps = 4/47 (9%)

Query  20  GYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSF  66
           G+V K+G   KSW+ RY+V+   N Q++Y+E  +     N+  KGSF
Sbjct  8   GWVYKQGSMVKSWKKRYMVLK--NKQLTYFE--NEKIEGNSKAKGSF  50

>PYAP_17385
Length=1236

 Score = 35.8 bits (81),  Expect = 0.51, Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 31/51 (61%), Gaps = 0/51 (0%)

Query  268  RNVDHLAEEIRVPTNDIEKLAMALKDLEVQAQLINSEAVKSNEQIARIEGQ  318
            +N+D   +++ V  N  +KL   + + E+   ++N EAVK+ EQ+  I+G+
Sbjct  377  QNLDEGVQDVFVTLNPTQKLENTIMEFELSHPVLNEEAVKAQEQLGSIQGK  427

>PITG_17893
Length=747

 Score = 35.4 bits (80),  Expect = 0.52, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 17/23 (74%), Gaps = 0/23 (0%)

Query  17   SCEGYVTKRGHFRKSWRVRYLVI  39
            S  G++ KRGH RK+W+ RY V+
Sbjct  218  SMSGWLRKRGHVRKNWKARYFVL  240

>PYAP_16297
Length=2466

 Score = 35.8 bits (81),  Expect = 0.52, Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 55/114 (48%), Gaps = 12/114 (11%)

Query  19    EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEKHEYWI  78
             EGY+ KRGH   S R RY ++  V   ++YY + + S++    P GSF ++       W 
Sbjct  1168  EGYLVKRGHLVPSMRKRYCML--VKNVLTYYLTHEDSRNTEIQPLGSFRVEIVSD---WH  1222

Query  79    SQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLKASK  132
              +  T + +   +G ++  H  K  +     F  S+ +  QW+   ++G+  S+
Sbjct  1223  GKTTTQTYE---YGMELETHDGKTFFCA--AF--SNEEKVQWMRAFHHGIALSR  1269

>PYU1_G012859
Length=1183

 Score = 35.4 bits (80),  Expect = 0.54, Method: Compositional matrix adjust.
 Identities = 29/136 (21%), Positives = 60/136 (44%), Gaps = 28/136 (21%)

Query  20   GYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEKHEYWIS  79
            G++ K+GH  +SW+ RY V+ G ++Q  Y+E      + +  P+G  I          + 
Sbjct  497  GWLLKQGHLIRSWKQRYFVLHGDSLQ--YFE------NIDKPPRGGGI----------VV  538

Query  80   QMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINN----GLKASKCMA  135
             ++  +V +      +       G + L +  D+  D++ W D + N    G +A++   
Sbjct  539  HVLRDTVDQNCLDVHLA-----NGRV-LKISADARDDLNSWYDALQNASKLGAEATEDQE  592

Query  136  REAFMAEMDTTKSVLG  151
             +     +D + + LG
Sbjct  593  NQVEETNLDNSGNRLG  608

 Score = 32.3 bits (72),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 10/24 (42%), Positives = 17/24 (71%), Gaps = 0/24 (0%)

Query  17   SCEGYVTKRGHFRKSWRVRYLVIS  40
            +CEG++ K+GH  K W+ RY  ++
Sbjct  358  TCEGWLLKQGHKSKRWKRRYFTLN  381

>PYU1_G003229
Length=810

 Score = 35.4 bits (80),  Expect = 0.58, Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 29/50 (58%), Gaps = 8/50 (16%)

Query  20   GYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQ  69
            G++ K+GH  KSW+ R+ V+ G    ++Y+E        +  PKGS ++Q
Sbjct  402  GWLNKQGHRMKSWKRRFFVVEGST--ITYFE------QVHEDPKGSGVIQ  443

 Score = 32.7 bits (73),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 10/28 (36%), Positives = 18/28 (64%), Gaps = 0/28 (0%)

Query  18   CEGYVTKRGHFRKSWRVRYLVISGVNMQ  45
            CEG++ KRG    +W+ R+  ++G  +Q
Sbjct  260  CEGWLYKRGQRSTAWKKRFFTLNGFQLQ  287

>PHYSO_556164
Length=765

 Score = 35.4 bits (80),  Expect = 0.60, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 17/23 (74%), Gaps = 0/23 (0%)

Query  17   SCEGYVTKRGHFRKSWRVRYLVI  39
            S  G++ KRGH RK+W+ RY V+
Sbjct  220  SMSGWLRKRGHVRKNWKARYFVL  242

>HYAP_08248
Length=784

 Score = 35.0 bits (79),  Expect = 0.65, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 20/27 (74%), Gaps = 0/27 (0%)

Query  20   GYVTKRGHFRKSWRVRYLVISGVNMQV  46
            G +TKRGHF K+W  R+LV+S   +QV
Sbjct  84   GALTKRGHFFKAWLPRHLVLSRGALQV  110

>SDRG_02135
Length=306

 Score = 34.7 bits (78),  Expect = 0.65, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 22/32 (69%), Gaps = 2/32 (6%)

Query  19  EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYE  50
           EGY+ K+GH  K+WR RY  +  V+  ++YY+
Sbjct  2   EGYLLKQGHVVKNWRRRYFRL--VDASLAYYD  31

>SDRG_14486
Length=308

 Score = 34.7 bits (78),  Expect = 0.69, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 36/54 (67%), Gaps = 4/54 (7%)

Query  19  EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAE  72
           +G+V K+G   +SW+ RY+V+   N Q+SY+++++ + S  A  KGSF + + E
Sbjct  7   QGWVFKQGSLVRSWKKRYMVLK--NKQLSYFDTENVTASTKA--KGSFAVITIE  56

>SPRG_02753
Length=309

 Score = 34.7 bits (78),  Expect = 0.74, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 36/54 (67%), Gaps = 4/54 (7%)

Query  19  EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAE  72
           +G+V K+G   +SW+ RY+V+   N Q+SY+++++ + S  A  KGSF + + E
Sbjct  7   QGWVFKQGSLVRSWKKRYMVLK--NKQLSYFDTENVTASTKA--KGSFAVITIE  56

>CCI45895
Length=1721

 Score = 35.0 bits (79),  Expect = 0.75, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 20/32 (63%), Gaps = 0/32 (0%)

Query  19   EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYE  50
            EGY+ KRGH   S R RY V+  V+  + Y+E
Sbjct  843  EGYLLKRGHRIPSMRKRYFVLQSVDPTLRYFE  874

>H310_07701
Length=811

 Score = 35.0 bits (79),  Expect = 0.78, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  16  TSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
           T  EGYV K+GH  ++WR RY +++G     +YY
Sbjct  50  TDWEGYVWKQGHVVRNWRNRYGILTGTCF--TYY  81

>H257_07514
Length=810

 Score = 35.0 bits (79),  Expect = 0.81, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  16  TSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
           T  EGYV K+GH  ++WR RY +++G     +YY
Sbjct  50  TDWEGYVWKQGHVVRNWRNRYGILTGTCF--TYY  81

>CCI39367
Length=2046

 Score = 35.0 bits (79),  Expect = 0.82, Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 4/47 (9%)

Query  6    NEQHLARYTPTS---CEGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
            NE+H AR          G++ K+GH  KSWRVR+ V+   +  ++YY
Sbjct  69   NERHYARMLAMGEYIKMGWLRKQGHLWKSWRVRFFVLY-TDGTLAYY  114

>PYIR_15118
Length=1222

 Score = 35.0 bits (79),  Expect = 0.85, Method: Compositional matrix adjust.
 Identities = 22/85 (26%), Positives = 39/85 (46%), Gaps = 13/85 (15%)

Query  4    NINEQHLARYTPTSC--EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskN--  59
            N+N + + +++ +     GY+ K+G F K+WR RY ++      +SYY+S +        
Sbjct  175  NVNGKDVEQFSDSDIVYSGYLVKQGSFWKTWRRRYFILRRDIPVLSYYDSAEELTKLGEI  234

Query  60   ---------ATPKGSFILQSAEKHE  75
                      TP+  F  Q   +HE
Sbjct  235  TVDGTTGVRPTPREGFPFQFVVEHE  259

>SPRG_05449
Length=723

 Score = 34.7 bits (78),  Expect = 0.86, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 24/32 (75%), Gaps = 2/32 (6%)

Query  19  EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYE  50
           EG+V+K+GH  ++W++RY  +   N+ +SYYE
Sbjct  66  EGFVSKKGHLVRNWKLRYFTLES-NL-LSYYE  95

>PYU1_G009508
Length=328

 Score = 34.3 bits (77),  Expect = 0.86, Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 11/67 (16%)

Query  20   GYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskd-----------sskskNATPKGSFIL  68
            GY+ K+G + K+WR RY ++      +SYY+S +           ++ +   TP+  F  
Sbjct  166  GYLVKQGSYWKTWRRRYFILRRDTPVLSYYDSAEELTKLGEITVDATTTVKPTPREGFPF  225

Query  69   QSAEKHE  75
            Q   +HE
Sbjct  226  QFVVEHE  232

>SDRG_06288
Length=641

 Score = 34.7 bits (78),  Expect = 0.87, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 1/36 (3%)

Query  15   PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYE  50
            P  C G + K+G   K+WR RY  I GV+ Q+SY +
Sbjct  259  PRHC-GILLKKGRTVKAWRKRYFSIDGVSNQLSYSD  293

 Score = 33.9 bits (76),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 28/49 (57%), Gaps = 4/49 (8%)

Query  20  GYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFIL  68
           G+V K+G   KSW+ R+LV+ G    VSYY+   S    +   KGS +L
Sbjct  7   GFVFKQGSLIKSWKKRFLVVQG--RHVSYYD--RSVHEPDPREKGSLVL  51

>SPRG_14312
Length=661

 Score = 34.7 bits (78),  Expect = 0.89, Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 55/115 (48%), Gaps = 14/115 (12%)

Query  13   YTPTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAE  72
            Y P S  G + K+ +  K+W+ R++V+ G ++   YY     + S+++ PKG   L   E
Sbjct  106  YAPLSRSGVLVKQANHLKNWKKRFMVLRGQSL--FYY--VSGAASEDSYPKGLISLVGVE  161

Query  73   KHEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNG  127
                   Q+V  +  +K F F++  H     Y  L +   + +D+ QW+  I + 
Sbjct  162  ------VQLVDVARFKKQFCFEL-SHP---YYRPLYLMAKNEADLTQWMSCIKSA  206

>PHYKE_4910
Length=375

 Score = 34.3 bits (77),  Expect = 0.93, Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 23/40 (58%), Gaps = 2/40 (5%)

Query  10   LARYTPTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
            + R  P +  G+V K G   +SW+ R+LV  G   +++YY
Sbjct  120  MGRTDPVTYAGWVFKEGSLVRSWKKRFLVCKGA--ELAYY  157

>PYVX_14527
Length=1269

 Score = 34.7 bits (78),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 33/53 (62%), Gaps = 4/53 (8%)

Query  20   GYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAE  72
            G+V K+G   ++W+ R++V+ G   Q++YY++   + S  A  KGSF L + E
Sbjct  903  GWVYKQGSLVRNWKKRFMVLHG--RQLTYYDTARLTPSVKA--KGSFTLITVE  951

>CCA19118
Length=125

 Score = 32.7 bits (73),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 25/44 (57%), Gaps = 2/44 (5%)

Query  6   NEQHLA--RYTPTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVS  47
           NE++L+  R    + EG +TKR  + K WR RY ++ G  +  S
Sbjct  5   NEENLSTERIQNPAFEGELTKRSMWMKEWRKRYFILKGNKLYFS  48

>SDRG_08236
Length=864

 Score = 34.3 bits (77),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 24/71 (34%), Positives = 32/71 (45%), Gaps = 3/71 (4%)

Query  13  YTPTSC-EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSA  71
           Y PT   EGY+ K+G   K W+ R+ V  G ++  SYY S    K     P  S  +Q  
Sbjct  16  YDPTYMKEGYLQKKGQLLKGWKKRWFVCDGRSL--SYYISSKDKKPNAVIPLESASVQDG  73

Query  72  EKHEYWISQMV  82
              E W S  +
Sbjct  74  GLSETWHSPRI  84

>PHYRA_78815
Length=919

 Score = 34.3 bits (77),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 35/137 (26%), Positives = 52/137 (38%), Gaps = 36/137 (26%)

Query  18   CEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEKHEYW  77
            CEG++ KRG     W+ RY  + G  +Q              + PKG+            
Sbjct  275  CEGWLYKRGQRSTEWQRRYFKLKGFKLQY-------QDGPGESVPKGA------------  315

Query  78   ISQMVTGSVKEKPFGFKMVGHAPKQGYIELD------VFVDSSSDMDQWLDVINNGL-KA  130
                  G+V     G K+        Y++LD      V  DS   +D+W+  I + L K 
Sbjct  316  ------GTV----VGLKLGETGSNCVYVQLDSGRVLCVSADSQGQVDKWVQAICSLLDKD  365

Query  131  SKCMAREAFMAEMDTTK  147
             K + +EA  A    TK
Sbjct  366  PKTVEKEAPTAAPAVTK  382

>CCI46235
Length=1155

 Score = 34.3 bits (77),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 10/54 (19%)

Query  4    NINEQHLARYTPTSC--------EGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
            N N    +++ P+S         EGYV K+G +   W  RYLV+ G  +  +YY
Sbjct  97   NPNTAPTSQFPPSSVFQQHQVHWEGYVRKKGDWLPRWEERYLVLDGATL--TYY  148

>PYIW_18911
Length=1196

 Score = 34.3 bits (77),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 15/49 (31%), Positives = 29/49 (59%), Gaps = 2/49 (4%)

Query  4    NINEQHLARYTPTSC--EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYE  50
            N+N + + +++ +     GY+ K+G F K+WR RY ++      +SYY+
Sbjct  156  NVNGKDVEQFSDSDIVYSGYLVKQGSFWKTWRRRYFILRRDIPVLSYYD  204

>PYAP_18636
Length=1009

 Score = 34.3 bits (77),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 2/31 (6%)

Query  19   EGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
            EGYV K+G +   W  RYLV+ G  +  +YY
Sbjct  103  EGYVRKKGDWLPRWEERYLVLDGATL--TYY  131

>PYIW_16987
Length=821

 Score = 33.9 bits (76),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 2/31 (6%)

Query  19   EGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
            EGYV K+G +   W  RYLV+ G  +  +YY
Sbjct  120  EGYVRKKGDWLPRWEERYLVLDGAAL--TYY  148

>H310_08803
Length=916

 Score = 33.9 bits (76),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 84/204 (41%), Gaps = 42/204 (21%)

Query  6    NEQHLARYTPTSCE--GYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPK  63
            N+++L R   +S    GY+ K+G   K+W  R+ +++G+N Q+ Y +       +  TPK
Sbjct  326  NQEYLERRISSSIRYAGYLHKKGSNIKTWHRRWFMLTGLN-QLGYCD------KEGETPK  378

Query  64   GSFILQSAEKHEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELD------VFVDSSSDM  117
            G               +++   V  K        H     Y+ LD      V  DS +D+
Sbjct  379  G-------------YGKVIDVCVNHK------RAHCL---YVHLDSGRRLSVAADSQNDI  416

Query  118  DQWLDVINNGLKASKCMAREAFMAEMDTTKSVLG--FSYIGTTSKQQIQVLKSKKCDY--  173
            D W  V++    A     ++   +  D T   LG   S+ G   K+  + +KS K  Y  
Sbjct  417  DGWYQVLSKVAAAVAQNQQQQRSSAPDATNESLGKHTSHSGWLQKEG-KSIKSWKRRYFT  475

Query  174  IHEALQQIEMAKSAGNAACDEIVS  197
            +H+ +         GNA    IVS
Sbjct  476  LHDRMLVYHKDMEGGNAVGQGIVS  499

>PHYKE_4911
Length=46

 Score = 30.4 bits (67),  Expect = 1.6, Method: Composition-based stats.
 Identities = 12/31 (39%), Positives = 22/31 (71%), Gaps = 2/31 (6%)

Query  20  GYVTKRGHFRKSWRVRYLVISGVNMQVSYYE  50
           G+V K+G   K+W+ R++V+ G   Q++YY+
Sbjct  9   GWVYKQGSLVKNWKKRFMVLRG--RQLTYYD  37

>PHYRA_73534
Length=1210

 Score = 33.9 bits (76),  Expect = 1.7, Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 17/23 (74%), Gaps = 0/23 (0%)

Query  17   SCEGYVTKRGHFRKSWRVRYLVI  39
            S  G++ KRGH RK+W+ RY V+
Sbjct  339  SMSGWLRKRGHVRKNWKARYFVL  361

>SPRG_01860
Length=674

 Score = 33.9 bits (76),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 24/71 (34%), Positives = 32/71 (45%), Gaps = 3/71 (4%)

Query  13  YTPTSC-EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSA  71
           Y PT   EGY+ K+G   K W+ R+ V  G ++  SYY S    K     P  S  +Q  
Sbjct  16  YDPTYMKEGYLQKKGQLLKGWKKRWFVCDGRSL--SYYISSKDKKPNAVIPLESASVQDG  73

Query  72  EKHEYWISQMV  82
              E W S  +
Sbjct  74  GLSETWHSPRI  84

>PYIR_23012
Length=965

 Score = 33.9 bits (76),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 32/74 (43%), Gaps = 3/74 (4%)

Query  10  LARYTPTSC-EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFIL  68
           LA Y PT   EGY+ K+G   K W+ R+ V     +  SYY ++   K     P     +
Sbjct  28  LAEYDPTCMKEGYLQKKGQRLKGWKRRWFVCDARTL--SYYINRKDRKPNAVIPLEGCTV  85

Query  69  QSAEKHEYWISQMV  82
           Q     E W S  +
Sbjct  86  QDGGLSETWNSPRI  99

>SDRG_01407
Length=815

 Score = 33.9 bits (76),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (65%), Gaps = 2/31 (6%)

Query  19   EGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
            EGYV K+G +   W  RYLV+ G ++  +YY
Sbjct  85   EGYVRKKGDWLPRWEERYLVLDGASL--TYY  113

>SDRG_00080
Length=298

 Score = 33.5 bits (75),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 23/39 (59%), Gaps = 0/39 (0%)

Query  1   MLPNINEQHLARYTPTSCEGYVTKRGHFRKSWRVRYLVI  39
           ML +    + A   P +  GYV K+G F K+W+ RY+V+
Sbjct  56  MLSSSRSGNEAPSGPPAFSGYVRKQGSFVKNWKRRYMVL  94

>PPTG_10755
Length=723

 Score = 33.9 bits (76),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (60%), Gaps = 3/47 (6%)

Query  20   GYVTKRG-HFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGS  65
            G + KRG  +RK W++RY+ + G   Q++YYE   +  +  AT  G+
Sbjct  103  GSLEKRGFRWRKKWKLRYVELDG--RQLAYYEDSGAFSATTATASGT  147

>PITG_00416
Length=698

 Score = 33.9 bits (76),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 3/47 (6%)

Query  20   GYVTKRG-HFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGS  65
            G + KRG  +RK W++RY+ + G   Q++YYE   +     AT  G+
Sbjct  79   GALEKRGFRWRKKWKLRYVELDG--RQLAYYEDSGAFSVTTATASGT  123

>PHYRA_82543
Length=1199

 Score = 33.9 bits (76),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 13/31 (42%), Positives = 19/31 (61%), Gaps = 2/31 (6%)

Query  19  EGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
           EGYV K+G +   W  RYL++ G  +  +YY
Sbjct  61  EGYVRKKGDWLPRWEERYLILDGATL--TYY  89

>PPTG_19371
Length=1195

 Score = 33.9 bits (76),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 13/31 (42%), Positives = 19/31 (61%), Gaps = 2/31 (6%)

Query  19  EGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
           EGYV K+G +   W  RYL++ G  +  +YY
Sbjct  71  EGYVRKKGDWLPRWEERYLILDGATL--TYY  99

>H257_03093
Length=975

 Score = 33.9 bits (76),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (65%), Gaps = 2/31 (6%)

Query  19   EGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
            EGYV K+G +   W  RYLV+ G ++  +YY
Sbjct  104  EGYVRKKGDWLPRWEERYLVLDGASL--TYY  132

>PYU1_G008848
Length=765

 Score = 33.9 bits (76),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 2/31 (6%)

Query  19   EGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
            EGYV K+G +   W  RYLV+ G  +  +YY
Sbjct  134  EGYVRKKGDWLPRWEERYLVLDGAAL--TYY  162

>PYIW_21108
Length=2593

 Score = 33.9 bits (76),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query  19    EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSF  66
             EGY+ KRGH   S R RY V+   N  + Y+ + + S++    P GSF
Sbjct  1234  EGYLVKRGHLIPSMRKRYCVLLK-NASLEYFATHEDSRNPAIRPHGSF  1280

>H257_05175
Length=678

 Score = 33.9 bits (76),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 22/69 (32%), Positives = 36/69 (52%), Gaps = 18/69 (26%)

Query  19  EGYVTKR-GHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFIL---------  68
           EG++TKR  H    W  RY ++ G N++  YY+     K  + TP+G+++L         
Sbjct  2   EGWLTKRRDHMNIIWTERYFILEGSNLR--YYK-----KRGDPTPRGTYVLTNECVVGKV  54

Query  69  -QSAEKHEY  76
             S EKH++
Sbjct  55  FNSEEKHKH  63

>PYAR_15463
Length=1091

 Score = 33.9 bits (76),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 2/31 (6%)

Query  19   EGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
            EGYV K+G +   W  RYLV+ G  +  +YY
Sbjct  78   EGYVRKKGDWLPRWEERYLVLDGATL--TYY  106

>H310_04843
Length=968

 Score = 33.9 bits (76),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (65%), Gaps = 2/31 (6%)

Query  19   EGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
            EGYV K+G +   W  RYLV+ G ++  +YY
Sbjct  103  EGYVRKKGDWLPRWEERYLVLDGASL--TYY  131

>H310_04667
Length=680

 Score = 33.5 bits (75),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 22/69 (32%), Positives = 36/69 (52%), Gaps = 18/69 (26%)

Query  19  EGYVTKR-GHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFIL---------  68
           EG++TKR  H    W  RY ++ G N++  YY+     K  + TP+G+++L         
Sbjct  2   EGWLTKRRDHMNIIWTERYFILEGSNLR--YYK-----KRGDPTPRGTYVLTNECIVGKV  54

Query  69  -QSAEKHEY  76
             S EKH++
Sbjct  55  FNSEEKHKH  63

>PHYSO_544598
Length=1163

 Score = 33.9 bits (76),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 13/31 (42%), Positives = 19/31 (61%), Gaps = 2/31 (6%)

Query  19  EGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
           EGYV K+G +   W  RYL++ G  +  +YY
Sbjct  19  EGYVRKKGDWLPRWEERYLILDGATL--TYY  47

>SPRG_00364
Length=255

 Score = 33.1 bits (74),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 44/107 (41%), Gaps = 22/107 (21%)

Query  20   GYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEKHEYWIS  79
            G+V KRG   ++W+ RY V+      ++YY+       +    KG   +QS E       
Sbjct  166  GWVEKRGAVMRTWKRRYFVLR--ENVLAYYD----INLEGQPKKGGDFVQSIE-------  212

Query  80   QMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINN  126
               T ++K     FKMV      G      F +++ D  QWL   N 
Sbjct  213  ---TSTIKPNGLEFKMVSGRSLLG------FTETTDDHVQWLLAANT  250

>H310_06667
Length=896

 Score = 33.5 bits (75),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 28/117 (24%), Positives = 49/117 (42%), Gaps = 28/117 (24%)

Query  19   EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEKHEYW-  77
            EGY+ K+G   K W+ R+ V  G ++  SY+ +K         P  +  +Q     E W 
Sbjct  37   EGYLQKQGQLLKGWKKRWFVCDGRSL--SYFHTKADKTPSAVIPLETATVQGGGTSERWN  94

Query  78   -----ISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLK  129
                 ++  V+G V      + + G              D ++ M QWLDV+ + ++
Sbjct  95   GPKINVTDTVSGVV------YCLSGE-------------DGATVM-QWLDVLQHAVQ  131

>CCA15513
Length=1341

 Score = 33.9 bits (76),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 28/48 (58%), Gaps = 6/48 (13%)

Query  6    NEQHLARYTPTSCE----GYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
            NEQH AR   T  E    G+++K+GH  K WR R+ V+   +  ++YY
Sbjct  69   NEQHYARML-TMGEYIKMGWLSKQGHLWKGWRSRFFVLYA-DGTLAYY  114

>H257_06469
Length=76

 Score = 30.8 bits (68),  Expect = 2.0, Method: Composition-based stats.
 Identities = 12/19 (63%), Positives = 14/19 (74%), Gaps = 0/19 (0%)

Query  19  EGYVTKRGHFRKSWRVRYL  37
           EGYV K+GH  KSW+ RY 
Sbjct  2   EGYVFKQGHVVKSWQRRYF  20

>PHYRA_82040
Length=1054

 Score = 33.5 bits (75),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 51/128 (40%), Gaps = 24/128 (19%)

Query  8    QHLARYTPTSC-EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSF  66
            + LA Y PT   EG++ K+G   K W+ R+ V  G  +  SYY S+   K     P    
Sbjct  131  ESLADYDPTYMKEGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISRKDRKPNAVIPLEGC  188

Query  67   ILQSAEKHEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVI--  124
             +Q     E W S  +       P    M   + ++G +           + QWLDV+  
Sbjct  189  TVQDGGLSETWNSPRI---YLTDPATGIMYCLSAEEGIV-----------VTQWLDVLRV  234

Query  125  -----NNG  127
                 NNG
Sbjct  235  AVARANNG  242

>PHYSO_478611
Length=522

 Score = 33.5 bits (75),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 18/53 (34%), Positives = 32/53 (60%), Gaps = 4/53 (8%)

Query  20   GYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAE  72
            G+V K+G   K+W+ R++V+ G   Q++YY++     +  A  KGSF + + E
Sbjct  141  GWVYKQGSLVKNWKKRFMVLRG--RQLTYYDTAKVDPTVKA--KGSFQVITVE  189

>PITG_19213
Length=1201

 Score = 33.5 bits (75),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 13/31 (42%), Positives = 19/31 (61%), Gaps = 2/31 (6%)

Query  19  EGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
           EGYV K+G +   W  RYL++ G  +  +YY
Sbjct  71  EGYVRKKGDWLPRWEERYLILDGATL--TYY  99

>CCA18023
Length=1138

 Score = 33.5 bits (75),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 2/31 (6%)

Query  19   EGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
            EGYV K+G +   W  RYLV+ G  +  +YY
Sbjct  125  EGYVRKKGDWLPRWEERYLVLDGATL--TYY  153

>SPRG_00890
Length=883

 Score = 33.5 bits (75),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (65%), Gaps = 2/31 (6%)

Query  19  EGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
           EGYV K+G +   W  RYLV+ G ++  +YY
Sbjct  31  EGYVRKKGDWLPRWEERYLVLDGASL--TYY  59

>PYIR_18382
Length=1154

 Score = 33.5 bits (75),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 2/31 (6%)

Query  19   EGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
            EGYV K+G +   W  RYLV+ G  +  +YY
Sbjct  129  EGYVRKKGDWLPRWEERYLVLDGAAL--TYY  157

>PYVX_13312
Length=1016

 Score = 33.5 bits (75),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 13/31 (42%), Positives = 19/31 (61%), Gaps = 2/31 (6%)

Query  19   EGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
            EGYV K+G +   W  RYL++ G  +  +YY
Sbjct  76   EGYVRKKGDWLPRWEERYLILDGAAL--TYY  104

>PYIW_17818
Length=1188

 Score = 33.5 bits (75),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 18/32 (56%), Gaps = 0/32 (0%)

Query  14   TPTSCEGYVTKRGHFRKSWRVRYLVISGVNMQ  45
            TP  C G++ K G   K+W+ RY  + G  ++
Sbjct  826  TPGGCSGWLNKEGGTIKTWKRRYFSLHGTTLR  857

>PHALS_03540
Length=904

 Score = 33.1 bits (74),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 17/28 (61%), Gaps = 0/28 (0%)

Query  18   CEGYVTKRGHFRKSWRVRYLVISGVNMQ  45
            CEG++ KRG     W+ RY ++ G  +Q
Sbjct  272  CEGWLYKRGQRSTEWQRRYFILKGYQLQ  299

>H257_08182
Length=859

 Score = 33.1 bits (74),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 18/49 (37%), Positives = 29/49 (59%), Gaps = 4/49 (8%)

Query  20  GYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFIL  68
           G++ K+G   K+W+ RY+V+ G    V+YY+   S    N T KG+ +L
Sbjct  10  GWIYKQGSRVKTWKKRYMVLQG--RHVTYYD--KSVLEPNPTEKGALVL  54

 Score = 32.7 bits (73),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 6/39 (15%)

Query  16   TSC----EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYE  50
            TSC    EG++ K+G   KSW+ RY V+ G ++  +YY+
Sbjct  657  TSCMMTQEGWMLKQGKQVKSWKRRYFVVHGTDL--AYYK  693

>PHALS_04098
Length=1183

 Score = 33.5 bits (75),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 13/31 (42%), Positives = 19/31 (61%), Gaps = 2/31 (6%)

Query  19   EGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
            EGYV K+G +   W  RYL++ G  +  +YY
Sbjct  75   EGYVRKKGDWLPRWEERYLILDGATL--TYY  103

>PYU1_G011261
Length=1328

 Score = 33.5 bits (75),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 32/124 (26%), Positives = 56/124 (45%), Gaps = 22/124 (18%)

Query  16   TSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEKHE  75
            T   G++ K+G   +S++ RY+ ++G  +  SYY+ K          K    L +AEK  
Sbjct  165  TFISGFLRKKGEKNRSFKRRYMELNGTVL--SYYKKKPEK-------KSGIPLSAAEKKA  215

Query  76   Y--------WISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNG  127
            Y         +S +     K +PFG  +V  A  + ++   +  +S  D  +WL V+   
Sbjct  216  YERGSIDLDRVSSLQPMENKSEPFGIHLVTTA--RTWV---IAAESDQDYQRWLKVLCGV  270

Query  128  LKAS  131
            +K S
Sbjct  271  VKYS  274

>PHYCA_504801
Length=398

 Score = 33.1 bits (74),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 18/53 (34%), Positives = 33/53 (62%), Gaps = 4/53 (8%)

Query  20  GYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAE  72
           G+V K+G   K+W+ R++V+ G   Q++YY++   + +  A  KGSF + + E
Sbjct  12  GWVYKQGSLVKNWKKRFMVLRG--RQLTYYDTAKVNPTTKA--KGSFQVITVE  60

>PHALS_12503
Length=340

 Score = 32.7 bits (73),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 12/31 (39%), Positives = 23/31 (74%), Gaps = 2/31 (6%)

Query  20   GYVTKRGHFRKSWRVRYLVISGVNMQVSYYE  50
            G++ KRGH  K+W+ R+ +++GV   ++YY+
Sbjct  101  GWLWKRGHSFKTWKKRFFLLNGV--ALTYYK  129

>HYAP_09304
Length=1144

 Score = 33.1 bits (74),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 0/30 (0%)

Query  20   GYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
            GY+ K+G F KSWR R+ ++      +SYY
Sbjct  125  GYLVKQGSFWKSWRRRFFILRRDCPVLSYY  154

>HYAP_06101
Length=984

 Score = 33.1 bits (74),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 33/129 (26%), Positives = 60/129 (47%), Gaps = 21/129 (16%)

Query  20   GYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEKHEYWIS  79
            G++TK+GH  KSW+ R+ V+   +   +YY++K   K      KG   L           
Sbjct  143  GWLTKQGHLWKSWKTRFFVLFA-DGTFAYYKNKGRKKI-----KGCMQLNDGVVS----V  192

Query  80   QMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLKASKCMAREAF  139
            Q V   V EK + F++     ++G+ +L  +  S  + + W+      L++ + +A   +
Sbjct  193  QHVDIRVAEKAYAFQI-----EKGFYKLLCYCCSQFEAEIWV----AALRSVRRVAPPCY  243

Query  140  MAEMDTTKS  148
              EMD T +
Sbjct  244  --EMDLTST  250

>CCA19097
Length=688

 Score = 33.1 bits (74),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 55/107 (51%), Gaps = 21/107 (20%)

Query  20   GYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEKHEYWIS  79
            G+V K+G   K+W+ RY+V++G  ++  YY+S  S K +    KGS  + S E       
Sbjct  9    GWVHKQGAVIKTWKRRYMVLNGNVLK--YYDSALSIKMEE---KGSVQILSVE-------  56

Query  80   QMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINN  126
              ++GS++    G  M G   K G + L ++ DSS    +W + I N
Sbjct  57   --MSGSIQN---GRIMHG---KGGRV-LKIYTDSSMQNKEWFEAITN  94

>CCA24531
Length=374

 Score = 32.7 bits (73),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 13/31 (42%), Positives = 22/31 (71%), Gaps = 2/31 (6%)

Query  20  GYVTKRGHFRKSWRVRYLVISGVNMQVSYYE  50
           G++ K+G   +SW+ RY+V+ G   Q+SYY+
Sbjct  27  GWIFKQGSLVRSWKKRYMVLKG--RQLSYYD  55

>SDRG_14286
Length=670

 Score = 32.7 bits (73),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 32/124 (26%), Positives = 54/124 (44%), Gaps = 21/124 (17%)

Query  20   GYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATP--KGSFILQSAEKHEYW  77
            G++ K GH RK+W+ R+ V+ G  +Q  YY    S      TP  KG  +L   +   ++
Sbjct  277  GWLHKLGHRRKNWKHRFFVLDGSVLQ--YYTDDVSKAK---TPKLKGEVLLFHKDTTVHY  331

Query  78   ISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLKASKCMARE  137
              +  TG    + F F     A   G   L +   S  D + W+  I + +     + R+
Sbjct  332  ADEPATG----RAFCF-----AIDAGAYSLLLQAPSELDREAWIYAIEDAI-----LCRD  377

Query  138  AFMA  141
            ++ A
Sbjct  378  SYCA  381

>SPRG_09128
Length=620

 Score = 32.7 bits (73),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 20/30 (67%), Gaps = 2/30 (7%)

Query  20   GYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
            G++ K GH RKSW+ R+ V+ G  +Q  YY
Sbjct  268  GWLHKLGHRRKSWKHRFFVLDGSVLQ--YY  295

>CCI47145
Length=390

 Score = 32.7 bits (73),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 32/53 (60%), Gaps = 3/53 (6%)

Query  20  GYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAE  72
           G++ K+G   +SW+ RY+V+ G   Q+SYY+  D+  S     KGSF + + E
Sbjct  39  GWIFKQGSLVRSWKKRYMVLKG--RQLSYYD-TDNILSLKVKEKGSFQVITVE  88

>SDRG_05567
Length=980

 Score = 32.7 bits (73),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 22/34 (65%), Gaps = 8/34 (24%)

Query  6    NEQHLARYTPTSCEGYVTKRGHFRKSWRVRYLVI  39
            N+ H+A        GY++KRG +RK+W+ RY ++
Sbjct  131  NDIHMA--------GYLSKRGSWRKNWKQRYFIL  156

>SPRG_06021
Length=983

 Score = 32.7 bits (73),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 22/34 (65%), Gaps = 8/34 (24%)

Query  6    NEQHLARYTPTSCEGYVTKRGHFRKSWRVRYLVI  39
            N+ H+A        GY++KRG +RK+W+ RY ++
Sbjct  133  NDIHMA--------GYLSKRGSWRKNWKQRYFIL  158

>CCA25510
Length=1139

 Score = 32.7 bits (73),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 0/30 (0%)

Query  20   GYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
            GY+ K+G F KSWR RY ++      ++YY
Sbjct  197  GYLVKQGSFWKSWRRRYFILRRDVPILAYY  226

>HYAP_04457
Length=1203

 Score = 32.7 bits (73),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 13/31 (42%), Positives = 19/31 (61%), Gaps = 2/31 (6%)

Query  19  EGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
           EGYV K+G +   W  RYL++ G  +  +YY
Sbjct  62  EGYVRKKGDWLPRWEERYLILDGPTL--TYY  90

>SPRG_14955
Length=635

 Score = 32.7 bits (73),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 12/31 (39%), Positives = 21/31 (68%), Gaps = 2/31 (6%)

Query  20  GYVTKRGHFRKSWRVRYLVISGVNMQVSYYE  50
           G + KRGH RK+W  R+ V++  +++  YY+
Sbjct  28  GVLQKRGHLRKNWLTRFFVLTPTHLR--YYK  56

>CCI43456
Length=126

 Score = 31.2 bits (69),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (59%), Gaps = 0/29 (0%)

Query  19  EGYVTKRGHFRKSWRVRYLVISGVNMQVS  47
           EG +TKR  + K WR RY ++ G  +  S
Sbjct  21  EGELTKRSMWMKEWRKRYFILKGNKLYFS  49

>PHYCA_564296
Length=957

 Score = 32.7 bits (73),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 34/132 (26%), Positives = 52/132 (39%), Gaps = 24/132 (18%)

Query  8    QHLARYTPTSC-EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSF  66
            + +  Y PT   EG++ K+G   K W+ R+ V  G  +  SYY S+   K     P    
Sbjct  26   ESMPDYDPTYMKEGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISRKDRKPNAVIPLEGC  83

Query  67   ILQSAEKHEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDV---  123
             +Q     E W S  +       P    M   + ++G +           + QWLDV   
Sbjct  84   TVQDGGLSETWNSPRI---YLTDPATGIMYCLSAEEGIV-----------VTQWLDVLRV  129

Query  124  ----INNGLKAS  131
                +NNG  A+
Sbjct  130  AVARVNNGTAAT  141

>PYU1_G012274
Length=873

 Score = 32.7 bits (73),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 50/131 (38%), Gaps = 21/131 (16%)

Query  9    HLARY---TPTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGS  65
            H  RY      S EGY+ K+    +SW+  Y V+ G  M  +YYE        N    G 
Sbjct  299  HTVRYRNGDGISFEGYLNKKSDLLQSWKALYCVLEGETM--AYYE-SREDFIMNTKLIGR  355

Query  66   FILQSAEKHEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVIN  125
              +QS E                KP GF+++    +  ++       ++ + DQW   I 
Sbjct  356  IHIQSVEDDHM-----------GKPNGFRILTEGHRTNHLS----SRTAFEKDQWKRAIT  400

Query  126  NGLKASKCMAR  136
              +  +   AR
Sbjct  401  AAITKAPEAAR  411

>PHYKE_7856
Length=346

 Score = 32.3 bits (72),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 16/20 (80%), Gaps = 0/20 (0%)

Query  20  GYVTKRGHFRKSWRVRYLVI  39
           G++TK+GH  KSW+ R+ V+
Sbjct  63  GWLTKQGHMWKSWKTRFFVL  82

>PHYSO_558498
Length=967

 Score = 32.7 bits (73),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 34/76 (45%), Gaps = 3/76 (4%)

Query  8   QHLARYTPTSC-EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSF  66
           + +A Y PT   EG++ K+G   K W+ R+ V  G  +  SYY S+   K     P    
Sbjct  26  ESMADYDPTYMKEGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISRKDRKPNAVIPLEGC  83

Query  67  ILQSAEKHEYWISQMV  82
            +Q     E W S  +
Sbjct  84  TVQDGGLSETWNSPRI  99

>PYVX_23349
Length=924

 Score = 32.7 bits (73),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 16/23 (70%), Gaps = 0/23 (0%)

Query  17   SCEGYVTKRGHFRKSWRVRYLVI  39
            S  G++ K GH RK+W+ RY V+
Sbjct  444  SMSGWLRKLGHVRKNWKARYFVL  466

>SDRG_14070
Length=630

 Score = 32.3 bits (72),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 12/31 (39%), Positives = 21/31 (68%), Gaps = 2/31 (6%)

Query  20  GYVTKRGHFRKSWRVRYLVISGVNMQVSYYE  50
           G + KRGH RK+W  R+ V++  +++  YY+
Sbjct  28  GVLQKRGHLRKNWLTRFFVLTPTHLR--YYK  56

>HYAP_11295
Length=689

 Score = 32.3 bits (72),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 56/235 (24%), Positives = 96/235 (41%), Gaps = 49/235 (21%)

Query  15   PTS---CEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSA  71
            PTS    EG + KRGH  K+WR R+  I     ++ YY          +  KGS  L   
Sbjct  339  PTSHIHMEGLLLKRGHVNKNWRNRFFRIE--KGELRYY------TENQSVLKGSVPLNDT  390

Query  72   EKHEYWISQMVTGSVKEKPFG----FKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNG  127
                     +V+  + + P G    F +     K G  E+ +     + M  W++ +   
Sbjct  391  ---------IVSPGMAQCPDGRTYYFVLTS---KDGTFEMHLNARDENSMHLWIEALQEA  438

Query  128  LKASKCMAREAFMAEMDTTK-SVLGFSYIGTTSKQ----QIQVLKSKKCDYIHEALQQIE  182
              A         +  M+ T+ +V G S +   +++    +I VL  +  D   E  ++ E
Sbjct  439  QTA---------LGRMEGTRDTVAGLSLVLKRAEEIPLGKISVLFRRPEDITIEMQKRTE  489

Query  183  ---MAKSAGNAACDEIVSQGEQLGKVEQNLSTIQNDLNHSEKLIKSIRHPLRYFF  234
               +A S  N A    V+ G QL  +E + S +++    + K ++S   PL+  F
Sbjct  490  ALIVASSPDNYA----VAVGCQLISIEGH-SVLRSTYAEARKSLRSSSFPLQLEF  539

>PYIR_14494
Length=819

 Score = 32.3 bits (72),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 10/28 (36%), Positives = 18/28 (64%), Gaps = 0/28 (0%)

Query  18   CEGYVTKRGHFRKSWRVRYLVISGVNMQ  45
            CEG++ KRG    +W+ R+  ++G  +Q
Sbjct  265  CEGWLYKRGQRSTAWKRRFFTLNGFQLQ  292

 Score = 32.0 bits (71),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 29/53 (55%), Gaps = 9/53 (17%)

Query  20   GYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGS-FILQSA  71
            G++ K+G   KSW+ R+ VI   +  ++YYE        N  PKG+ FI Q A
Sbjct  422  GWLKKQGKHMKSWKRRFFVIE--DRTITYYE------QLNEAPKGNGFINQVA  466

>PYIR_15898
Length=1183

 Score = 32.3 bits (72),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 10/21 (48%), Positives = 17/21 (81%), Gaps = 0/21 (0%)

Query  19   EGYVTKRGHFRKSWRVRYLVI  39
            EG++ KRG F +SW++RY ++
Sbjct  197  EGWLGKRGTFSRSWKLRYFLL  217

>H257_01309
Length=895

 Score = 32.3 bits (72),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 25/59 (42%), Gaps = 2/59 (3%)

Query  19   EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEKHEYW  77
            EGY+ K+G   K W+ R+ V  G  +  SY+ +          P  +  +Q     E W
Sbjct  48   EGYLQKQGQLLKGWKKRWFVCDGRTL--SYFHTNLDKTPSAIIPLETATVQDGGTSERW  104

>PYIR_24588
Length=909

 Score = 32.3 bits (72),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 30/130 (23%), Positives = 56/130 (43%), Gaps = 19/130 (15%)

Query  20   GYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEKHEYWIS  79
            G++ K GH RK+W+ RY V+    ++  YY  +       A  KG  +L       +++ 
Sbjct  412  GWLRKLGHVRKNWKSRYFVLEKSVLR--YYADESM-----ARLKGEVLLFHPATRVHYVD  464

Query  80   QMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLKASKCMAREAF  139
              ++G  K+  F      H  K   + L    D  SD + W+  I + L     + R+++
Sbjct  465  IHLSGG-KDCTFAI----HVGKDYALLLQ--ADQLSDRENWMYCIEDAL-----LCRDSY  512

Query  140  MAEMDTTKSV  149
              + D  + +
Sbjct  513  HQDPDQARDL  522

>SDRG_05608
Length=121

 Score = 30.8 bits (68),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 0/23 (0%)

Query  19  EGYVTKRGHFRKSWRVRYLVISG  41
           EG +TKR  + K WR RY V+ G
Sbjct  13  EGELTKRSVWLKEWRARYFVLKG  35

>PITG_00020
Length=927

 Score = 32.3 bits (72),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 51/137 (37%), Gaps = 36/137 (26%)

Query  18   CEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEKHEYW  77
            CEG++ KRG     W+ RY  + G  +Q              + PKG+            
Sbjct  274  CEGWLYKRGQRSTEWQRRYFKLKGFKLQY-------QDGPGESVPKGA------------  314

Query  78   ISQMVTGSVKEKPFGFKMVGHAPKQGYIELD------VFVDSSSDMDQWLDVINNGL-KA  130
                  G+V     G K+        Y++L       V  DS + +D+W+  I + L K 
Sbjct  315  ------GTV----VGLKLGEAGSNSVYVQLSSGRVLCVSADSQASVDKWVQAICSLLDKD  364

Query  131  SKCMAREAFMAEMDTTK  147
             K + +E   A    +K
Sbjct  365  PKTLEKEVHAASAGVSK  381

>SPRG_16312
Length=261

 Score = 32.0 bits (71),  Expect = 5.3, Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 45/114 (39%), Gaps = 22/114 (19%)

Query  15   PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEKH  74
            P    GYV K+G F K+W+ R++V+   +  + YY     S+   A P+G F + S    
Sbjct  38   PPDFSGYVRKQGSFVKNWKRRFMVLH--DDTLFYY----VSERAMAKPRGFFRVTS----  87

Query  75   EYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGL  128
                         + P G    G     G   L   +  S + D W D ++  L
Sbjct  88   --------VAYAPDLPHGLIADG----TGTRRLRFTLADSDECDAWYDTLSERL  129

>PYIR_23372
Length=1415

 Score = 32.3 bits (72),  Expect = 5.4, Method: Compositional matrix adjust.
 Identities = 17/45 (38%), Positives = 23/45 (51%), Gaps = 5/45 (11%)

Query  9    HLARYTP---TSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYE  50
            H  RY      S EGY+ K+    +SW+  Y V+ G  M  +YYE
Sbjct  311  HTVRYRSGDGISFEGYLNKKSDLLQSWKATYCVLEGDTM--AYYE  353

>PYVX_19172
Length=1408

 Score = 32.3 bits (72),  Expect = 5.5, Method: Composition-based stats.
 Identities = 18/76 (24%), Positives = 39/76 (51%), Gaps = 7/76 (9%)

Query  268   RNVDHLAEEIRVPTNDIEKL-------AMALKDLEVQAQLINSEAVKSNEQIARIEGQLS  320
             R  D   E+  + T  IE +          L+D+  +  ++ S+  K + +I ++E +L+
Sbjct  1322  READFCREKQNMETQRIESVRHEQEIYQKELQDVSFRHSMVQSDRAKQDVRIRQLERELA  1381

Query  321   GINDRIQAQTSQVITS  336
             G+ +R+ +Q S+ + S
Sbjct  1382  GVKERMASQESERVAS  1397

>PPTG_18989
Length=1213

 Score = 32.3 bits (72),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 0/30 (0%)

Query  20   GYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
            GY+ K+G F KSWR R+ ++      + YY
Sbjct  188  GYLVKQGSFWKSWRRRFFILRRDRPVLCYY  217

>H257_09823
Length=654

 Score = 32.3 bits (72),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 18/26 (69%), Gaps = 0/26 (0%)

Query  20   GYVTKRGHFRKSWRVRYLVISGVNMQ  45
            G++ K GH RK+W+ R+ V+ G  +Q
Sbjct  265  GWLYKLGHVRKNWKRRFFVLDGSVLQ  290

>SPRG_02502
Length=121

 Score = 30.8 bits (68),  Expect = 5.7, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 0/23 (0%)

Query  19  EGYVTKRGHFRKSWRVRYLVISG  41
           EG +TKR  + K WR RY V+ G
Sbjct  13  EGELTKRSVWLKEWRARYFVLKG  35

>PHYRA_81944
Length=1149

 Score = 32.3 bits (72),  Expect = 5.8, Method: Compositional matrix adjust.
 Identities = 25/97 (26%), Positives = 38/97 (39%), Gaps = 28/97 (29%)

Query  20   GYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskd-----------sskskNATPKGSFIL  68
            GY+ K+G F KSWR R+ ++      + YY S +            + +  ATPK  F  
Sbjct  123  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTSAEELAKLGELVIDENTTVQATPKDGFPF  182

Query  69   ----------------QSAEKHEYWISQMVTGSVKEK  89
                            Q  E  E WIS  + G + ++
Sbjct  183  RFTIDTEGRKLTLFAEQGEESMEAWIS-CINGCITQR  218

>H257_02642
Length=975

 Score = 32.3 bits (72),  Expect = 5.9, Method: Compositional matrix adjust.
 Identities = 14/36 (39%), Positives = 21/36 (58%), Gaps = 2/36 (6%)

Query  15  PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYE  50
           P   EGY+ KRG +   W    +V+ G  ++VSYY+
Sbjct  27  PIQWEGYLRKRGDWLPRWDYYLVVLDG--LRVSYYD  60

>PHYKE_1044
Length=521

 Score = 32.0 bits (71),  Expect = 6.0, Method: Compositional matrix adjust.
 Identities = 22/76 (29%), Positives = 34/76 (45%), Gaps = 3/76 (4%)

Query  8   QHLARYTPTSC-EGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSF  66
           + +A Y P+   EG++ K+G   K W+ R+ V  G  +  SYY S+   K     P    
Sbjct  26  ESMADYDPSFMKEGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISRKDRKPNAVIPLEGC  83

Query  67  ILQSAEKHEYWISQMV  82
            +Q     E W S  +
Sbjct  84  TVQDGGLSETWNSPRI  99

>PHYSO_563553
Length=797

 Score = 32.0 bits (71),  Expect = 6.0, Method: Compositional matrix adjust.
 Identities = 14/27 (52%), Positives = 19/27 (70%), Gaps = 0/27 (0%)

Query  20   GYVTKRGHFRKSWRVRYLVISGVNMQV  46
            G +TKRG F K+W  R+LV+S   +QV
Sbjct  110  GALTKRGQFFKTWIPRHLVLSRGALQV  136

>PHALS_07930
Length=1200

 Score = 32.3 bits (72),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 0/30 (0%)

Query  20   GYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
            GY+ K+G F KSWR R+ ++      + YY
Sbjct  184  GYLVKQGSFWKSWRRRFFILRRDRPVLCYY  213

>PHYCA_539981
Length=712

 Score = 32.0 bits (71),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 55/228 (24%), Positives = 95/228 (42%), Gaps = 35/228 (15%)

Query  15   PTS---CEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSA  71
            PTS    EG + KRGH  K+W+ R+  I     ++ YY    S        KGS  L+  
Sbjct  361  PTSYIHMEGCLLKRGHVNKNWKNRFFRIE--KGELRYYTENQSEL------KGSVPLKDT  412

Query  72   EKHEYWISQMVTGSVKEKPFGFKM-VGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLKA  130
                     +V+  + + P G K       K G  E+ +   + + M  W++ +     A
Sbjct  413  ---------IVSPGMAQCPDGRKFYFVLTSKDGKFEMHLNAHNENSMHLWIEALQEAQTA  463

Query  131  SKCMAREAFMAEMDTTKSVLGFSYIGTTSKQ----QIQVLKSKKCDYIHEALQQIEMAKS  186
               MA      + DT   V G S +   +++    +I VL  K+ + I   +Q+   A  
Sbjct  464  LGRMA-----GKKDT---VAGLSLVVKRAEEIPLGKIGVL-FKRPEDIDIEMQKRTEALI  514

Query  187  AGNAACDEIVSQGEQLGKVEQNLSTIQNDLNHSEKLIKSIRHPLRYFF  234
              ++  +  V+ G QL  VE   S ++     + K++++   PL+  F
Sbjct  515  VASSPRNRGVAVGSQLIAVE-GRSILRETYTEARKILRASSFPLQLEF  561

>PYVX_13084
Length=1267

 Score = 32.0 bits (71),  Expect = 6.3, Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 0/30 (0%)

Query  20   GYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
            GY+ K+G F K+WR RY V+      +SY+
Sbjct  242  GYLVKQGSFWKTWRRRYFVLRRDLPVMSYF  271

>H257_00729
Length=121

 Score = 30.4 bits (67),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 0/23 (0%)

Query  19  EGYVTKRGHFRKSWRVRYLVISG  41
           EG +TKR  + K WR RY V+ G
Sbjct  13  EGELTKRSVWLKEWRTRYFVLKG  35

>CCA22367
Length=885

 Score = 32.0 bits (71),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 0/30 (0%)

Query  16   TSCEGYVTKRGHFRKSWRVRYLVISGVNMQ  45
            T  +G++ KRGH +K+W+ RY  I    +Q
Sbjct  541  TRRDGFLWKRGHLKKNWKKRYFRIEDGQLQ  570

>PHYSO_552247
Length=746

 Score = 32.0 bits (71),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 55/228 (24%), Positives = 92/228 (40%), Gaps = 35/228 (15%)

Query  15   PTS---CEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSA  71
            PTS    EG + KRGH  K+W+ R+  I     ++ YY    S        KGS  L+  
Sbjct  395  PTSYIHMEGCLLKRGHVNKNWKNRFFRIE--KGELRYYTENQSEL------KGSVPLKDT  446

Query  72   EKHEYWISQMVTGSVKEKPFGFK-MVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLKA  130
                     +V+  + + P G K       K G  E+ +   + S M  W++ +     A
Sbjct  447  ---------IVSPGMAQCPDGRKYYFVLTSKDGKFEMHLNALNESSMHLWIEALQEAQTA  497

Query  131  SKCMAREAFMAEMDTTKSVLGFSYIGTTSKQ----QIQVLKSKKCDYIHEALQQIEMAKS  186
               MA            +V G + +   +++    +I VL  +  D I   +Q+   A  
Sbjct  498  LGRMA--------GKKGTVAGLALVVKRAEEIPLGKIGVLFRRPED-IDIEMQKRTEALI  548

Query  187  AGNAACDEIVSQGEQLGKVEQNLSTIQNDLNHSEKLIKSIRHPLRYFF  234
              ++  +  VS G QL  VE   S ++     + K++++   PLR  F
Sbjct  549  VASSPRNRGVSVGSQLISVE-GRSILRETYAEARKILRASSFPLRLEF  595

>H257_12476
Length=661

 Score = 32.0 bits (71),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 52/124 (42%), Gaps = 8/124 (6%)

Query  1    MLPNINEQHLARYTPTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNA  60
            MLP++    + +       G++ K+G F ++W+ R+ V    +  ++YY+        N 
Sbjct  362  MLPDLVPHDVRQKECYIKRGWLFKQGGFVQNWKRRWCVAK--DGTLTYYK-----SDTNC  414

Query  61   TPKGSFILQSAEKHEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQW  120
               GS  LQ A  +  W     T  V      FK+   +  Q         D+ SD+ +W
Sbjct  415  HANGSVALQGATVNR-WQCHKFTAKVGHPCHFFKVEPPSSAQKRRVYYFGADTESDLVEW  473

Query  121  LDVI  124
            + V+
Sbjct  474  MRVV  477

>PHYSO_529931
Length=2211

 Score = 32.0 bits (71),  Expect = 6.7, Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 58/136 (43%), Gaps = 28/136 (21%)

Query  19    EGYVTKRGHFRKSWRVRYLVISGVNMQ--VSYYEskdsskskNATPKGSFILQSAEKHEY  76
             EGY+ KRGH   S R RY V+ G  +   V++ +SK+        P G+F ++       
Sbjct  989   EGYLMKRGHKIPSMRKRYCVLVGNELSYFVTHDDSKNPGGGATTNPLGNFRVE-------  1041

Query  77    WISQMVTGSVKEKPFGFKMVGHAPKQGYIELDV------FVDSSS--DMDQWLDVINNGL  128
                  V G      +  K   H  + G +EL+       F  +SS  +  QW+D    G+
Sbjct  1042  -----VVGD-----WHGKTAAHTYEHG-MELETTDGKTFFCAASSAKEKQQWVDAFRRGI  1090

Query  129   KASKCMAREAFMAEMD  144
               ++   R A + + D
Sbjct  1091  ALARNELRRAELEDED  1106

>H310_01094
Length=121

 Score = 30.4 bits (67),  Expect = 6.8, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 0/23 (0%)

Query  19  EGYVTKRGHFRKSWRVRYLVISG  41
           EG +TKR  + K WR RY V+ G
Sbjct  13  EGELTKRSVWLKEWRARYFVLKG  35

>PYAR_19291
Length=711

 Score = 32.0 bits (71),  Expect = 6.9, Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 16/20 (80%), Gaps = 0/20 (0%)

Query  20   GYVTKRGHFRKSWRVRYLVI  39
            G++ K GH RK+W++RY V+
Sbjct  212  GWLRKLGHVRKNWKMRYFVL  231

>PYAP_24144
Length=1022

 Score = 32.0 bits (71),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 41/166 (25%), Positives = 67/166 (40%), Gaps = 22/166 (13%)

Query  4    NINEQHLARYTP---TSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNA  60
            N    H  RY      + EGY+ K+      WR  Y V+ G  +  +YYE        NA
Sbjct  296  NRGRSHTVRYRTEKGIAFEGYLHKKSDLLAQWRAIYCVLEGDTL--AYYE-SREDFILNA  352

Query  61   TPKGSFILQSAEKHEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQW  120
               G   +Q  +          TG    KP GF+++     +G+    +   ++ + DQW
Sbjct  353  RLIGRIQVQGVDDDNL---PAATG----KPHGFRVL----TEGHRIHHLGSRTAFEKDQW  401

Query  121  LDVINNGL-KASKCMARE--AFMAEMDTTKSVLGFSYIGTTSKQQI  163
               I + + KA+   AR   AF ++    K    +  +G   KQ++
Sbjct  402  KRAIKSAIAKATNSSARPQIAFASQALDPKKF--YRLLGALLKQEV  445

>HYAP_13757
Length=262

 Score = 31.6 bits (70),  Expect = 7.2, Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 22/31 (71%), Gaps = 2/31 (6%)

Query  20  GYVTKRGHFRKSWRVRYLVISGVNMQVSYYE  50
           G++ KRGH  K+W+ R+ +++G  +  +YY+
Sbjct  15  GWLWKRGHTFKTWKKRFFLLNGAAL--TYYK  43

>PYAR_16120
Length=1057

 Score = 32.0 bits (71),  Expect = 7.2, Method: Compositional matrix adjust.
 Identities = 24/113 (21%), Positives = 47/113 (42%), Gaps = 19/113 (17%)

Query  15   PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEKH  74
            P    G++ K+    +SW+ RY  + G    V YY      +  +  P+G  +L   +  
Sbjct  20   PPRKTGHLYKKSGLARSWKTRYFSLEG---SVLYY----YKREGDTAPRGMVVLTGCD--  70

Query  75   EYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNG  127
                   +  +  +K + F++    PK   +  D+     S MD W++ + +G
Sbjct  71   -------IKTTRNKKYYSFRIT--HPKTSKV-YDLAATLQSRMDDWIEALQDG  113

>PYAP_23478
Length=897

 Score = 32.0 bits (71),  Expect = 7.3, Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 16/20 (80%), Gaps = 0/20 (0%)

Query  20   GYVTKRGHFRKSWRVRYLVI  39
            G++ K GH RK+W++RY V+
Sbjct  380  GWLRKLGHVRKNWKLRYFVL  399

>PHYRA_94409
Length=1270

 Score = 32.0 bits (71),  Expect = 7.5, Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 16/20 (80%), Gaps = 0/20 (0%)

Query  20   GYVTKRGHFRKSWRVRYLVI  39
            G++TK+GH  KSW+ R+ V+
Sbjct  113  GWLTKQGHMWKSWKTRFFVL  132

>H310_00912
Length=2182

 Score = 32.0 bits (71),  Expect = 7.5, Method: Compositional matrix adjust.
 Identities = 27/123 (22%), Positives = 50/123 (41%), Gaps = 16/123 (13%)

Query  19    EGYV-TKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEKHEYW  77
             EG+V  +R HF  +W+  Y V+ G  +         ++     T K   +         W
Sbjct  1797  EGFVHLRRSHFGAAWKEHYCVLKGPWLATYDTREDFATAPGKPTSKREVVFVGD-----W  1851

Query  78    ISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNG---LKASKCM  134
                +  G  K   F  + +    + G++E   +VD ++D  QW+  +      LKA + +
Sbjct  1852  YGGVSAGGAKNM-FRIETI----EDGFVE--AYVDDAADKPQWMQTLQTAVSSLKADQLV  1904

Query  135   ARE  137
              R+
Sbjct  1905  TRD  1907

>PYIR_13555
Length=355

 Score = 31.6 bits (70),  Expect = 7.6, Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 31/53 (58%), Gaps = 4/53 (8%)

Query  20  GYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAE  72
           G+V K+G   ++W+ RY+V+ G   Q++YY++   +       KGSF + + E
Sbjct  10  GWVFKQGSLVRNWKKRYMVLRG--KQLTYYDTASLTAKTK--EKGSFQVITVE  58

>H310_03025
Length=645

 Score = 31.6 bits (70),  Expect = 7.6, Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 54/126 (43%), Gaps = 18/126 (14%)

Query  6    NEQHLARYTPTSCEGYVTKRGHFRKSWRVRYLVISGVNMQ--VSYYEskdsskskNATPK  63
            ++ H A+  P +  G + KRGH R +W  RY  +  ++    + YY          ATPK
Sbjct  322  DDPHDAKTMPMA--GVLLKRGHVRTNWVQRYFKLEKLDHHPVLRYYS----DGDGRATPK  375

Query  64   GSFILQSAEKHEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDV  123
            G+  L +A      +S  V      +   F ++      G ++L +   +  DM +W+  
Sbjct  376  GAISLVNAS-----VSAGVPFCCDGRRNYFVVL-----SGSLDLHLNALTERDMRRWIHA  425

Query  124  INNGLK  129
            +   ++
Sbjct  426  LRKAIE  431

>PYAP_16734
Length=1314

 Score = 32.0 bits (71),  Expect = 7.6, Method: Compositional matrix adjust.
 Identities = 19/68 (28%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query  20   GYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFIL---QSAEKHEY  76
            G +TK+G +R++W+ R+ ++   +  + YY+S++  +   A    S  L   +SA  H  
Sbjct  181  GTLTKQGSWRRNWKTRFFLLRRDHPSLCYYKSEEKLELLGAIAVSSDTLVLDKSAGGHAP  240

Query  77   WISQMVTG  84
            +  Q+ TG
Sbjct  241  YRFQLRTG  248

>PHYRA_73430
Length=395

 Score = 31.6 bits (70),  Expect = 7.7, Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 32/53 (60%), Gaps = 4/53 (8%)

Query  20  GYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAE  72
           G+V K+G   ++W+ R++V+ G   Q++YY++     +  A  KGSF + + E
Sbjct  12  GWVFKQGSLVRNWKKRFMVLRG--RQLTYYDTAKVDPTVKA--KGSFQVITVE  60

>PITG_03318
Length=1343

 Score = 32.0 bits (71),  Expect = 7.8, Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 16/20 (80%), Gaps = 0/20 (0%)

Query  20   GYVTKRGHFRKSWRVRYLVI  39
            G++TK+GH  KSW+ R+ V+
Sbjct  139  GWLTKQGHMWKSWKTRFFVL  158

>PYU1_G000724
Length=189

 Score = 30.8 bits (68),  Expect = 7.8, Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 16/20 (80%), Gaps = 0/20 (0%)

Query  20   GYVTKRGHFRKSWRVRYLVI  39
            G++TK+GH  KSW+ R+ V+
Sbjct  111  GWLTKQGHMWKSWKTRFFVL  130

>SPRG_00889
Length=994

 Score = 31.6 bits (70),  Expect = 8.0, Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 10/48 (21%)

Query  2    LPNINEQHLARYTPTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
            L N+ E H         EG+V K+G +   W  RYLV+ G  +  +YY
Sbjct  114  LGNVQEVHW--------EGHVRKKGDWLPRWEPRYLVLDGTTL--TYY  151

>PPTG_16044
Length=1378

 Score = 32.0 bits (71),  Expect = 8.0, Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 16/20 (80%), Gaps = 0/20 (0%)

Query  20   GYVTKRGHFRKSWRVRYLVI  39
            G++TK+GH  KSW+ R+ V+
Sbjct  139  GWLTKQGHMWKSWKTRFFVL  158

>PHYSO_248481
Length=1283

 Score = 32.0 bits (71),  Expect = 8.0, Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 16/20 (80%), Gaps = 0/20 (0%)

Query  20   GYVTKRGHFRKSWRVRYLVI  39
            G++TK+GH  KSW+ R+ V+
Sbjct  92   GWLTKQGHMWKSWKTRFFVL  111

>PYU1_G012870
Length=352

 Score = 31.6 bits (70),  Expect = 8.1, Method: Compositional matrix adjust.
 Identities = 18/53 (34%), Positives = 32/53 (60%), Gaps = 4/53 (8%)

Query  20  GYVTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAE  72
           G+V K+G   ++W+ R++V+ G   Q++YY++   S       KGSF + +AE
Sbjct  7   GWVFKQGSLVRNWKKRFMVLRG--KQLTYYDTASISPKTK--EKGSFQVITAE  55

>PHYKE_6662
Length=765

 Score = 31.6 bits (70),  Expect = 8.1, Method: Compositional matrix adjust.
 Identities = 12/31 (39%), Positives = 19/31 (61%), Gaps = 2/31 (6%)

Query  19  EGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
           EG+V K+G +   W  RYL++ G  +  +YY
Sbjct  72  EGFVRKKGDWLPRWEERYLILDGATL--TYY  100

>H310_14473
Length=613

 Score = 31.6 bits (70),  Expect = 8.5, Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 2/30 (7%)

Query  20  GYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
           G + KRGH RK+W  R+ V++   ++  YY
Sbjct  27  GILLKRGHLRKNWLTRFFVLTSGALR--YY  54

>CCI43793
Length=1117

 Score = 31.6 bits (70),  Expect = 8.5, Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 0/30 (0%)

Query  20   GYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
            GY+ K+G F KSWR R+ ++      ++YY
Sbjct  175  GYLVKQGSFWKSWRRRFFILRRDIPVLAYY  204

>PHYKE_5588
Length=751

 Score = 31.6 bits (70),  Expect = 8.6, Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 16/28 (57%), Gaps = 0/28 (0%)

Query  18   CEGYVTKRGHFRKSWRVRYLVISGVNMQ  45
            CEG++ KRG     W+ RY  + G  +Q
Sbjct  252  CEGWLYKRGQRSTEWQRRYFKLKGFTLQ  279

>PYAR_13491
Length=1080

 Score = 31.6 bits (70),  Expect = 8.7, Method: Compositional matrix adjust.
 Identities = 29/123 (24%), Positives = 51/123 (41%), Gaps = 34/123 (28%)

Query  22   VTKRGHFRKSWRVRYLVISGVNMQVSYYEskdsskskNATPKGSFILQSAEKHEYWISQM  81
            +TK+G +R++W+ R+ ++      +SYY                   +S EK E   S  
Sbjct  2    LTKQGSWRRNWKTRFFILRSDYPSLSYY-------------------KSEEKLELLGSVP  42

Query  82   VTGS--VKEKPFGFKMVGHAPKQGYIELDVF-------VDSSSDMDQWLDVIN---NGLK  129
            +TG   V +K  G    GHAP +  +  D          ++  +  +W+D      + L+
Sbjct  43   ITGDSLVLDKSAGG---GHAPFRFQLRTDAVGAALLLETETRDNQQRWMDACQELVDTLR  99

Query  130  ASK  132
            A K
Sbjct  100  AEK  102

>SDRG_01408
Length=916

 Score = 31.6 bits (70),  Expect = 8.8, Method: Compositional matrix adjust.
 Identities = 13/31 (42%), Positives = 19/31 (61%), Gaps = 2/31 (6%)

Query  19   EGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
            EG+V K+G +   W  RYLV+ G  +  +YY
Sbjct  125  EGHVRKKGDWLPRWEPRYLVLDGTTL--TYY  153

>PPTG_16659
Length=916

 Score = 31.6 bits (70),  Expect = 9.1, Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 16/28 (57%), Gaps = 0/28 (0%)

Query  18   CEGYVTKRGHFRKSWRVRYLVISGVNMQ  45
            CEG++ KRG     W+ RY  + G  +Q
Sbjct  274  CEGWLYKRGQRSTEWQRRYFKLKGFKLQ  301

>CCA25092
Length=357

 Score = 31.2 bits (69),  Expect = 9.3, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 48/111 (43%), Gaps = 26/111 (23%)

Query  147  KSVLGFSYIGTTSKQQIQVLKSKKCDYIHEALQQIEMAKSAGNAACDEIVSQGEQLGKVE  206
            KSV+ +  + T + +++     K C+   E    IE  +      C+ +V   + L K  
Sbjct  143  KSVVRYLPVETCTNEKL-----KHCNNCKEF---IEFRRPQSGRECNSVVGYNQGLSKHP  194

Query  207  QNLS---------------TIQNDLNHSEKLIKSIRHPLR---YFFSRSRP  239
             NL+               T+ ++L H  K++  ++HPLR   +F  + +P
Sbjct  195  INLADRCFDEGLPMREAYGTVLHELGHCLKMLHELQHPLRNVLFFLDKIKP  245

>H310_02933
Length=1053

 Score = 31.6 bits (70),  Expect = 9.4, Method: Compositional matrix adjust.
 Identities = 9/21 (43%), Positives = 18/21 (86%), Gaps = 0/21 (0%)

Query  19   EGYVTKRGHFRKSWRVRYLVI  39
            +GY++K+G +RK+W+ RY ++
Sbjct  179  QGYLSKQGSWRKNWKRRYFIL  199

>PYAR_21162
Length=1135

 Score = 31.6 bits (70),  Expect = 9.4, Method: Compositional matrix adjust.
 Identities = 9/21 (43%), Positives = 17/21 (81%), Gaps = 0/21 (0%)

Query  19   EGYVTKRGHFRKSWRVRYLVI  39
            EG++ +RG F +SW++RY ++
Sbjct  221  EGWLGQRGTFSRSWKLRYFIL  241

>PHALS_06636
Length=2386

 Score = 31.6 bits (70),  Expect = 9.5, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 20/31 (65%), Gaps = 2/31 (6%)

Query  19    EGYVTKRGHFRKSWRVRYLVISGVNMQVSYY  49
             EGY+ KRGH   S R RY V+  V  ++SYY
Sbjct  1097  EGYLMKRGHKIPSMRKRYCVL--VRNELSYY  1125

>PITG_11578
Length=2131

 Score = 31.6 bits (70),  Expect = 9.5, Method: Compositional matrix adjust.
 Identities = 32/124 (26%), Positives = 53/124 (43%), Gaps = 18/124 (15%)

Query  19    EGYVTKRGHFRKSWRVRYLVISG--VNMQVSYYEskdsskskNATPKGSFILQSAEKHEY  76
             EGY+ KRGH   S R RY V+ G  +   V++ +SK+        P G+F ++       
Sbjct  952   EGYLMKRGHKIPSMRKRYCVLIGNELTYYVTHDDSKNPGGGATTNPLGNFRVEIVGD---  1008

Query  77    WISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSS---DMDQWLDVINNGLKASKC  133
             W  +  T + +          HA +    +   F  ++S   +  QW+D    G+  S+ 
Sbjct  1009  WHGKTATHTYE----------HAMELETTDGKTFFCAASTAKEKQQWVDAFRRGIALSRI  1058

Query  134   MARE  137
               RE
Sbjct  1059  EQRE  1062

>PYU1_G007423
Length=928

 Score = 31.6 bits (70),  Expect = 10.0, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 16/23 (70%), Gaps = 0/23 (0%)

Query  17   SCEGYVTKRGHFRKSWRVRYLVI  39
            S  G++ K GH RK+W+ RY V+
Sbjct  433  SMRGWLRKLGHVRKNWKSRYFVL  455

Lambda      K        H        a         alpha
   0.315    0.130    0.367    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 22360291095

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40