Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
CCA18898147571147114759510.0
CCI45122147571105112337730.0
PYIR_13453147571186116818020.0
PYIW_187931475799790117160.0
PYU1_G0017341475780078516510.0
PYAP_17746147571169116215570.0
PHYRA_95901147571075115815130.0
PPTG_17128147571177117714730.0
PHALS_06477147571166118114690.0
PITG_18457147571170116914630.0
PHYSO_32115714757118079414485e-180
SDRG_01764147571092113014321e-178
SPRG_063541475788487413672e-171
H257_06305147571099113513815e-171
H310_09212147571113114613712e-169
PHYCA_344751475769273512901e-162
PHYKE_8394147574282194982e-53
PYAR_13581147577303134932e-50
PHYSO_3267997190111171571020.008
CCA165302856151244821.7
H257_02115123605999151812.2
PITG_071166006460146793.3
PHYRA_8590972689389125783.9
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= CCA18898

Length=1147
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

CCA18898                                                              2296       0.0   
CCI45122                                                              1457       0.0   
PYIR_13453                                                            698        0.0   
PYIW_18793                                                            665        0.0   
PYU1_G001734                                                          640        0.0   
PYAP_17746                                                            604        0.0   
PHYRA_95901                                                           587        0.0   
PPTG_17128                                                            572        0.0   
PHALS_06477                                                           570        0.0   
PITG_18457                                                            568        0.0   
PHYSO_321157                                                          562        5e-180
SDRG_01764                                                            556        1e-178
SPRG_06354                                                            531        2e-171
H257_06305                                                            536        5e-171
H310_09212                                                            532        2e-169
PHYCA_34475                                                           501        1e-162
PHYKE_8394                                                            196        2e-53 
PYAR_13581                                                            194        2e-50 
PHYSO_326799                                                          43.9       0.008 
CCA16530                                                              36.2       1.7   
H257_02115                                                            35.8       2.2   
PITG_07116                                                            35.0       3.3   
PHYRA_85909                                                           34.7       3.9   

>CCA18898
Length=1147

 Score = 2296 bits (5951),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1147/1147 (100%), Positives = 1147/1147 (100%), Gaps = 0/1147 (0%)

Query  1     MLRHLVSYKSNYSCYKGSCLELQDGMEQVEQKYHKEDVGRILLQTQQELRDIRAEISARK  60
             MLRHLVSYKSNYSCYKGSCLELQDGMEQVEQKYHKEDVGRILLQTQQELRDIRAEISARK
Sbjct  1     MLRHLVSYKSNYSCYKGSCLELQDGMEQVEQKYHKEDVGRILLQTQQELRDIRAEISARK  60

Query  61    QAGISHVVDAHPHREDHASLANENQSKDLETLHDILDRAEREIQAKVDLMFRGAANFGQM  120
             QAGISHVVDAHPHREDHASLANENQSKDLETLHDILDRAEREIQAKVDLMFRGAANFGQM
Sbjct  61    QAGISHVVDAHPHREDHASLANENQSKDLETLHDILDRAEREIQAKVDLMFRGAANFGQM  120

Query  121   MQTGLPAVTSPPRQVSTTTKSLSDQIFSTQESKVDGTRKQLTAAKDDYKCSPSMQQSELI  180
             MQTGLPAVTSPPRQVSTTTKSLSDQIFSTQESKVDGTRKQLTAAKDDYKCSPSMQQSELI
Sbjct  121   MQTGLPAVTSPPRQVSTTTKSLSDQIFSTQESKVDGTRKQLTAAKDDYKCSPSMQQSELI  180

Query  181   SPKRPTQGLLTSKASKKRYNVSLKSLPAVQNGHastsssaladqssETAHFLNSRHGSPL  240
             SPKRPTQGLLTSKASKKRYNVSLKSLPAVQNGHASTSSSALADQSSETAHFLNSRHGSPL
Sbjct  181   SPKRPTQGLLTSKASKKRYNVSLKSLPAVQNGHASTSSSALADQSSETAHFLNSRHGSPL  240

Query  241   NSIEISQSTYDRALMQRTAQLHNRLEEPIRTTPCTSTISHDITSLKFDFSAPTILQSPGK  300
             NSIEISQSTYDRALMQRTAQLHNRLEEPIRTTPCTSTISHDITSLKFDFSAPTILQSPGK
Sbjct  241   NSIEISQSTYDRALMQRTAQLHNRLEEPIRTTPCTSTISHDITSLKFDFSAPTILQSPGK  300

Query  301   VQIHEQVTHFNDQALGECNCRLSTNQVSMALINGFREDNSKLSPSRDHSKKMGIPKVIKS  360
             VQIHEQVTHFNDQALGECNCRLSTNQVSMALINGFREDNSKLSPSRDHSKKMGIPKVIKS
Sbjct  301   VQIHEQVTHFNDQALGECNCRLSTNQVSMALINGFREDNSKLSPSRDHSKKMGIPKVIKS  360

Query  361   TKINTDTESHKGNNSSNHDFTIHQGIVDRRRSDFKSFQCFANDVWNNVEEVVTTLERLLS  420
             TKINTDTESHKGNNSSNHDFTIHQGIVDRRRSDFKSFQCFANDVWNNVEEVVTTLERLLS
Sbjct  361   TKINTDTESHKGNNSSNHDFTIHQGIVDRRRSDFKSFQCFANDVWNNVEEVVTTLERLLS  420

Query  421   VYFIPIAHINGQRILTLSQENNKIITNRDLLSCVKNEHEVRMLLLKPGQRFQGVEKCTRA  480
             VYFIPIAHINGQRILTLSQENNKIITNRDLLSCVKNEHEVRMLLLKPGQRFQGVEKCTRA
Sbjct  421   VYFIPIAHINGQRILTLSQENNKIITNRDLLSCVKNEHEVRMLLLKPGQRFQGVEKCTRA  480

Query  481   AMAVQSFMRMITFRRTYLLMISNHRKVRAIQQNWRRYAAYKATKIKIEAIRERQDIVFNE  540
             AMAVQSFMRMITFRRTYLLMISNHRKVRAIQQNWRRYAAYKATKIKIEAIRERQDIVFNE
Sbjct  481   AMAVQSFMRMITFRRTYLLMISNHRKVRAIQQNWRRYAAYKATKIKIEAIRERQDIVFNE  540

Query  541   IMRSFCSNWDKIRTQRRTVMHIPSISIDPRHRMKTEQFSIQQNLQLQRLCALIDENVELI  600
             IMRSFCSNWDKIRTQRRTVMHIPSISIDPRHRMKTEQFSIQQNLQLQRLCALIDENVELI
Sbjct  541   IMRSFCSNWDKIRTQRRTVMHIPSISIDPRHRMKTEQFSIQQNLQLQRLCALIDENVELI  600

Query  601   YICPFELTDDIVQYYMKLLQLAGISDAAARIKLMCPENASRFPSHFSLSNVVLCSPHTMK  660
             YICPFELTDDIVQYYMKLLQLAGISDAAARIKLMCPENASRFPSHFSLSNVVLCSPHTMK
Sbjct  601   YICPFELTDDIVQYYMKLLQLAGISDAAARIKLMCPENASRFPSHFSLSNVVLCSPHTMK  660

Query  661   RLSRYIRGRNAYLVPGFPGTEDKRLAALLRIPILGLDPAKFFQMTTHSGIKRCFKKTNAN  720
             RLSRYIRGRNAYLVPGFPGTEDKRLAALLRIPILGLDPAKFFQMTTHSGIKRCFKKTNAN
Sbjct  661   RLSRYIRGRNAYLVPGFPGTEDKRLAALLRIPILGLDPAKFFQMTTHSGIKRCFKKTNAN  720

Query  721   TLPGSIDLYDENELIFSLAKLIAANPHQSSMVLKLDYDPFRTGTALVDISQLQSIQVLRL  780
             TLPGSIDLYDENELIFSLAKLIAANPHQSSMVLKLDYDPFRTGTALVDISQLQSIQVLRL
Sbjct  721   TLPGSIDLYDENELIFSLAKLIAANPHQSSMVLKLDYDPFRTGTALVDISQLQSIQVLRL  780

Query  781   RTRTLDYWRQPPIQNKLIRNIVQEMQSIISSLVFMVNPEVYPSWKSFLQAIRMYGVVIEV  840
             RTRTLDYWRQPPIQNKLIRNIVQEMQSIISSLVFMVNPEVYPSWKSFLQAIRMYGVVIEV
Sbjct  781   RTRTLDYWRQPPIQNKLIRNIVQEMQSIISSLVFMVNPEVYPSWKSFLQAIRMYGVVIEV  840

Query  841   CPKNRQGYVRANLFIEPSRRVCISSTQEFLSFENIHENDDRARKVVFDKAFAAKMRTIGF  900
             CPKNRQGYVRANLFIEPSRRVCISSTQEFLSFENIHENDDRARKVVFDKAFAAKMRTIGF
Sbjct  841   CPKNRQGYVRANLFIEPSRRVCISSTQEFLSFENIHENDDRARKVVFDKAFAAKMRTIGF  900

Query  901   TFPQTLIDHEVLKSASLVIGQALAKDGICGYISVDFLVILDDQTQNKILYAMALQPFLTN  960
             TFPQTLIDHEVLKSASLVIGQALAKDGICGYISVDFLVILDDQTQNKILYAMALQPFLTN
Sbjct  901   TFPQTLIDHEVLKSASLVIGQALAKDGICGYISVDFLVILDDQTQNKILYAMALQPFLTN  960

Query  961   saasfslfqflsRGGGYNSKTGLFHLPRAITshgvtsdtpsssslsatDLMIREARLSGI  1020
             SAASFSLFQFLSRGGGYNSKTGLFHLPRAITSHGVTSDTPSSSSLSATDLMIREARLSGI
Sbjct  961   SAASFSLFQFLSRGGGYNSKTGLFHLPRAITSHGVTSDTPSSSSLSATDLMIREARLSGI  1020

Query  1021  VSNELPLTPTRSYVLLEYVCNPNVATLSYGSFFQNCRSRGVYFDIERDIGTVFLLADSLT  1080
             VSNELPLTPTRSYVLLEYVCNPNVATLSYGSFFQNCRSRGVYFDIERDIGTVFLLADSLT
Sbjct  1021  VSNELPLTPTRSYVLLEYVCNPNVATLSYGSFFQNCRSRGVYFDIERDIGTVFLLADSLT  1080

Query  1081  AGVLGIMCISDTRKNALLSCRAAMEAIAASAGTKSSISKSNHSMNDLMRADSTRDRFSEI  1140
             AGVLGIMCISDTRKNALLSCRAAMEAIAASAGTKSSISKSNHSMNDLMRADSTRDRFSEI
Sbjct  1081  AGVLGIMCISDTRKNALLSCRAAMEAIAASAGTKSSISKSNHSMNDLMRADSTRDRFSEI  1140

Query  1141  LRALHLM  1147
             LRALHLM
Sbjct  1141  LRALHLM  1147

>CCI45122
Length=1105

 Score = 1457 bits (3773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 746/1123 (66%), Positives = 883/1123 (79%), Gaps = 19/1123 (2%)

Query  26    MEQVEQKYHKEDVGRILLQTQQELRDIRAEISARKQAGISHVVDAHPHREDHASLANENQ  85
             M+ +EQK+H ED+GRILLQTQQELR+IRAEIS RKQ   +++ DA P  +  A + + N 
Sbjct  1     MDHLEQKHHTEDIGRILLQTQQELREIRAEISGRKQTTETYIADATPFEDYPAPIVSVNP  60

Query  86    SKDLETLHDILDRAEREIQAKVDLMFRGAANFGQMMQTGLPAVTSPPRQVSTTTKSLSDQ  145
             SKDLETL +ILDRAEREIQAKVDL+++G A++G+  QTGLP V SPPRQ+ ++  S  ++
Sbjct  61    SKDLETLQNILDRAEREIQAKVDLLYKGVAHYGRKTQTGLPFVASPPRQIPSSANSSLER  120

Query  146   IFSTQESKVDGTRKQLTAAKDDYKCSPSMQQSELISPKRPTQGLLTSKASKKRYNVSLKS  205
               S QE  VD  RKQL + K+ YKC P+ Q SELISPKRPTQGLLTSK SKKRYN SL+S
Sbjct  121   KSSFQELSVDLIRKQLHSVKEKYKCLPTKQHSELISPKRPTQGLLTSKPSKKRYNASLRS  180

Query  206   LPAVQNGHastsssaladqssETAHFLNSRHGSPLNSIEISQSTYDRALMQRTAQLHNRL  265
             LP VQ G A   SSA  DQ  E ++ L               S  DR LMQRTA LHNR+
Sbjct  181   LPTVQRGEAGDFSSASRDQIGEASNTL---------------SVNDRVLMQRTAHLHNRM  225

Query  266   EEPIRTTPCTSTISHDITSLKFDFSAPTILQSP-GKVQIHEQVTHFNDQALGECNCRLST  324
             EEPI+TTP T+ ISH++ S+KFDF  PT  QSP GK+Q  E++   ND    + N  L  
Sbjct  226   EEPIKTTPYTTAISHNMMSVKFDFMTPTS-QSPCGKMQTQEKIVLTNDLQSKQRNGALLA  284

Query  325   NQVSMALINGFREDNSKLSPSRDHSKKMGIPKVIKSTKINTDTESHKGNNSSNHDFTIHQ  384
             NQ+S++   G RED+S+ SP RD SKK+GI K I    +N  T+S  G  S  +DF IHQ
Sbjct  285   NQISLSPGGGCREDDSRFSPGRDPSKKIGIIKAITPIFLNDVTKSLVGEISKTYDFVIHQ  344

Query  385   GIVDRRRSDFKSFQCFANDVWNNVEEVVTTLERLLSVYFIPIAHINGQRILTLSQENNKI  444
             GI+DR+R +F++FQ  AN +W++V+ V+  L R+LS+YFIPIA+INGQRILTL+Q +N  
Sbjct  345   GIIDRKRPEFEAFQRIANPIWSSVDVVLEALARILSLYFIPIAYINGQRILTLAQADNVP  404

Query  445   ITNRDLLSCVKNEHEVRMLLLKPGQRFQGVEKCTRAAMAVQSFMRMITFRRTYLLMISNH  504
             +T +DL+SC++NE EV+MLL KPGQRFQG E+  RA +A+QSF+RM   R+ +L+M   +
Sbjct  405   LTTKDLISCIRNEDEVKMLLSKPGQRFQGAERTKRATIALQSFIRMAMHRKRFLVMRYKY  464

Query  505   RKVRAIQQNWRRYAAYKATKIKIEAIRERQDIVFNEIMRSFCSNWDKIRTQRRTVMHIPS  564
              KV AIQ+NWRR++A+KATK+KIEA RE Q++VF + MRSFCSNWDKIR QRRT++HIPS
Sbjct  465   WKVTAIQRNWRRFSAHKATKLKIEAKREHQEMVFTDSMRSFCSNWDKIRMQRRTIIHIPS  524

Query  565   ISIDPRHRMKTEQFSIQQNLQLQRLCALIDENVELIYICPFELTDDIVQYYMKLLQLAGI  624
             ISID R RMKTEQFSIQQNLQLQRLCA+IDENVELIYICPFELTDDIVQYYMKLLQL GI
Sbjct  525   ISIDSRQRMKTEQFSIQQNLQLQRLCAVIDENVELIYICPFELTDDIVQYYMKLLQLGGI  584

Query  625   SDAAARIKLMCPENASRFPSHFSLSNVVLCSPHTMKRLSRYIRGRNAYLVPGFPGTEDKR  684
             SDAAARIKL+CPENASRFPSHFSLS+VVL SP T+ RLSR IRGRNAY+VPGFPG EDKR
Sbjct  585   SDAAARIKLICPENASRFPSHFSLSSVVLYSPRTLNRLSRCIRGRNAYMVPGFPGLEDKR  644

Query  685   LAALLRIPILGLDPAKFFQMTTHSGIKRCFKKTNANTLPGSIDLYDENELIFSLAKLIAA  744
             +A +L +PILGLD  K  Q TT+SG KR F+K N NTLP  IDLYDENELIFSLAKL+A+
Sbjct  645   VATILGVPILGLDSTKSLQATTYSGSKRYFRKANVNTLPACIDLYDENELIFSLAKLVAS  704

Query  745   NPHQSSMVLKLDYDPFRTGTALVDISQLQSIQVLRLRTRTLDYWRQPPIQNKLIRNIVQE  804
             +PHQ S+VL+LDYDPF TG AL+DIS+LQS++ +RLRT+TL+ W QPPIQ KLIRN+V E
Sbjct  705   HPHQLSVVLRLDYDPFGTGIALMDISRLQSVKEVRLRTKTLESWLQPPIQAKLIRNLVLE  764

Query  805   MQSIISSLVFMVNPEVYPSWKSFLQAIRMYGVVIEVCPKNRQGYVRANLFIEPSRRVCIS  864
             MQ+ ISS +F+V+PE++PS KSFLQAIR+YGV+IE+ PK RQG+VRANLFIEPSRRVC+S
Sbjct  765   MQNNISSFIFVVHPEIFPSSKSFLQAIRIYGVIIELSPKKRQGHVRANLFIEPSRRVCVS  824

Query  865   STQEFLSFENIHENDDRARKVVFDKAFAAKMRTIGFTFPQTLIDHEVLKSASLVIGQALA  924
             ST E  S E   + DDR RK   DKA AAKMRT G TFPQTLIDHEVLK ASL IGQALA
Sbjct  825   STHEIHSLETDTKIDDRVRKFGLDKASAAKMRTFGVTFPQTLIDHEVLKDASLAIGQALA  884

Query  925   KDGICGYISVDFLVILDDQTQNKILYAMALQPFLTNsaasfslfqflsRGGGYNSKTGLF  984
             KDGICGYISVDF+V LDDQTQ K LYA  LQPFLTN+AASF+LFQ LSRGG YNS TG  
Sbjct  885   KDGICGYISVDFVVCLDDQTQKKTLYATGLQPFLTNTAASFALFQLLSRGGSYNSMTGSL  944

Query  985   HLPRAITshgvtsdtpsssslsatDLMIREARLSGIVSNELPLTPTRSYVLLEYVCNPNV  1044
             HLP+ +    V       SSLSATDLMIREARLSGIVSN LP TPTR+Y L+EYVCNP V
Sbjct  945   HLPQEVP--LVGVQNDPPSSLSATDLMIREARLSGIVSNVLPPTPTRTYALIEYVCNPCV  1002

Query  1045  ATLSYGSFFQNCRSRGVYFDIERDIGTVFLLADSLTAGVLGIMCISDTRKNALLSCRAAM  1104
             ATLS  SFFQ+CRSRGVYFD ERD GTVFLLADSLTAGV GIMCISDTRKNAL +CRAAM
Sbjct  1003  ATLSCSSFFQHCRSRGVYFDTERDSGTVFLLADSLTAGVFGIMCISDTRKNALSNCRAAM  1062

Query  1105  EAIAASAGTKSSISKSNHSMNDLMRADSTRDRFSEILRALHLM  1147
             EAIA  AGTK S+SKS+  MN+L+R D  RD+FSEILRALH+M
Sbjct  1063  EAIAGVAGTKMSVSKSSDGMNELIRTDRMRDQFSEILRALHVM  1105

>PYIR_13453
Length=1186

 Score = 698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/1168 (36%), Positives = 652/1168 (56%), Gaps = 103/1168 (9%)

Query  26    MEQVEQKYHKEDVGRILLQTQQELRDIRAEISARKQAGISHVVDAHPHREDHASLANENQ  85
             M+Q +Q++H EDVGRILLQTQ++LR +R +++A      S +             A+   
Sbjct  1     MDQFQQQHHVEDVGRILLQTQEQLRLMREQMAATSTTPSSSM-----------RFASSGA  49

Query  86    SK-DLETLHDILDRAEREIQAKVDLMFRGAANFGQMMQTGLPAVTSPP-----------R  133
             S+ D+    +IL RAE EI+AK +L+  G  N      + LP V+S             +
Sbjct  50    SQPDVLAFQEILQRAEVEIRAKAELVLNGFVNTSSQA-SALPTVSSSANGNASPKARLRQ  108

Query  134   QVSTTTKSLSDQIFSTQESKVDGTRKQLTAAKDDYKCSPSMQQSELISPKRPTQGLLTSK  193
              V++ T +  +   ++ E  +D  R +      ++  SP +          P Q +   +
Sbjct  109   NVTSLTAARRNSRLASDEPDLDYFRARFHNPAVEFVSSPVLPS--------PVQRITKGQ  160

Query  194   ASKKRYNVSLKSLPAVQNGHastsssaladqssETAHF-LNSRHGSPLNS--IEISQSTY  250
               KK+   + + LP+V     S  +  L++Q +++    L +R   P+ +       + +
Sbjct  161   LVKKKMAQNARLLPSVNKSDPSAPTPELSEQDAKSGMLSLVNRGFLPVGADLTPAFINNH  220

Query  251   DRALMQRTAQLHNRLEEPIRTTPCTSTISHDITSLKFDF---------------SAPTIL  295
                +     ++++R E+PIR+ P T+    ++ SLKFD                S P++ 
Sbjct  221   GSIIKNSKTRIYDRQEQPIRSMPSTNPSGFNVASLKFDIAPPSTTVSDRENSNGSEPSLQ  280

Query  296   QSPGKVQI-------------HEQVTHFNDQALGECNCRLSTNQVSMALINGFREDNSKL  342
             ++    Q              +E   +   +           + V   L        +  
Sbjct  281   RTAAATQFVSKGGSSLLSPRQYENSANVRSRGAKVVTVNFQGDAVRGNLQASVGSVTAAA  340

Query  343   SPSRDHSKKMGIPKVIKSTKINT---------------------DTESHKGNNS-----S  376
               S D S++   P+     ++N+                     + E  +G N      S
Sbjct  341   MLSTDQSQEAESPETNLDDEVNSGGNDNADDDNDDTSAMDELRKNVEKIRGYNELLDTYS  400

Query  377   NHDFTIHQGIVDRRRSDFKSFQCFANDVWNNVEEVVTTLERLLSVYFIPIAHINGQRILT  436
              H F IH+G   R   +F SF+  A +VW +VEEV+  LE LL+ YF+P+A+I+GQR++T
Sbjct  401   LHQFIIHKGRAMRETPEFVSFKRVAQEVWGSVEEVIRALEALLTRYFVPLAYIDGQRLMT  460

Query  437   LSQENNKIITNRDLLSCVKNEHEVRMLLLKPGQRFQGVEKCTRAAMAVQSFMRMITFRRT  496
             ++       + RDLLSC+ NE +V  L+ +PGQR++G ++  RAA+ +Q+F RM   ++ 
Sbjct  461   VAAMEMAAFSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAITIQNFFRMWWNQKK  520

Query  497   YLLMISNHRKVRAIQQNWRRYAAYKATKIKIEAIRERQDIVFNEIMRSFCSNWDKIRTQR  556
             Y     +   V  IQ+ WR +A++++ K K++  R +Q   +   M+    +W  I+  R
Sbjct  521   YTRFRHHLASVVTIQRVWRAFASHESLKRKLKFQRAQQHEQWEAKMQRLKRDWTHIKGNR  580

Query  557   RTVMHIPSISIDPRHRMKTEQFSIQQNLQLQRLCALIDENVELIYICPFELTDDIVQYYM  616
             R V+H+PS+SID R R+  + FS++QN+QL RLC LID NV+++Y+ PFELT D+ QY M
Sbjct  581   RVVIHVPSLSIDERSRISADNFSVKQNIQLSRLCGLIDPNVDIVYVSPFELTADVAQYSM  640

Query  617   KLLQLAGISDAAARIKLMCPENASRFPSHFSLSNVVLCSPHTMKRLSRYIRGRNAYLVPG  676
             KLLQL GI+D  AR+KL+ PE A+RFP+HFSL+ ++L SPH ++R+ RYIR + AYLV G
Sbjct  641   KLLQLGGIADPVARVKLVYPEQAARFPAHFSLTTLLLYSPHCLRRIQRYIRNKEAYLVTG  700

Query  677   FPGTEDKRLAALLRIPILGLDPAKFFQMTTHSGIKRCFKKTNANTLPGSIDLYDENELIF  736
              PG EDKRLA  L +PILG+DP     + T SG KR F + + N   G+ D+YDE+EL+F
Sbjct  701   IPGREDKRLAVALNVPILGMDPLSALPLMTKSGSKRFFMRADVNVPTGTYDIYDEDELVF  760

Query  737   SLAKLIAANPHQSSMVLKLDYDPFRTGTALVDISQLQSIQVLRLRTRTLDYWRQPPIQNK  796
             SLAKLI ++  QS  VLK+DYDPF TGTAL+D+S +  ++ +R   ++ +YW+QP  ++ 
Sbjct  761   SLAKLIMSHIEQSVWVLKIDYDPFGTGTALLDVSTMTVLREIRREKKSPEYWKQPSTRDN  820

Query  797   LIRNIVQEMQSIISSLVFMVNPEVYPSWKSFLQAIRMYGVVIEVCPKNRQGYVRANLFIE  856
               R I+ E++  ++ LV  ++PEVYPSW+ F+ AI  +GVV+E  P    G+VRANLFIE
Sbjct  821   AARAIIAELERTLAHLVTPLHPEVYPSWQEFVDAISQFGVVVEAAPSAVIGHVRANLFIE  880

Query  857   PSRRVCISSTQEFLSFENIHENDDRARKVVFDKAFAAKMRTIGFTFPQTLIDHEVLKSAS  916
             PS  V +SSTQ+ ++      N   +      KA A + +T+G+ FPQT   +E ++ AS
Sbjct  881   PSGEVHVSSTQDIIT---TSSNSSSSGGGAGKKAGAYRSKTVGYAFPQTAAPYEAIRGAS  937

Query  917   LVIGQALAKDGICGYISVDFLVILDDQTQNKILYAMALQPFLTNsaasfslfqflsRGGG  976
               IG+ LA + + GY S+D+LV  +D+T    L+AMAL P+LT+SA++F+ F  L+R G 
Sbjct  938   TAIGKLLADECVFGYSSIDYLVFQEDKTHAARLWAMALHPYLTDSASTFATFHLLNR-GA  996

Query  977   YNSKTGLFHLPRAITshgvt---------sdtpsssslsatDLMIREARLSGIVSNELPL  1027
              N+ +GL+HLP    S   +         S    ++  SA DL+++EA  SG+VS E   
Sbjct  997   LNASSGLYHLPPVAASPSSSSTKSLKPSHSRAAGATGTSAADLVMQEATHSGLVSLE-KA  1055

Query  1028  TPTRSYVLLEYVCNPNVATLSYGSFFQNCRSRGVYFDIERDIGTVFLLADSLTAGVLGIM  1087
                R+YV+ EY+ +PNV+T+ Y +FF  CR  GV FD+ER +G+VFLLADSLTAGV GIM
Sbjct  1056  GAQRTYVVSEYIFHPNVSTMQYSAFFHTCRLHGVCFDVERCVGSVFLLADSLTAGVFGIM  1115

Query  1088  CISDTRKNALLSCRAAMEAIAASAGTKS  1115
             C SD+   AL   R A+E I    GT++
Sbjct  1116  CCSDSASGALGFLRTALEVIGREVGTQA  1143

>PYIW_18793
Length=997

 Score = 665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/901 (40%), Positives = 545/901 (60%), Gaps = 56/901 (6%)

Query  260   QLHNRLEEPIRTTPCTSTISHDITSLKFDFSAPTILQ------SPGKVQIHEQVTHFN--  311
             ++++R E+PIR  P T+    +I +LKFD +A    +      SP + +    V + +  
Sbjct  65    RIYDRQEQPIRAVPHTNPSGFNIATLKFDLAATAECREGDGSDSPSQHKAALAVVNGSQL  124

Query  312   DQALGECNCRLSTNQVSMALINGFREDNSKLSPSRDHSKKMGI------PKVIKSTKINT  365
             D    E   R   N ++++     R  N   +      +  GI       +  +S + N 
Sbjct  125   DHDSAETRAR-GPNVLTVSFQGDARRGNFHATVRSAQQQHSGIRHHASANQEAESPETNV  183

Query  366   D---------------------TESHKGNNS-----SNHDFTIHQGIVDRRRSDFKSFQC  399
             D                      E  +G N      S H F IH+G   R   +F SF+ 
Sbjct  184   DEDLMYDEKDDDANAMDELRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFVSFKR  243

Query  400   FANDVWNNVEEVVTTLERLLSVYFIPIAHINGQRILTLSQENNKIITNRDLLSCVKNEHE  459
              A +VW +V+EV+  LE LL+ YF+P+A+++GQR++T++       + RDLLSC+ NE +
Sbjct  244   VAQEVWGSVDEVIKALEALLTRYFVPLAYVDGQRLMTVAAMEMASYSKRDLLSCIVNEDQ  303

Query  460   VRMLLLKPGQRFQGVEKCTRAAMAVQSFMRMITFRRTYLLMISNHRKVRAIQQNWRRYAA  519
             V  L+ +PGQR++G ++  RAA+ +Q+F RM   ++ Y     +   V AIQ+ WR YA+
Sbjct  304   VGSLIRRPGQRYKGKDRKRRAAVTIQNFFRMWWNQKKYSRFRHHLASVVAIQRVWRVYAS  363

Query  520   YKATKIKIEAIRERQDIVFNEIMRSFCSNWDKIRTQRRTVMHIPSISIDPRHRMKTEQFS  579
             +   K +I++ R++Q   +   M+    +W +I+  RR V+H+PS S+D R R+  + FS
Sbjct  364   HDDLKRRIKSQRDQQHAQWEAKMQRLKRDWIRIKGNRRVVIHVPSFSVDERLRLSADNFS  423

Query  580   IQQNLQLQRLCALIDENVELIYICPFELTDDIVQYYMKLLQLAGISDAAARIKLMCPENA  639
             ++QNLQL RLC L+D NV+++Y+ PFELT D+VQY MKLLQL GI+D  AR+KL+ PE+A
Sbjct  424   VKQNLQLSRLCGLVDSNVDIVYVSPFELTTDVVQYSMKLLQLGGIADPVARVKLVFPEHA  483

Query  640   SRFPSHFSLSNVVLCSPHTMKRLSRYIRGRNAYLVPGFPGTEDKRLAALLRIPILGLDPA  699
              RFP+HFSL+ ++L SPH ++R+ RYI+ + AYLV G PG EDKRLA  L +PILG+DP 
Sbjct  484   PRFPTHFSLTTLLLYSPHCLRRIQRYIKNKEAYLVTGMPGPEDKRLAMALNVPILGMDPL  543

Query  700   KFFQMTTHSGIKRCFKKTNANTLPGSIDLYDENELIFSLAKLIAANPHQSSMVLKLDYDP  759
                 + T SG KR F + + N   G+ D+YDE+EL+FSLAKLI ++  QS  VLK+DYDP
Sbjct  544   SALPLMTKSGGKRFFMRADVNVPTGTYDIYDEDELVFSLAKLIVSHIEQSVWVLKIDYDP  603

Query  760   FRTGTALVDISQLQSIQVLRLRTRTLDYWRQPPIQNKLIRNIVQEMQSIISSLVFMVNPE  819
             F TGTAL+D+S + +++ +R   R+ +YWRQP  ++   R I+ E++  + +LV  ++PE
Sbjct  604   FSTGTALLDVSTMVALREIRREKRSPEYWRQPGTRDNAARVIIAELERTLGNLVTPLHPE  663

Query  820   VYPSWKSFLQAIRMYGVVIEVCPKNRQGYVRANLFIEPSRRVCISSTQEFLSFENIHEND  879
             +YPSW+ +  AI  +GVV+E  P    G+VRANLF+EPS  V +SSTQ+ L         
Sbjct  664   LYPSWQDYADAIVQFGVVVEAAPSAVVGHVRANLFVEPSGEVHVSSTQDILLSS------  717

Query  880   DRARKVVFDKAFAAKMRTIGFTFPQTLIDHEVLKSASLVIGQALAKDGICGYISVDFLVI  939
               +         A + +++G+ FPQT   +E ++ AS  IG+ LA+D + GY S+DFLV 
Sbjct  718   --SGGCGGKPGGAYRHKSVGYAFPQTAAPYEAIRGASTAIGKLLAEDNVFGYASIDFLVF  775

Query  940   LDDQTQNKILYAMALQPFLTNsaasfslfqflsRGGGYNSKTGLFHLPRAITshgv----  995
              +D++    L+AMAL+P+LT+SAA+F+ F  L+R G  N+ +GL++LP A  +       
Sbjct  776   QEDKSHTARLWAMALRPYLTDSAATFTTFHLLNR-GALNTTSGLYYLPAATVTSASLVQL  834

Query  996   -tsdtpsssslsatDLMIREARLSGIVSNELPLTPTRSYVLLEYVCNPNVATLSYGSFFQ  1054
              +S    +S  SA DL++ EA  SG+VS E  +    +YV+ EY+ +PNV+T+ Y +FF 
Sbjct  835   QSSSAAFASGASAADLVLHEATHSGLVSLE-KVGAQHTYVVSEYIFHPNVSTMQYSAFFH  893

Query  1055  NCRSRGVYFDIERDIGTVFLLADSLTAGVLGIMCISDTRKNALLSCRAAMEAIAASAGTK  1114
              CR  GV FD+ER +G+VFLLADSLTAGV G+MC SDT   AL   R A+E +    GT+
Sbjct  894   TCRLHGVCFDVERCVGSVFLLADSLTAGVFGLMCCSDTASGALGFLRTALEVVGREVGTQ  953

Query  1115  S  1115
             +
Sbjct  954   A  954

>PYU1_G001734
Length=800

 Score = 640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/785 (43%), Positives = 497/785 (63%), Gaps = 43/785 (5%)

Query  373   NNSSNHDFTIHQGIVDRRRSDFKSFQCFANDVWNNVEEVVTTLERLLSVYFIPIAHINGQ  432
             +  S H F IH+G   R   +F SF+  A ++W  VEEV+  LE LL+ YF+P+A+++GQ
Sbjct  19    DTYSLHQFIIHKGKAMRETPEFVSFKRVAQEIWGGVEEVIKALETLLTRYFVPLAYVDGQ  78

Query  433   RILTLSQENNKIITNRDLLSCVKNEHEVRMLLLKPGQRFQGVEKCTRAAMAVQSFMRMIT  492
             R++T++       + +DLLSC+ NE +V  L+ +PGQR++G ++  RAA+ +Q+  RM +
Sbjct  79    RLMTVASMEMASFSKQDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAITIQNVFRMWS  138

Query  493   FRRTYLLMISNHRKVRAIQQNWRRYAAYKATKIKIEAIRERQDIVFNEIMRSFCSNWDKI  552
              ++ Y     +   V  IQQ WR YA+++  + K++A R++Q   +   M+     W +I
Sbjct  139   NQKKYSRYRRHLSSVVLIQQVWRAYASHEDLRRKLKAQRQQQHEQWEARMQRLQREWPRI  198

Query  553   RTQRRTVMHIPSISIDPRHRMKTEQFSIQQNLQLQRLCALIDENVELIYICPFELTDDIV  612
             +  RR ++H+PS+SID R R++ + F+++QNLQL RLC +ID NV+++Y+ PFELT ++ 
Sbjct  199   KANRRVIIHVPSLSIDERFRIRADNFAVKQNLQLSRLCGIIDANVDIVYVSPFELTSEVG  258

Query  613   QYYMKLLQLAGISDAAARIKLMCPENASRFPSHFSLSNVVLCSPHTMKRLSRYIRGRNAY  672
             QY+MKLLQL GI+D   R+KL+ PE A+RFP+HFSL+ V+L SPH ++R+ R ++G+ AY
Sbjct  259   QYFMKLLQLGGIADPVTRVKLVFPEQATRFPAHFSLTTVLLYSPHCLRRIRRCVKGKEAY  318

Query  673   LVPGFPGTEDKRLAALLRIPILGLDPAKFFQMTTHSGIKRCFKKTNANTLPGSIDLYDEN  732
             LV G PG EDKRLA  L +PILG+DP     + T SG KR F + + N   G+ D+YDE+
Sbjct  319   LVTGMPGQEDKRLAMALNVPILGMDPLATLPLMTKSGSKRFFMRADVNVPTGTYDIYDED  378

Query  733   ELIFSLAKLIAANPHQSSMVLKLDYDPFRTGTALVDISQLQSIQVLRLRTRTLDYWRQPP  792
             ELIFSLAKLI ++  Q+  +LK+DYDPF TGTA+VD S + +++ +R   ++ +YWRQP 
Sbjct  379   ELIFSLAKLIVSHIEQNVWLLKIDYDPFGTGTAIVDASVVTALREIRREKKSPEYWRQPG  438

Query  793   IQNKLIRNIVQEMQSIISSLVFMVNPEVYPSWKSFLQAIRMYGVVIEVCPKNRQGYVRAN  852
              ++   R I+ E++  I  LV  ++PEVYP+W+ F  AI  +GVVIE  P    GY+RAN
Sbjct  439   TRDNAARMIIAELERTIGKLVTPLHPEVYPTWQEFADAIAQFGVVIEAAPSAIVGYIRAN  498

Query  853   LFIEPSRRVCISSTQE-FLSFENIHENDDRARKVVFDKAFAAKMRTIGFTFPQTLIDHEV  911
             LF+EPS  V +SSTQ+  LS  +IH+     RKV             G+ FPQT   +E 
Sbjct  499   LFVEPSGEVHVSSTQDVILSTASIHK-----RKVA------------GYAFPQTTAPYEA  541

Query  912   LKSASLVIGQALAKDGICGYISVDFLVILDDQTQNKILYAMALQPFLTNsaasfslfqfl  971
             ++ AS+ IG+ L  D + GY SVD+LV  +D+T    L+AMAL P+LT+SA++F++F  L
Sbjct  542   IRGASMAIGKVLVDDSVFGYSSVDYLVFREDKTHVPRLWAMALHPYLTDSASTFAVFHLL  601

Query  972   sRGGGYNSKTGLFHLP-------------RAITshgvtsdtpsssslsatDLMIREARLS  1018
             +R G  N  TG +HLP              +++     S T ++ S ++ +L+++EA   
Sbjct  602   NR-GALNIHTGQYHLPAPAASGVPSSSTASSVSLKLNASSTRAAGSATSANLVLQEATHL  660

Query  1019  GIVSNELPLTPTRSYVLLEYVCNPNVATLSYGSFFQNCRSRGVYFDIERDIGTVFLLADS  1078
             G+VS E      R+Y + EY+ +PNV+T+ Y SFF  CR  GV FD+ER  GT+F+LADS
Sbjct  661   GLVSLE-KAGAQRTYAVNEYIFHPNVSTMQYSSFFHTCRLHGVCFDVERCFGTIFMLADS  719

Query  1079  LTAGVLGIMCISDTRKNALLSCRAAMEAIAASAGTKSSISKSNHSMNDLMR--ADSTRDR  1136
             LTAGV GI+C  DT   AL   R A+E I    GT+        ++ D +R   D     
Sbjct  720   LTAGVFGIICCGDTASAALGFLRTALEVIGREVGTQ--------ALTDDLRGGGDCESGN  771

Query  1137  FSEIL  1141
             F+E+L
Sbjct  772   FAEVL  776

>PYAP_17746
Length=1169

 Score = 604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/1162 (34%), Positives = 624/1162 (54%), Gaps = 95/1162 (8%)

Query  26    MEQVEQKYHKEDVGRILLQTQQELRDIRAEISARKQAGISHVVDAHPHREDHASLANENQ  85
             MEQ++Q++H EDVGRILLQTQ +LR +R ++      G   V+            A+ N 
Sbjct  1     MEQLQQRHHVEDVGRILLQTQDQLRQLREQLVGSNGPGNGSVI------------ASNNA  48

Query  86    SKDLETLHDILDRAEREIQAKV-----DLMFRGAANFGQMMQTG----LPAVTSPPRQVS  136
               ++E   +IL RAE E++ K      +++  G A+ G   + G    LP V  PP    
Sbjct  49    GAEIE---EILQRAEDELRMKAELVLSNIVTAGPASPGANDREGGLIPLPTVRRPPIARR  105

Query  137   TTTKS-LSDQIFSTQESKVDGTRKQLTAAKDDYKCSPSMQQSELISPKRPTQGLLTSKAS  195
                K+ L D      + +    R + TA  D    S +M  +       PT      K  
Sbjct  106   RRRKAELHDGGSYDLDIEYFRQRFKRTAVDD---ASSTMTTAPRQRGGGPTPTHAHGKVV  162

Query  196   KKRYNVSLKSLPAVQNGHastsssaladqssETAHF-LNSRHGSPLN----------SIE  244
             K +   + + LP V     +     L+   ++     L +R   P N          S  
Sbjct  163   KHKTTSNARLLPFVNKYDPTAPRPVLSPVDAKQGVLSLLNRGFLPPNVDLTPAFQSVSSP  222

Query  245   ISQSTYDRALMQRTAQLHNRLEEPIRTTPCTSTISHDITSLKFDFSAPTILQSPGK--VQ  302
              SQ      +   + +LH R E+P+R T  +S  + ++ +LKFD +A   + +     ++
Sbjct  223   KSQGNPTSVIQNGSVKLHRREEQPVRATAYSSPGNFNLATLKFDMAAVNTVTAAENRSIE  282

Query  303   IHEQVTHFNDQALGECNCRLSTNQVSMALIN--------GFREDNSKLSPSRDHSKKMGI  354
              H++      +A+          +   +  N        G RED +  +P       +  
Sbjct  283   PHDESEALPLRAMKTVTISFHNGKSESSPRNNARESEHDGRREDGNDTAPLEREDLDVTA  342

Query  355   PKVIKSTK-INTDTESHKGNNS-----SNHDFTIHQGIVDRRRSDFKSFQCFANDVWNNV  408
              +   S + +  + E  +G N      S H F IH+G   R   +F+SF+  A ++W ++
Sbjct  343   DEAANSMEDLRNNVEKIRGYNELLDAYSLHQFIIHKGRALRDTPEFQSFKRVAQEIWGSI  402

Query  409   EEVVTTLERLLSVYFIPIAHINGQRILTLSQENNKIITNRDLLSCVKNEHEVRMLLLKPG  468
             EEV+  LE LL+ YF+P+A+I+GQR++TL+      ++  +LL+CV NE +V  L+ +PG
Sbjct  403   EEVIQALEILLTRYFVPLAYIDGQRLMTLASMEMAKLSTCELLTCVVNEDQVASLIRRPG  462

Query  469   QRFQGVEKCTRAAMAVQSFMRMITFRRTYLLMISNHRKVRAIQQNWRRYAAYKATKIKIE  528
             QR++G ++  RAA  +Q+F RM+  R  +  +  N      IQ+ WR YA  ++ + ++ 
Sbjct  463   QRYKGKDRKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSLRRRLA  522

Query  529   AIRERQDIVFNEIMRSFCSNWDKIRTQRRTVMHIPSISIDPRHRMKTEQFSIQQNLQLQR  588
              +RE +   +   +R   S W  IR QRR V+H+ SIS+D R R+  E FS++QNLQL R
Sbjct  523   HVREERLGEWKAKVRRMRSQWRDIRQQRRVVIHVASISVDERTRLSMENFSVKQNLQLSR  582

Query  589   LCALIDENVELIYICPFELTDDIVQYYMKLLQLAGISDAAARIKLMCPENASRFPSHFSL  648
             L  L+D+NVE++Y+ PFEL+ ++ QY++KLLQL+GI++A  R++L+ PE+A++FP HFSL
Sbjct  583   LAGLVDQNVEIVYVTPFELSTEVSQYFIKLLQLSGIANAHTRVRLVFPEHAAQFPQHFSL  642

Query  649   SNVVLCSPHTMKRLSRYIRGRNAYLVPGFPGTEDKRLAALLRIPILGL-DPAKFFQMTTH  707
             +  ++ SP+ ++R+ R ++G+ AYLV G PG ED+RLA  L++PILG  DP     + T 
Sbjct  643   ATHLIYSPNCIRRIQRLVQGKEAYLVMGVPGPEDQRLAVALQVPILGPEDPTSILPLMTR  702

Query  708   SGIKRCFKKTNANTLPGSIDLYDENELIFSLAKLIAANPHQSSMVLKLDYDPFRTGTALV  767
             SG KR F K + N   G+ D+YD +EL+FSLAKLI ++ +Q+  +LKLD DP  TGTA++
Sbjct  703   SGSKRFFIKADVNVPTGTYDIYDIDELLFSLAKLIISHLNQNVWLLKLDADPLGTGTAIL  762

Query  768   DISQLQSIQVLRLRTRTLDYWRQPPIQNKLIRNIVQEMQSIISSLVFMVNPEVYPSWKSF  827
             D+S + +++ +R   R  +YW+QP I++ + R ++QE++  I SL+   +PE++ SWK F
Sbjct  763   DVSLMTTLRDIRREKRPPEYWKQPGIRDTIARALLQELEREIGSLLKPSHPEIFASWKEF  822

Query  828   LQAIRMYGVVIEVCPKNRQGYVRANLFIEPSRRVCISSTQEFLSFENIHENDDRARKVVF  887
               AI  +GVV+E  P +  G +R N+FIEPS  V + ST + LS  N      R R    
Sbjct  823   ASAIPEFGVVVEALPFHVAGVIRMNIFIEPSGDVHVMSTNDVLS-GNGTTLSQRQR----  877

Query  888   DKAFAAKMRTIGFTFPQTLIDHEVLKSASLVIGQALAKD-GICGYISVDFLV----ILDD  942
                     R   F FPQTL+ HE +  AS  +G+ L ++   CGY SVD  +     L  
Sbjct  878   --------RPAAFVFPQTLVPHEAIVGASSAVGRVLYEEHAFCGYASVDLQLSQEESLTS  929

Query  943   QTQNKILYAMALQPFLTNsaasfslfqflsRGGGYNSKTGLFHLPRAITshgvtsdtpss  1002
               + + L+A++L P+LT+SAA+F+ F  L R G  N  TG ++L            T   
Sbjct  930   PHKAERLWAVSLFPYLTDSAATFAAFHALHR-GVLNPATGRYNL------------TARE  976

Query  1003  sslsatDLMIREARLSGIVSNELPLTPTRSYVLLEYVCNPNVATLSYGSFFQNCRSRGVY  1062
             S+   +D     A +S ++     +   RSY + EYV +PNV+ +SY +FF  CR  GV 
Sbjct  977   STPPESD----SALVSSVIGTLDRIGAPRSYAVAEYVFHPNVSIMSYNAFFHTCRLHGVC  1032

Query  1063  FDIERDIGTVFLLADSLTAGVLGIMCISDTRKNALLSCRAAMEAIAASAGTKSSISKSNH  1122
             FD+ER +G+VFLLADSLTAG+ G++   ++   AL   R A E I    GT+S +S    
Sbjct  1033  FDVERCVGSVFLLADSLTAGIFGVLSSGESATQALQYLRTAFEVIGREVGTQSMVSGD--  1090

Query  1123  SMNDLMRADSTRDRFSEILRAL  1144
               +D+  +      F+EIL  L
Sbjct  1091  --SDIGSSVQLSGNFAEILGLL  1110

>PHYRA_95901
Length=1075

 Score = 587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/1158 (34%), Positives = 633/1158 (55%), Gaps = 142/1158 (12%)

Query  26    MEQVEQKYHKEDVGRILLQTQQELRDIRAEISARKQAGISHVVDAHPHREDHASLANENQ  85
             ME+V+Q++H EDVGR+LLQTQ++LR +R +++A      +   +A P R  H+++     
Sbjct  1     MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAA---AVEANASPMR--HSAVVT---  52

Query  86    SKDLETLHDILDRAEREIQAKVDLMFRGAANFGQMMQTG-------LPAVT--SPPRQVS  136
             + +++  + IL + E E++AK +L+ +G  N     QT        LP VT  +PP   S
Sbjct  53    TAEVQAFNAILQQTEVELRAKAELVLKGMVNSSSSAQTNQSQSGTLLPVVTVAAPP---S  109

Query  137   TTTKSLSDQIFSTQESKVDGTRKQLTAAKDDYKCSPSMQQSELISPKRPTQ--GLLTSKA  194
             T  +S      S     ++  R+Q       +  S  ++QS + SP+   +  G+   + 
Sbjct  110   TRHRSGYGDASSI---PIEFFREQF------HNSSVEVRQSLMPSPQHWQRHLGIQHGRL  160

Query  195   SKKRYNVSLKSLPAVQNGHastsssaladqssETAHFLNSRHGSPLNSIEISQSTYDRA-  253
              +K+     + LP+V     +  +  L ++        +++HG  LN +  S  T D + 
Sbjct  161   LRKKTTQHCRLLPSVNKVDPTAPTPELREE--------DAKHGV-LNLVTRSSGTKDGSG  211

Query  254   -LMQRTAQLHNRLEEPIRTTPCTSTISHDITSLKFDFSAPTILQSPGKVQIHEQVTHFND  312
              + QR  ++++R E+P R TP T +  +++ +LKFD      L+S G        T  ND
Sbjct  212   VMKQRATRIYDRSEQPARATPFTQSTGYNLAALKFD------LRSTG--------TGKND  257

Query  313   QALGECNCRLSTNQVSMALING--FREDNSKLSPSRDHSKKMGIPKVIKSTKINTDTESH  370
             ++    N  +  N+     I+G    ED       +D   +M         ++  + +  
Sbjct  258   RS----NDDMEGNREH---IDGEISDEDQGGADNDKDEEAEM--------EELGANVDKI  302

Query  371   KGNNS-----SNHDFTIHQGIVDRRRSDFKSFQCFANDVWNNVEEVVTTLERLLSVYFIP  425
             +G N      S H F IH+G   R   +F SF+  A ++W +VEE +  LE LL+ YF+P
Sbjct  303   RGYNDLLDAYSLHQFLIHKGRSMRDTPEFVSFRRVAQELWGSVEEALRALETLLTQYFVP  362

Query  426   IAHINGQRILTLSQENNKIITNRDLLSCVKNEHEVRMLLLKPGQRFQGVEKCTRAAMAVQ  485
             +A+++GQR+L+L+       +  +LL+C+ NE +V  +L +PGQR++G ++  RAA  +Q
Sbjct  363   LAYVDGQRLLSLAATGQPRFSKSELLACIVNEEQVMSVLRRPGQRYKGRDRKRRAATTIQ  422

Query  486   SFMRMITFRRTYLLMISNHRKVRAIQQNWRRYAAYKATKIKIEAIRERQDIVFNEIMRSF  545
             + +RM + RR Y+   ++      IQ  WR Y+ + A K ++  +R  Q   +   M+  
Sbjct  423   ACVRMWSIRRRYVRSRASDISATRIQLAWRSYSCHAALKTRLREVRREQLERWEARMQDL  482

Query  546   CSNWDKIRTQRRTVMHIPSISIDPRHRMKTEQFSIQQNLQLQRLCAL-IDENVEL-IYIC  603
              + W +I  +RR V+H+PS+S+D   R+  E F++QQNLQL R+CA  +D +V+L +Y+ 
Sbjct  483   RTQWPQIAGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSHVDLLVYVS  542

Query  604   PFELTDDIVQYYMKLLQLAGISDAAARIKLMCPENASRFPSHFSLSNVVLCSPHTMKRLS  663
             PFELT D+ QY++KLLQL G++D+  R+KL+ PE A+RFP HFSLS+++L SPH ++R+ 
Sbjct  543   PFELTADVSQYFLKLLQLGGLADSRPRVKLVFPEQAARFPDHFSLSSLLLYSPHCLRRIR  602

Query  664   RYIRGRNAYLVPGFPGTEDKRLAALLRIPILGLDPAKFFQMTTHSGIKRCFKKTNANTLP  723
              Y  G+ AYLV G PG ED+RLA  L +PILG  PA+   + T SG KR   + + N   
Sbjct  603   HYTAGKEAYLVMGLPGAEDQRLAVALDLPILGAPPAQALPLLTRSGGKRLLIRADVNVPT  662

Query  724   GSIDLYDENELIFSLAKLIAANPHQSSMVLKLDYDPFRTGTALVDISQLQSIQVLRLRTR  783
             G+ +LYDE+EL  +LAKL  A+  Q   +LKLDYDP   G A+VD+S +Q+++ LR   R
Sbjct  663   GTYELYDEHELFAALAKLAVAHMEQPKWLLKLDYDPLGIGEAVVDLSGMQAMRELRREKR  722

Query  784   TLDYWRQPPIQNKLIRNIVQEMQ--SIISSLVFMVNPEVYPSWKSFLQAIRMYGVVIEVC  841
             T +YWRQP  ++   + ++ E++   +++ L   ++ E++P+W+ F +AI  +G VIE  
Sbjct  723   TPEYWRQPGPRDAAAKLVLAELERPGVLARLATPMHTEIFPAWRDFTEAIGHFGCVIEAV  782

Query  842   PKN-------------RQGYVRANLFIEPSRRVCISSTQEFLSFENIHENDDRARKVVFD  888
             P                  YVRANLF+ P  +  ++S+   L+                 
Sbjct  783   PPAGIAATPESSSLLVEPAYVRANLFVYPDGKNVLASSGGGLN-----------------  825

Query  889   KAFAAKMRTIGFTFPQTLIDHEVLKSASLVIGQALAKDGICGYISVDFLVILDDQTQNKI  948
                    +T+ FTFPQT   HE ++ A    G+ L +  + GY+S+DF+V  D++     
Sbjct  826   ------RKTVAFTFPQTAAPHEAVQGACDATGKLLVETSVWGYVSLDFVVFQDEKNGGSP  879

Query  949   -LYAMALQPFLTNsaasfslfqflsRGGGYNSKTGLFHLPRAITshgvtsdtpsssslsa  1007
              L+A+A+ PFLT+SAASF+ F  L+R G Y           A ++  V ++   S S  A
Sbjct  880   RLWALAVHPFLTDSAASFACFHLLAR-GAYRV---------AASNSMVNANPGRSGSGGA  929

Query  1008  tDLMIREARLSGIVSNELPLTPTRSYVLLEYVCNPNVATLSYGSFFQNCRSRGVYFDIER  1067
              DL++REA L+       P    R +V+  YV +P+V T+ Y +FF  CR  GV FD+ER
Sbjct  930   ADLLLREASLTKAALAGAP----RCFVVCSYVFHPHVTTMQYSAFFHACRLHGVCFDVER  985

Query  1068  DIGTVFLLADSLTAGVLGIMCISDTRKNALLSCRAAMEAIAASAGTKSSISKSNHSMNDL  1127
              +GT+FLLADSLTAGV GI+ + +T + AL   R A+E I    G    ++ S       
Sbjct  986   TLGTLFLLADSLTAGVFGILSVGETTEGALAFLRTALEVIGREVGATIEMATS-------  1038

Query  1128  MRADSTRD-RFSEILRAL  1144
              R  STR+  F+++L A+
Sbjct  1039  -RPVSTRNGNFAQVLSAV  1055

>PPTG_17128
Length=1177

 Score = 572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/1177 (33%), Positives = 638/1177 (54%), Gaps = 135/1177 (11%)

Query  26    MEQVEQKYHKEDVGRILLQTQQELRDIRAEISARKQAGISHVVDAHPHREDHASLANENQ  85
             ME+V+Q+ H EDVGR+LLQTQ++LR +R +++A      +   +A P R  H+++     
Sbjct  1     MEKVQQQQHVEDVGRLLLQTQEQLRVMREQMTAAAA---AVEANASPMR--HSAIVT---  52

Query  86    SKDLETLHDILDRAEREIQAKVDLMFRG-----AANFGQMMQTG--LPAVTSPPRQVSTT  138
             + +++  + IL + E E+++K +L+  G             Q+G  LPAVT        +
Sbjct  53    TAEVQAFNAILQQTETELRSKAELVLNGMVNSSNNAQNNQTQSGNFLPAVTV---AALPS  109

Query  139   TKSLSDQIFSTQESKVDGTRKQLTAAKDDYK-CSPSMQQSELISPKRPTQ---GLLTSKA  194
             TK  S    + +  ++D +   +   ++ ++  S  ++QS + SP+ P Q   G+   + 
Sbjct  110   TKHRSGYNGANKPRQMDASSIPMEFFREQFRNSSVEIRQSLMPSPE-PWQRHFGVHHGRL  168

Query  195   SKKRYNVSLKSLPAVQNGHastsssaladqssETAHFLNSRHGSPLNSIE----------  244
              +K+     + LP+V     S  +  L ++        +++HG  LN +           
Sbjct  169   MRKKTTQHCRLLPSVNKVDPSAPAPELREE--------DAKHGV-LNLVTRGFLPAYADL  219

Query  245   ---------ISQSTYDRALMQRTAQLHNRLEEPIRTTPCTSTISHDITSLKFDFSAPTI-  294
                       S  +    + QR  ++++R E+ +R+TP T +  +++ SLKFD  AP   
Sbjct  220   TPAFAGPNGTSNGSCGGIMKQRATRIYDRSEQAVRSTPFTQSTGYNLASLKFDLCAPPTP  279

Query  295   ---------LQSP------------GKVQIHEQVTHFNDQALGECNCRLSTNQVSM--AL  331
                      L  P              VQ   +VT    ++  +     S +Q S+  A 
Sbjct  280   PPPIPESKDLMPPESTTRRRSVRKSSAVQGPNRVTMSFPKSGNKVKNSRSAHQTSLMSAA  339

Query  332   INGF------------REDNSKLSPSRDHSKKMGIPKVIKSTKINTDTESHKGNNS----  375
             +  F            R  +  +S     + + G  +  +  ++  + +  +G N     
Sbjct  340   VAAFTNQGEDMDNNRGRFSDDDVSDEDQENDENGKDEDAEMEELGANVDKIRGYNELLDA  399

Query  376   -SNHDFTIHQGIVDRRRSDFKSFQCFANDVWNNVEEVVTTLERLLSVYFIPIAHINGQRI  434
              S H F IH+G   R   +F SF+  A ++W +VEE +  LE LL+ YF+P+A+++GQR+
Sbjct  400   YSLHQFLIHKGRTMRDTPEFISFRRVAQELWGSVEEALRALEALLTQYFVPLAYVDGQRL  459

Query  435   LTLSQENNKIITNRDLLSCVKNEHEVRMLLLKPGQRFQGVEKCTRAAMAVQSFMRMITFR  494
             L L+       + R+LLSC+ NE ++  +L +PGQR++G ++  RAA  VQ+ +RM   R
Sbjct  460   LALAGTGQPRFSKRELLSCIVNEDQIMSVLRRPGQRYKGRDRKRRAATTVQACIRMWLVR  519

Query  495   RTYLLMISNHRKVRAIQQNWRRYAAYKATKIKIEAIRERQDIVFNEIMRSFCSNWDKIRT  554
             R Y    ++      IQ  WR Y+ + A K ++  +R  +   + + M +  S W +I  
Sbjct  520   RRYARSRASDINATKIQLAWRAYSCHTALKTRLREVRREKLEKWEKRMCTLKSQWSQIAA  579

Query  555   QRRTVMHIPSISIDPRHRMKTEQFSIQQNLQLQRLCAL-IDENVEL-IYICPFELTDDIV  612
             +RR V+H+PS+S+D  +R+  E F++QQNLQL R+CA+ +D NV+L +Y+ PFELT D++
Sbjct  580   RRRVVVHVPSLSLDEHYRLSAENFAVQQNLQLTRVCAVALDSNVDLLVYVSPFELTADVL  639

Query  613   QYYMKLLQLAGISDAAARIKLMCPENASRFPSHFSLSNVVLCSPHTMKRLSRYIRGRNAY  672
             QY++KLLQL G+ D+  R+K + PE ++RFP+HFSLS+++L SPH ++R+  Y  G+ AY
Sbjct  640   QYFLKLLQLGGLVDSGPRVKFVFPEQSTRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAY  699

Query  673   LVPGFPGTEDKRLAALLRIPILGLDPAKFFQMTTHSGIKRCFKKTNANTLPGSIDLYDEN  732
             LV G PG ED+RLA  L +PILG  PA+   + T SG KR   + + N   G+ +LYDE+
Sbjct  700   LVMGLPGAEDQRLAIALDLPILGAPPAQALPLLTRSGGKRLLIRADVNVPNGTYELYDEH  759

Query  733   ELIFSLAKLIAANPHQSSMVLKLDYDPFRTGTALVDISQLQSIQVLRLRTRTLDYWRQPP  792
             EL  +LAKL  A+  Q   ++KLDYDP   G A+VD+S +Q+++ LR   RT +YWRQP 
Sbjct  760   ELCAALAKLAIAHMDQPKWLIKLDYDPLGVGEAVVDLSNIQAMRELRREKRTPEYWRQPG  819

Query  793   IQNKLIRNIVQEMQ--SIISSLVFMVNPEVYPSWKSFLQAIRMYGVVIEVCPKN------  844
              ++   + I+ E++   +++ L   ++ E++P+W+ ++ A+  +G VIE  P        
Sbjct  820   PRDAAAKMILAELERPGMLARLAAPMHSEMFPTWRDYIDAVGHFGCVIEAVPPTAIAASP  879

Query  845   -------RQGYVRANLFIEPSRRVCISSTQEFLSFENIHENDDRARKVVFDKAFAAKMRT  897
                       YVRANLF++P   V ++STQ  L+      N                 +T
Sbjct  880   EASTALVEPAYVRANLFVDPDGSVHVTSTQNVLATGGGGLN----------------RKT  923

Query  898   IGFTFPQTLIDHEVLKSASLVIGQALAKDGICGYISVDFLVILDDQTQNKI-LYAMALQP  956
             + FTFPQT   HE +K A    G+ L +  + GY+S+DF+V  D+++     L+A+A+ P
Sbjct  924   VAFTFPQTAAPHEAIKGACNAAGKLLVETNVWGYVSLDFVVFQDEKSNGAPRLWALAVHP  983

Query  957   FLTNsaasfslfqflsRGGGYNSKTGLFHLPRAITshgvtsdtpsssslsatDLMIREAR  1016
             FLT+SAASF+ F  L+R G  ++ +G +     + S  +T+ T  + S   TDL++REA 
Sbjct  984   FLTDSAASFACFHLLAR-GVLDTNSGAYR----VASKSLTTVTGRNGSGCTTDLLLREAS  1038

Query  1017  LSGIVSNELPLTPTRSYVLLEYVCNPNVATLSYGSFFQNCRSRGVYFDIERDIGTVFLLA  1076
             L+    + L   P R +V+  YV +P+V T+ Y +FF  CR  GV FD+ER +GT+FLLA
Sbjct  1039  LA---KDSLAGAP-RCFVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLA  1094

Query  1077  DSLTAGVLGIMCISDTRKNALLSCRAAMEAIAASAGT  1113
             DSLTAGV G++ I +T + AL   R A+E I   AG+
Sbjct  1095  DSLTAGVFGVLSIGETMEGALAFLRTALEVIGREAGS  1131

>PHALS_06477
Length=1166

 Score = 570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/1181 (33%), Positives = 604/1181 (51%), Gaps = 142/1181 (12%)

Query  25    GMEQVEQKYHKEDVGRILLQTQQELRDIRAEISARKQAGISHVVDAHPHREDHASLANEN  84
             GME+V+Q YH EDVGR+LL+TQ++LR +R +++A   A  S   +  P R  H+S+    
Sbjct  15    GMEKVQQHYHVEDVGRLLLETQEQLRAMREQMTA---AAASMEANKSPKR--HSSVIT--  67

Query  85    QSKDLETLHDILDRAEREIQAKVDLMFRGAANFGQMMQ-------TGLPAVT----SPPR  133
              + +++  H +L + E E++AK +L+  G  N    +        T LPAV+    SP +
Sbjct  68    -NAEVQAFHALLQQTESELRAKAELVLNGIINSSNSVHNSQVQRNTRLPAVSVAAPSPIK  126

Query  134   QVSTTTK-------------SLSDQIFSTQ--ESKVD----------------GTRKQLT  162
                  ++             S S + F  Q   ++V+                G R+   
Sbjct  127   HRRGDSRADEFGHINRIDNNSTSMEFFRQQFRNNRVEIRQSLMTSPENWRRKSGARRVRK  186

Query  163   AAKDDYKCSPSMQQSELISPKRPTQGLLTSKASKKRYNVSLKS-LPAVQNGHastsssal  221
                  Y+  P + +++   P  PT  L    A+    N+  +  LPA  +          
Sbjct  187   KTTQHYRLLPCVNKAD---PSEPTPDLREEDATCGLLNLVTRGFLPAYAD----------  233

Query  222   adqssETAHFLNSRHGSPLNSIEISQSTYDRALMQRTAQLHNRLEEPIRTTPCTSTISHD  281
                       L      P      S  +   AL  R   +++R +   R TP   +I  +
Sbjct  234   ----------LTPAFAGPNGK---SNGSGGCALKHRATYIYDRSKRSARCTPLVYSIGFN  280

Query  282   ITSLKFDF---SAPTILQSP---GKVQIHEQVTHFND------------QALGECNCRLS  323
             +  LKFDF   S P+    P     V      T F+              +L     R  
Sbjct  281   LAGLKFDFRTSSTPSSAPKPNHSATVSASMPNTKFSSIMQTVSSGPAKRNSLVVAAPRNQ  340

Query  324   TNQVSMALINGFRE-------DNSKLSPSRDHSKKMGIPKVIKSTKINTDTESHKGNNSS  376
                +     + F +       D+S +      S K     V K  + N   +++     S
Sbjct  341   NEDIENNCTHSFEDQEDEEGSDDSDIIKDEGFSTKDLAVNVAKIREYNDLVDAY-----S  395

Query  377   NHDFTIHQGIVDRRRSDFKSFQCFANDVWNNVEEVVTTLERLLSVYFIPIAHINGQRILT  436
              H   I++G   R   +F SF+   +D+W +VEEV+  LE +L  YF+P+AH++GQR++ 
Sbjct  396   LHQILIYKGRAIRDTPEFTSFRRVVHDLWGSVEEVLRALEAILFQYFVPLAHVDGQRLIA  455

Query  437   LSQENNKIITNRDLLSCVKNEHEVRMLLLKPGQRFQGVEKCTRAAMAVQSFMRMITFRRT  496
             L+  N    + R+LLSC+ N+ +V  +L +PGQR+ G ++  RAA  +Q+  RM      
Sbjct  456   LASTNQPQFSRRELLSCIVNKEQVMSVLRRPGQRYNGRDRKHRAATTIQACARMWMVHHR  515

Query  497   YLLMISNHRKVRAIQQNWRRYAAYKATKIKIEAIRERQDIVFNEIMRSFCSNWDKIRTQR  556
             Y+   S++     IQ  +R Y+   A K ++  IR  +   +   M  F S W +I  +R
Sbjct  516   YVKSRSSNINAIKIQSAFRAYSRCTALKARLREIRCEKAAKWEARMYEFKSQWSQIAARR  575

Query  557   RTVMHIPSISIDPRHRMKTEQFSIQQNLQLQRLCAL-IDENVEL-IYICPFELTDDIVQY  614
             R V+H+PS+S+    R+  E F++QQNLQL R+CA  +D  V+L +Y+ P+ELT D+ QY
Sbjct  576   RIVVHVPSMSLGEHSRLNAENFAVQQNLQLTRICAAALDLQVDLLVYVSPYELTADVSQY  635

Query  615   YMKLLQLAGISDAAARIKLMCPENASRFPSHFSLSNVVLCSPHTMKRLSRYIRGRNAYLV  674
             + KLLQL+G +D+  R+K + PE A+RFP+HFSLS+++L SP+ ++R+  Y  G  AYLV
Sbjct  636   FHKLLQLSGPADSRPRVKFVYPEQAARFPAHFSLSSLILYSPYCLRRIRHYTAGNEAYLV  695

Query  675   PGFPGTEDKRLAALLRIPILGLDPAKFFQMTTHSGIKRCFKKTNANTLPGSIDLYDENEL  734
              G PG ED+RLA  L +PILG  P++   + T SG KR   + + N   G+ +LYDE+E+
Sbjct  696   MGLPGPEDQRLAITLDLPILGALPSQALPLLTRSGGKRLLIQADINVPTGTYELYDEHEI  755

Query  735   IFSLAKLIAANPHQSSMVLKLDYDPFRTGTALVDISQLQSIQVLRLRTRTLDYWRQPPIQ  794
               +LAKL  A+  QS  ++KLDYDP   G A+VD+S +Q+++ L    RT +YWRQP  +
Sbjct  756   SVALAKLAVAHIDQSKWLIKLDYDPLGVGEAVVDLSSMQAMRELHREKRTPEYWRQPGTR  815

Query  795   NKLIRNIVQEMQ--SIISSLVFMVNPEVYPSWKSFLQAIRMYGVVIEVCPKNRQG-----  847
             +      + E +    ++ L   ++ E+YP+W+ +  AI  +G VIE  P          
Sbjct  816   DAAANLFLTEFERPGKLARLTTPIHTELYPTWREYAAAIGHFGCVIEAVPPTASAASMEE  875

Query  848   --YVRANLFIEPSRRVCISSTQEFLSFENIHENDDRARKVVFDKAFAAKMRTIGFTFPQT  905
               Y+RAN+F++P+  V ++STQ  L+         R  ++              F FPQT
Sbjct  876   PTYLRANIFVDPNGTVHMTSTQNVLT--TTRGGLSRKSEI--------------FAFPQT  919

Query  906   LIDHEVLKSASLVIGQALAKDGICGYISVDFLVILDDQTQNKI-LYAMALQPFLTNsaas  964
             +  H  +K A   +G+ LA+  + GY+S+DF+V  D ++   + L+A+A+ PFLTNSAA+
Sbjct  920   VAPHAAIKGACNAVGKQLAETNVWGYVSLDFVVFQDIKSNAAVRLWALAIHPFLTNSAAT  979

Query  965   fslfqflsRGGGYNSKTGLFHLPRAITshgvtsdtpsssslsatDLMIREARLSGIVSNE  1024
             F+ F  L+R G  ++ +G++ +P              S +  A DL++REA L+  +   
Sbjct  980   FACFHLLTR-GCLDANSGIYRVP-GTKKLQTACTAEQSGNHDAMDLLLREASLTKAIFQ-  1036

Query  1025  LPLTPTRSYVLLEYVCNPNVATLSYGSFFQNCRSRGVYFDIERDIGTVFLLADSLTAGVL  1084
                  TR YV+  YV +PNV    Y +FFQNCR  GV FD+ R +GT+FLLADSLTAGV 
Sbjct  1037  ---GATRCYVVCSYVFHPNVTATQYTTFFQNCRLHGVCFDVSRALGTLFLLADSLTAGVF  1093

Query  1085  GIMCISDTRKNALLSCRAAMEAIAASAG-TKSSISKSNHSM  1124
             GI+ I +T ++AL   R A+E I   AG TK  +S S+ S+
Sbjct  1094  GILSIGETAQDALSYLRTALEVIGREAGATKGIVSSSSRSV  1134

>PITG_18457
Length=1170

 Score = 568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/1169 (33%), Positives = 623/1169 (53%), Gaps = 112/1169 (10%)

Query  26    MEQVEQKYHKEDVGRILLQTQQELRDIRAEISARKQAGISHVVDAHPHREDHASLANENQ  85
             M++V+Q++H EDVGR+LLQTQ++LR +R +++A      +   +A P R  H ++     
Sbjct  1     MDKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAA---AVEANASPMR--HNAIVT---  52

Query  86    SKDLETLHDILDRAEREIQAKVDLMFRGAANFG-----QMMQTG--LPAVT--SPPRQVS  136
             + +++  + IL + E E++AK +L+  G  N          Q+G  LPAVT  + P   S
Sbjct  53    TAEVQAFNAILQQTETELRAKAELVLNGMVNSSSSARNNQAQSGTLLPAVTVAAAP---S  109

Query  137   TTTKSLSDQIFSTQESKVDGTRKQLTAAKDDYKCSPSMQQSELISPKRPTQGLLTSKASK  196
                +S  D+  + +  ++D +   +   ++ ++ +    +  L  P     G+   +  +
Sbjct  110   IMHRSGYDK--ANKPRQMDASSIPVEFFREQFRNNSVEIRQSLPEPWERHFGIHHGRLMR  167

Query  197   KRYNVSLKSLPAVQNGHastsssaladqssE-------TAHFLNSRHGSPLNSIEISQST  249
             K+     + LP+V     S  +  L ++ ++       T  FL +           S  +
Sbjct  168   KKTTQHCRLLPSVNKTDPSVPTPELREEDAKHGVLNLVTRGFLPAYADLTPVFSGTSDGS  227

Query  250   YDRALMQRTAQLHNRLEEPIRTTPCTSTISHDITSLKFDFSAPT----------------  293
                 + QR  +++NR E+ +R+TP T +  +++ SLKFD  AP                 
Sbjct  228   GGGVMKQRATRIYNRSEQVVRSTPFTQSTGYNLASLKFDLRAPPTPPPVVPEATFPDSTT  287

Query  294   ---------ILQSPGKVQIHEQVTH--------FNDQALGECNCRLSTNQVSMALINGFR  336
                       LQ P        ++          +  +L        TNQ      N  R
Sbjct  288   RRRSTRRSSALQGPNPFTRSVPISSSKIKNGRSAHPTSLMSAAVAAFTNQGEDTENNRDR  347

Query  337   EDNSKLSPSRDHSKKMGIPKVIKSTKINTDTESHKGNNS-----SNHDFTIHQGIVDRRR  391
               +  +S     S +    +  +  K+  + +  +G N      S H F IH+G   R  
Sbjct  348   FSDDDISDEEQESDENDKDEYAEMEKLGANVDKIRGYNELLDVYSLHQFLIHKGRTMRDT  407

Query  392   SDFKSFQCFANDVWNNVEEVVTTLERLLSVYFIPIAHINGQRILTLSQENNKIITNRDLL  451
              +F SF+    ++W +VEE +  LE LL+ YF+P+A+++GQR+L L+       + R+LL
Sbjct  408   PEFVSFRRVTQELWGSVEEALRALETLLAQYFVPLAYVDGQRLLALAGTGQPRFSKRELL  467

Query  452   SCVKNEHEVRMLLLKPGQRFQGVEKCTRAAMAVQSFMRMITFRRTYLLMISNHRKVRAIQ  511
             SC+ NE +V  +L +PGQR++G ++  RAA  +++ +RM   RR Y    ++      IQ
Sbjct  468   SCIVNEDQVMSVLRRPGQRYKGRDRKRRAATTIEACVRMWLVRRRYARTRASDFNASKIQ  527

Query  512   QNWRRYAAYKATKIKIEAIRERQDIVFNEIMRSFCSNWDKIRTQRRTVMHIPSISIDPRH  571
               WR Y+ + + K ++  +   +   + + M +  S+W +I  +RR V+H+PS+S+D   
Sbjct  528   LAWRAYSCHTSLKARLREVHLEKLEKWEKRMHNLKSHWPQIAGRRRVVVHVPSLSLDEHS  587

Query  572   RMKTEQFSIQQNLQLQRLCAL-IDENVELI-YICPFELTDDIVQYYMKLLQLAGISDAAA  629
             R+  E F+IQQNLQL R+CA  +D NVEL+ Y+ PFELT D+ QY++KLLQL G+ D+  
Sbjct  588   RLGAENFAIQQNLQLTRVCAAALDSNVELLLYVSPFELTSDVSQYFLKLLQLGGLVDSRP  647

Query  630   RIKLMCPENASRFPSHFSLSNVVLCSPHTMKRLSRYIRGRNAYLVPGFPGTEDKRLAALL  689
             R+KL+ PE  +RFP+HFSLS+++L SPH ++R+  Y  G+ AYLV G PG ED+RLA  L
Sbjct  648   RVKLVFPEQTTRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAMAL  707

Query  690   RIPILGLDPAKFFQMTTHSGIKRCFKKTNANTLPGSIDLYDENELIFSLAKLIAANPHQS  749
              +PILG  PA+   + T SG KR   + + N   G+ +LYDE+E+  +LAKL  A+  Q 
Sbjct  708   DLPILGAPPAQALPLLTRSGGKRLLIRADVNVPNGTYELYDEHEVCAALAKLAIAHMDQP  767

Query  750   SMVLKLDYDPFRTGTALVDISQLQSIQVLRLRTRTLDYWRQPPIQNKLIRNIVQEMQ--S  807
               ++KLDYDP   G A+VD+S +Q+++ LR   RT +YWRQP  ++   + I+ E++   
Sbjct  768   RWLIKLDYDPLDVGEAVVDLSNMQAMRELRREKRTPEYWRQPGPRDAAAKLILAELERPG  827

Query  808   IISSLVFMVNPEVYPSWKSFLQAIRMYGVVIEVCPKN-------------RQGYVRANLF  854
             +++ +   +  E++P W+ F+ A+  +G V+E  P                  YVRANLF
Sbjct  828   MLARIATPMQTEIFPKWREFIDAVGHFGCVVEAVPPTAIAASSEASTVLVEPAYVRANLF  887

Query  855   IEPSRRVCISSTQEFLSFENIHENDDRARKVVFDKAFAAKMRTIGFTFPQTLIDHEVLKS  914
             ++P   V ISSTQ  L+      N                 +T+ FTFPQT   +E +K 
Sbjct  888   VDPDGSVHISSTQNVLAAGGGGLN----------------RKTVAFTFPQTAAPYEAIKG  931

Query  915   ASLVIGQALAKDGICGYISVDFLVILDDQTQNKI-LYAMALQPFLTNsaasfslfqflsR  973
             A    G+ L +  + GY+S+DF+V  D+++ +   L+A+A+ PFLT+SA SF+ F  L+R
Sbjct  932   ACNAAGKLLVETNVWGYVSLDFVVFQDEKSNDAPRLWALAVHPFLTDSATSFACFHLLAR  991

Query  974   GGGYNSKTGLFHLPRAITshgvtsdtpsssslsatDLMIREARL--SGIVSNELPLTPTR  1031
              G  ++ +G++ +  A  S    +    S S SATDL++REA L  S +V         R
Sbjct  992   -GVLDTNSGVYRV--ANKSLTTANSGRKSESGSATDLLLREALLAKSSLVGAR------R  1042

Query  1032  SYVLLEYVCNPNVATLSYGSFFQNCRSRGVYFDIERDIGTVFLLADSLTAGVLGIMCISD  1091
              +V   YV +P+V T+ Y +FF  CR  GV FD+ER +GT+FLLADSLTAGV GI+ I +
Sbjct  1043  CFVACSYVFHPHVITMQYTAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGILSIGE  1102

Query  1092  TRKNALLSCRAAMEAIAASAGTKSSISKS  1120
             T + AL   R A+E I   AG+  S++ S
Sbjct  1103  TTEGALAFLRTALEVIGREAGSTISVASS  1131

>PHYSO_321157
Length=1180

 Score = 562 bits (1448),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 308/794 (39%), Positives = 463/794 (58%), Gaps = 60/794 (8%)

Query  376   SNHDFTIHQGIVDRRRSDFKSFQCFANDVWNNVEEVVTTLERLLSVYFIPIAHINGQRIL  435
             S H F IH+G   R   +F SF+  A ++W +VEE +  LE LL+ YF+P+A+ +GQR+L
Sbjct  402   SLHQFLIHKGRTMRDTPEFVSFRRVAQELWGSVEEALRALETLLTQYFVPLAYADGQRLL  461

Query  436   TLSQENNKIITNRDLLSCVKNEHEVRMLLLKPGQRFQGVEKCTRAAMAVQSFMRMITFRR  495
             +L+       + R+LLSC+ NE +V  +L +PGQR++G ++  RAA  +Q+ +RM + RR
Sbjct  462   SLASTGQPRFSKRELLSCIVNEEQVMAVLRRPGQRYKGRDRKRRAATTIQACVRMWSIRR  521

Query  496   TYLLMISNHRKVRAIQQNWRRYAAYKATKIKIEAIRERQDIVFNEIMRSFCSNWDKIRTQ  555
              Y+   ++      IQ  WR ++ + A K ++  +R  Q   +   M    + W +I  +
Sbjct  522   RYVRSRASDFSATKIQLAWRAFSCHAALKARLRELRREQLDNWEAKMNDLKTQWHQIAGR  581

Query  556   RRTVMHIPSISIDPRHRMKTEQFSIQQNLQLQRLCAL-IDENVEL-IYICPFELTDDIVQ  613
             RR V+H+PS+S+D   R+  E F++QQNLQL R+CA  +D NV+L +Y+ PFELT D+  
Sbjct  582   RRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSNVDLLVYVAPFELTADVSH  641

Query  614   YYMKLLQLAGISDAAARIKLMCPENASRFPSHFSLSNVVLCSPHTMKRLSRYIRGRNAYL  673
             Y++KLLQL G++D+  R+KL+ PE A+RFP+HFSLS+V+L SPH ++R+  Y  G++AYL
Sbjct  642   YFLKLLQLGGLADSRPRVKLVFPEQAARFPAHFSLSSVLLYSPHCLRRIRHYTAGKDAYL  701

Query  674   VPGFPGTEDKRLAALLRIPILGLDPAKFFQMTTHSGIKRCFKKTNANTLPGSIDLYDENE  733
             V G PGTED+RLA  L +PILG  P +   + T SG KR   + + N   G+ +LYDE+E
Sbjct  702   VMGLPGTEDQRLAIALDLPILGAPPPQALPLLTRSGGKRLLIRADVNVPTGTYELYDEHE  761

Query  734   LIFSLAKLIAANPHQSSMVLKLDYDPFRTGTALVDISQLQSIQVLRLRTRTLDYWRQPPI  793
             L  +LAKL  A+  Q   +LKLDYDP   G A+VD+S +Q+++ LR   +T +YWRQP  
Sbjct  762   LFAALAKLAVAHMDQPRWLLKLDYDPLGVGEAVVDLSGMQAMRELRREKKTPEYWRQPGP  821

Query  794   QNKLIRNIVQEMQ--SIISSLVFMVNPEVYPSWKSFLQAIRMYGVVIEVCPKN-------  844
             ++   + ++ E++   +++ L   ++ E++PSW+ + +AI  +G V+E  P         
Sbjct  822   RDAASKLVLAELERPGVLARLATPMHTEIFPSWREYTEAISHFGCVVEAVPPTSFVASPE  881

Query  845   ------RQGYVRANLFIEPSRRVCISSTQEFLSFENIHENDDRARKVVFDKAFAAKMRTI  898
                      YVRANLFI+P   V I+STQ  L+                        +T+
Sbjct  882   TASSSVEPAYVRANLFIDPDGTVHITSTQNVLA-----------------SGGGLNRKTV  924

Query  899   GFTFPQTLIDHEVLKSASLVIGQALAKDGICGYISVDFLVILDDQTQNKI-LYAMALQPF  957
              FTFPQT+  HE +K A    G+ L +  + GY+S+DF+V  DD++     L+A+A+ PF
Sbjct  925   AFTFPQTVAPHEAVKGACTAAGKLLVETNVWGYVSLDFVVFQDDKSGGAPRLWALAVHPF  984

Query  958   LTNsaasfslfqflsRG------GGYNSKTGLFHLPRAITshgvtsdtpsssslsatDLM  1011
             LT+SAASF+ F  L+RG      GGY           A  S     ++  S     TDL+
Sbjct  985   LTDSAASFACFHLLARGVLDASSGGYRMA--------AANSTLAAVNSGRSGGGGTTDLL  1036

Query  1012  IREARLSGIVSNELPLTPTRSYVLLEYVCNPNVATLSYGSFFQNCRSRGVYFDIERDIGT  1071
             +REA L+       P    R YV+  YV +P+V T+ Y +FF  CR  GV FD+ER +GT
Sbjct  1037  LREASLAKGAQAGTP----RCYVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGT  1092

Query  1072  VFLLADSLTAGVLGIMCISDTRKNALLSCRAAMEAIAASAGTKSSISKSNHSMNDLMRAD  1131
             +FLL DSLTAGV G++ + +T   AL   R A+E I   AG    ++ S        R  
Sbjct  1093  LFLLTDSLTAGVFGVLSVGETTDGALAFMRTALEVIGREAGATVEMATSPS------RPG  1146

Query  1132  STRD-RFSEILRAL  1144
             S R   F+++L A+
Sbjct  1147  SARSGNFAQVLSAV  1160

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 68/116 (59%), Gaps = 17/116 (15%)

Query  26   MEQVEQKYHKEDVGRILLQTQQELRDIRAEISARKQAGISHVVDAHPHREDHASLANENQ  85
            ME+V+Q++H EDVGR+LLQTQ++LR +R +++A      +   +A P R  H+++     
Sbjct  1    MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAA---AVEANASPMR--HSAVVT---  52

Query  86   SKDLETLHDILDRAEREIQAKVDLMFRG-------AANFGQMMQTGLPAVT--SPP  132
            + +++  + IL + E E++AK +L+  G       A N      T LPAVT  +PP
Sbjct  53   TAEVQAFNAILQQTEAELRAKAELVLNGMVNSSSSAQNNQSQSGTLLPAVTVAAPP  108

 Score = 36.6 bits (83),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 24/36 (67%), Gaps = 0/36 (0%)

Query  254  LMQRTAQLHNRLEEPIRTTPCTSTISHDITSLKFDF  289
            + QR  ++H+R E+ +R TP T +  +++ +LKFD 
Sbjct  238  MKQRATRIHDRSEQSVRPTPFTQSTGYNLAALKFDL  273

>SDRG_01764
Length=1092

 Score = 556 bits (1432),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 371/1130 (33%), Positives = 588/1130 (52%), Gaps = 114/1130 (10%)

Query  26    MEQVEQKYHKEDVGRILLQTQQELRDIRAEISARKQAGISHVVDAHPHREDHASLANENQ  85
             M+++ Q+YH EDVGRILLQ Q ELR++R ++                       L + N 
Sbjct  1     MDRLAQQYHVEDVGRILLQAQDELRNMREQV-----------------------LTSNN-  36

Query  86    SKDLETLHDILDRAEREIQAKVDLMFRGAANFGQMMQTGLPAVTSPPRQVSTTTKSLSDQ  145
               D++ L  IL+RAE ++++K +++  G  N    M+T LP + +P     + +K  S  
Sbjct  37    -IDIDALQAILERAELDLRSKAEIVLNGVVN--NTMKT-LPVIEAPGGGQPSVSKFSSK-  91

Query  146   IFSTQESKVDGTRKQLTAAKDDYKCSPS------MQQSELISP--------KRPT-QGLL  190
               + Q    D   +    + DD++   S       Q  + + P        KRP  + + 
Sbjct  92    -LAKQRELADAMARD--GSLDDHRTRSSPVERLRQQLGQPVVPVERDRPPGKRPIGRTMQ  148

Query  191   TSKASKKRYNVSLKSLPAVQNGHastsssaladqssETAHFLNSRHGSPLNSIEISQS-T  249
               +  KK+     + LP V           L D  ++         G    S ++S + T
Sbjct  149   VGRLIKKKVTGPQRLLPKVNRIDPLAPVPDLEDDDAKRGVLNLVNRGFIPTSADLSLAFT  208

Query  250   YDRALMQRTA-QLHNRLEEPIRTTPCTSTISHDITSLKFDFSAPTILQSPGKVQIHEQVT  308
             +   ++Q +  +L++R E+P+++ P  ++ S ++ SLK D +              E   
Sbjct  209   HGDGIIQNSKLRLYDRSEQPVKSQPYMNSSSFNVASLKLDLAP----------PPTEPDP  258

Query  309   HFNDQALGECNCRLSTNQVSMALINGFREDNSKLSPSRDHSKKMG-IPKVIKSTKINTDT  367
                 +     N + +   V +       +D   + P  D +   G I       ++  + 
Sbjct  259   TPLTRLAVARNKKSAVATVQLTFPGA--KDEGDVVPVEDPTTDDGPIEPTDTIDELRNNV  316

Query  368   ESHKGNNSSNHDFTIHQGIVDRRRS-----DFKSFQCFANDVWNNVEEVVTTLERLLSVY  422
             E  +G N     +++HQ I+ + ++     +F SF+    D+W +V   +  LE LL  Y
Sbjct  317   EKIRGYNDLLDTYSLHQFIIRKGQTLAETPEFISFKRITEDLWGSVSMAIRELETLLINY  376

Query  423   FIPIAHINGQRILTLSQENNKIITNRDLLSCVKNEHEVRMLLLKPGQRFQGVEKCTRAAM  482
              +P+A+I+GQ++L ++  +    +  +LL+CV N  EV   + +PGQRF+G +    AA+
Sbjct  377   SVPLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGEDSRHAAAI  436

Query  483   AVQSFMRMITFRRTYLLMISNHRKVRAIQQNWRRYAAYKATKIKIEAIRERQDIVFNEIM  542
              +QS  RM   RR  L     H     IQ+ +R Y + K  ++K+   RE     +   M
Sbjct  437   LLQSVYRMHLTRRR-LRQHHGHSYASHIQRVYRTYKSVKEIQVKLRLAREADARTWETQM  495

Query  543   RSFCSNWDKIRTQRRTVMHIPSISIDPRHRMKTEQFSIQQNLQLQRLCALIDENVELIYI  602
              +F +NWDKI+ QRR V+H+PS S + R R+  + F+I+QNLQ+ RLCA+ D NV++IYI
Sbjct  496   TAFHANWDKIKMQRRVVVHVPSFSAEERTRLNMDNFAIRQNLQMARLCAIADPNVDVIYI  555

Query  603   CPFELTDDIVQYYMKLLQLAGISDAAARIKLMCPENASRFPSHFSLSNVVLCSPHTMKRL  662
              PFEL+ DI +Y M+LLQL G++D  +R++++ PENA RFP HFSL+ ++L SPH +K++
Sbjct  556   SPFELSADIQKYMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLATILLYSPHCLKKI  615

Query  663   SRYIRGRNAYLVPGFPGTEDKRLAALLRIPILGLDPAKFFQMTTHSGIKRCFKKTNANTL  722
              RY+RG+ AY+V G  G EDKRLA  L++P+LG+DP +     T SG KR F + + N  
Sbjct  616   KRYVRGKEAYIVAGTVGPEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKRLFTQADVNIP  675

Query  723   PGSIDLYDENELIFSLAKLIAANPHQSSMVLKLDYDPFRTGTALVDISQLQSIQVLRLRT  782
              G+ D+YDE+ELI SLAKL AAN HQ   ++KLD DP  TG A +D+  L+ +  +R   
Sbjct  676   FGAHDIYDEDELILSLAKLTAANLHQGMWLIKLDADPSDTGLASIDMHALECVNKVRTEK  735

Query  783   RTL---DYWRQPPIQNKLIRNIVQEMQSIISSLVFMVNPEVYPSWKSFLQAIRMYGVVIE  839
             R +   +Y+ QP I+  ++R IV E+      L+    P+VYP+W+     +   G VIE
Sbjct  736   RAMKNDEYYSQPNIKEGIVRAIVAELSEQFHRLISPCFPDVYPTWQHMRPVVNRIGAVIE  795

Query  840   VCPKNRQGYVRANLFIEPSRRVCISSTQE-FLSFENIHENDDRARKVVFDKAFAAKMRTI  898
               P      VRAN+FIEPS  V ++S QE  +  +N H+                   ++
Sbjct  796   AYPPKVLARVRANVFIEPSGGVHLTSAQEQLMQAKNKHQ-------------------SV  836

Query  899   GFTFPQTLIDHEVLKSASLVIGQALAKDGICGYISVDFLVILDDQTQNKI-------LYA  951
             G  +P T + +  ++ ASL + QA+   GI GY S+D++  LD +T N         L+A
Sbjct  837   GAVYPSTTVPYAAIRGASLAVAQAMYASGIIGYASIDYVAFLDVKTVNGKAGPPHLRLWA  896

Query  952   MALQPFLTNsaasfslfqflsRGGGYNSKTGLFHLPRAITshgvtsdtpsssslsatDLM  1011
             + L P LT +A SF LF FLS     ++ TG   LP+               S +   L 
Sbjct  897   LQLLPCLTPTAMSFVLFTFLS-CATLDAATGRSFLPQP----------APHPSPATGQLP  945

Query  1012  IREARLS-GIVSNELP----LTPTRSYVLLEYVCNPNVATLSYGSFFQNCRSRGVYFDIE  1066
             + E +L+   + +E P    + P R+Y+  EY+ +PN+ATL Y  FF  CR  GV FD++
Sbjct  946   VTETQLAVEKILSESPRSSNVGPERAYIAHEYIFHPNMATLQYAVFFNMCRVHGVSFDLQ  1005

Query  1067  RDIGTVFLLADSLTAGVLGIMCISDTRKNALLSCRAAMEAIAASAGTKSS  1116
             + IG  F+LADSLTAGV+G++CI ++ K A+   RAA+E I    G + +
Sbjct  1006  KSIGAAFVLADSLTAGVVGLLCIGESDKEAVRLTRAALELIGDQVGVQPA  1055

>SPRG_06354
Length=884

 Score = 531 bits (1367),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 311/874 (36%), Positives = 486/874 (56%), Gaps = 55/874 (6%)

Query  260   QLHNRLEEPIRTTPCTSTISHDITSLKFDFSAPTILQSPGKVQIHEQVTHFNDQALGECN  319
             +L++R E+P+++ P  ++   ++ SLK D + P     P      + V         +  
Sbjct  7     RLYDRSEQPVKSQPYMNSSGFNVASLKLDLAPPPT--EP------DAVPPTRPAVARKRK  58

Query  320   CRLSTNQVSMALINGFREDNSKLSPSRDHSKKMG-IPKVIKSTKINTDTESHKGNNSSNH  378
               ++T Q+S     G +++     P  D +   G I       ++  + E  +G N    
Sbjct  59    STVATVQLSFP---GAKDELVDAVPVEDPATDDGPIEPTDTIDELRNNVEKIRGYNDLLD  115

Query  379   DFTIHQGIVDRRRS-----DFKSFQCFANDVWNNVEEVVTTLERLLSVYFIPIAHINGQR  433
              +++HQ I+ + ++     +F SF+    D+W +V   +  LE LL  Y +P+A+I+GQ+
Sbjct  116   TYSLHQFIIRKGQTLSETPEFISFKRITEDLWGSVSMAIRELETLLVHYSVPLAYIDGQK  175

Query  434   ILTLSQENNKIITNRDLLSCVKNEHEVRMLLLKPGQRFQGVEKCTRAAMAVQSFMRMITF  493
             +L ++  +    +  +LL+CV N  EV   + +PGQRF+G +    AA+ +QS  RM   
Sbjct  176   LLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGGDGRHAAAIVIQSVYRMHRT  235

Query  494   RRTYLLMISNHRKVRAIQQNWRRYAAYKATKIKIEAIRERQDIVFNEIMRSFCSNWDKIR  553
             RR  L     H     IQ+ +R Y   K  ++K+   RE     +   M +F +NWDKI+
Sbjct  236   RR-LLRQHHGHSYATHIQRVYRTYKCVKDIQVKLRLAREADARTWETQMTTFHANWDKIK  294

Query  554   TQRRTVMHIPSISIDPRHRMKTEQFSIQQNLQLQRLCALIDENVELIYICPFELTDDIVQ  613
              QRR V+H+PS S + R R+  + F+I+QNLQ+ RLCA+ D NV++IYI PFEL+ DI +
Sbjct  295   MQRRVVVHVPSFSAEERARLNMDNFAIRQNLQMARLCAIADPNVDVIYISPFELSVDIQK  354

Query  614   YYMKLLQLAGISDAAARIKLMCPENASRFPSHFSLSNVVLCSPHTMKRLSRYIRGRNAYL  673
             Y M+LLQL G++D  +R++++ PENA RFP HFSL+ ++L SPH +K++ RY+RG+ AY+
Sbjct  355   YMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLATILLYSPHCLKKIKRYVRGKEAYI  414

Query  674   VPGFPGTEDKRLAALLRIPILGLDPAKFFQMTTHSGIKRCFKKTNANTLPGSIDLYDENE  733
             V G  G EDKRLA  L++P+LG+DP +     T SG KR F + + N   G+ D+YDE+E
Sbjct  415   VAGTVGPEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKRLFTQADVNIPYGAHDIYDEDE  474

Query  734   LIFSLAKLIAANPHQSSMVLKLDYDPFRTGTALVDISQLQSIQVLRLRTRTL---DYWRQ  790
             LI SLAKL AAN HQ   ++KLD DP  TG A +D+  L+ +  +R   R +   +Y+ Q
Sbjct  475   LILSLAKLTAANLHQGMWLIKLDADPSDTGLAAIDMHALECVNKVRAEKRAMKNDEYYSQ  534

Query  791   PPIQNKLIRNIVQEMQSIISSLVFMVNPEVYPSWKSFLQAIRMYGVVIEVCPKNRQGYVR  850
             P I+  ++R IV E+      L+    P+VYP+W+     +   G VIE  P      VR
Sbjct  535   PNIKEGIVRAIVAELSEQFHRLISPCFPDVYPTWQHMRPVVNRIGAVIEAYPPKVLARVR  594

Query  851   ANLFIEPSRRVCISSTQE-FLSFENIHENDDRARKVVFDKAFAAKMRTIGFTFPQTLIDH  909
             AN+FIEPS  V ++S QE  +  +N H+                   ++G  +P T + +
Sbjct  595   ANVFIEPSGGVHVTSAQEQLMHVKNKHQ-------------------SVGAVYPPTAVPY  635

Query  910   EVLKSASLVIGQALAKDGICGYISVDFLVILDDQTQNKI-------LYAMALQPFLTNsa  962
               ++ ASL + QA+   GI GY S+D++  LD +T N         L+A+ L P LT +A
Sbjct  636   AAIRGASLAVAQAMYASGIIGYASIDYVAFLDVKTVNGKAGPPHLRLWALQLLPCLTPTA  695

Query  963   asfslfqflsRGGGYNSKTGLFHLPRAITshgvtsdtpsssslsatDLMIREARLSGIVS  1022
              SF LF FLS     ++ TG   LP         +  P++ +  A + ++ E+  +  + 
Sbjct  696   MSFVLFTFLS-CATLDAATGRSFLPLPAPRPSSLAGPPATETQLAVEKILGESSPAATMG  754

Query  1023  NELPLTPTRSYVLLEYVCNPNVATLSYGSFFQNCRSRGVYFDIERDIGTVFLLADSLTAG  1082
              E      R+Y+  EY+ +PN+ATL Y  FF  CR  GV FD+++ IG  F+LADSLTAG
Sbjct  755   AE------RAYIAHEYIFHPNMATLQYAVFFNMCRVHGVSFDLQKSIGAAFVLADSLTAG  808

Query  1083  VLGIMCISDTRKNALLSCRAAMEAIAASAGTKSS  1116
             V+G++CI ++ K A+   RAA+E I    G + +
Sbjct  809   VVGLLCIGESDKEAVRLTRAALELIGDQVGVQPA  842

>H257_06305
Length=1099

 Score = 536 bits (1381),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 360/1135 (32%), Positives = 596/1135 (53%), Gaps = 119/1135 (10%)

Query  26    MEQVEQKYHKEDVGRILLQTQQELRDIRAEISARKQAGISHVVDAHPHREDHASLANENQ  85
             M+++ Q+YH EDVGRILLQ Q ELR +R ++                         NE  
Sbjct  1     MDKLCQQYHAEDVGRILLQAQDELRSMREKV-------------------------NEKN  35

Query  86    SKDLETLHDILDRAEREIQAKVDLMFRGAANFGQMMQTGLPAVTSPPRQVSTTTKSLSDQ  145
             + D+  ++ IL+RAE +++AK +++  G  N    M   LPA+ +P  + S +       
Sbjct  36    NVDVNEINAILERAEADLRAKAEIVLNGVVNNSMKM---LPAIEAPGGKTSLSK------  86

Query  146   IFSTQESKVDGTRKQLTAAKDDYKCSPSMQQSE-------LISP--------KRPTQGLL  190
              FS++ ++       +T        SP+ +Q +        I P        +RP   ++
Sbjct  87    -FSSKLAQKRELAATMTRDSSYEPASPTYRQEDREPRFGGPIEPMERDRAPGRRPVGRII  145

Query  191   TSKA-SKKRYNVSLKSLPAVQNGHastsssaladqssETA-HFLNSRHGSPLNSIEISQS  248
              + +  KK+     + LP +     +  S  L ++ +    H L +R   P  S++++ +
Sbjct  146   KAGSLVKKKTTKPHRLLPKMNRTDPTAPSPDLVEEDARGGVHNLVTRGFLP-PSVDVTPA  204

Query  249   -TYDRALMQRT-AQLHNRLEEPIRTTPCTSTISHDITSLKFDFSAPTILQSPGKVQIHEQ  306
              T+  +++Q +  ++++R  +P+++ P T+    ++ SLKFD S      +P  V     
Sbjct  205   FTHGTSVIQNSRVKIYDRASQPVKSMPYTNPSGFNMASLKFDMSTTPATSTPSPVAAVVS  264

Query  307   VTHFNDQALGECNCRLSTNQVSMALINGFREDNSKLSPSRDHSKKMGIPKVIKSTKINTD  366
                 +   +   +        S   +     +  K   +       G    I + + N  
Sbjct  265   GGDVSKMVVTPIDISFDAPSSSHPPV-----EQPKGGATGGDDTNGGDSSTIHNLRRNV-  318

Query  367   TESHKGNNSSNHDFTIHQGIVDRRRS-----DFKSFQCFANDVWNNVEEVVTTLERLLSV  421
              E  +G N     +++HQ I+ + ++     +F SFQ    D+W +V   +  LE +L+ 
Sbjct  319   -EKIRGYNELLDTYSLHQFIIRKGKTLSDTPEFISFQRTTEDLWGSVSTSIQELETMLTS  377

Query  422   YFIPIAHINGQRILTLSQENNKIITNRDLLSCVKNEHEVRMLLLKPGQRFQGVEKCTRAA  481
             Y +P+A+++GQ+++ ++  +       +LLSC+ N  EV  L+ +PGQR++G +    A 
Sbjct  378   YSVPLAYVDGQKLMKIAAMDATTRGTTELLSCILNMDEVSSLMRRPGQRYKGSQGPDLAV  437

Query  482   MAVQSFMRMITFRRTYLLMISNH---RKVRAIQQNWRRYAAYKATKIKIEAIRERQDIVF  538
             + +QS  RM   ++     + NH        IQ+ +R Y  +   + +++ +RE    ++
Sbjct  438   VLIQSVWRMFLTKKR----LKNHHGNEDAAVIQRIYRSYRCFSQLQQRLKLVREADLRIW  493

Query  539   NEIMRSFCSNWDKIRTQRRTVMHIPSISIDPRHRMKTEQFSIQQNLQLQRLCALIDENVE  598
             +  M+ F +NWD ++ QRR V+H+PS + D R R+K + FSI+QNLQ+ R+CA+ D NV+
Sbjct  494   DAQMQRFRANWDTMKMQRRVVVHVPSFASDDRTRLKMDNFSIRQNLQMARMCAIADPNVD  553

Query  599   LIYICPFELTDDIVQYYMKLLQLAGISDAAARIKLMCPENASRFPSHFSLSNVVLCSPHT  658
             +IYI PFEL+ DI +Y ++LLQL GI+D   RI+++ PEN  RFP HFSL+ ++L SPH 
Sbjct  554   IIYISPFELSPDIQRYQVRLLQLGGITDPQTRIRMLHPENVDRFPEHFSLTTLLLYSPHC  613

Query  659   MKRLSRYIRGRNAYLVPGFPGTEDKRLAALLRIPILGLDPAKFFQMTTHSGIKRCFKKTN  718
             +K++ R++RG+NAY+V G  G EDKRLA  L+IP+LG+DP K     T SG KR F   +
Sbjct  614   LKKIKRFVRGKNAYIVTGNVGPEDKRLAIALQIPLLGMDPDKALLYGTRSGGKRIFMAAD  673

Query  719   ANTLPGSIDLYDENELIFSLAKLIAANPHQSSMVLKLDYDPFRTGTALVDISQLQSIQVL  778
              N   G+ D+YDE+ELI SL+KLIAA+  Q+  ++K+D D   TG A +++ Q+QS+  +
Sbjct  674   VNIPMGAHDIYDEDELIQSLSKLIAADVDQNEWLVKIDADQSDTGIASINVQQMQSVAKV  733

Query  779   RLRTRTL-----DYWRQPPIQNKLIRNIVQEM-QSIISSLVFMVNPEVYPSWKSFLQAIR  832
             R   R +     +Y++QP +++ ++R+I  E+ +S  ++ +    P+VY SW        
Sbjct  734   RAEKRDMKHMAAEYFQQPDVRDAVLRSIFNELTESYFAANITPCFPDVYASWAELRPVAL  793

Query  833   MYGVVIEVCPKNRQGYVRANLFIEPSRRVCISSTQE-FLSFENIHENDDRARKVVFDKAF  891
               GVVIE  P      VRAN+FIEPS  V I+S  + F+S  N H               
Sbjct  794   RVGVVIEAYPSKVLSQVRANVFIEPSGGVHITSAHDLFMSPANKHLPQ------------  841

Query  892   AAKMRTIGFTFPQTLIDHEVLKSASLVIGQALAKDGICGYISVDFLVILDDQT------Q  945
                       FPQT + ++ ++ ASL I  ++   GI GY S+D++   D +T       
Sbjct  842   -------CALFPQTSVPYQAIRGASLAIASSMFIKGIIGYASIDYMSFADPKTLVGGGRP  894

Query  946   NKILYAMALQPFLTNsaasfslfqflsRGGGYNSKTGLFHLPRAITshgvtsdtpssssl  1005
              + L+AM + P LTN+A SF +F FLS    +N  TG  HL        V +  P ++S 
Sbjct  895   RQRLWAMQVVPGLTNTAVSFVMFAFLS-CSQFNPITGKCHL-------QVAAPPPIAASA  946

Query  1006  satDLMIREARLSGIVSNELP-----LTPTRSYVLLEYVCNPNVATLSYGSFFQNCRSRG  1060
             +   +   +  +  I+S   P       P R+Y++L+Y+ +PN+ATL + +FF  CR  G
Sbjct  947   TVAPITQAQKAVETILSARPPNGAVVCGPERTYMVLDYIYHPNMATLHFSTFFNTCRLNG  1006

Query  1061  VYFDIERDIGTVFLLADSLTAGVLGIMCISDTRKNALLSCRAAMEAIAASAGTKS  1115
             V FD++R IG  F+LADSLTAGV+G+MCI +  K A    R A+E I    G ++
Sbjct  1007  VSFDLQRAIGAAFILADSLTAGVMGLMCIGENDKEAFRIARQAVELIGDQVGVQA  1061

>H310_09212
Length=1113

 Score = 532 bits (1371),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 374/1146 (33%), Positives = 603/1146 (53%), Gaps = 127/1146 (11%)

Query  26    MEQVEQKYHKEDVGRILLQTQQELRDIRAEISARKQAGISHVVDAHPHREDHASLANENQ  85
             ME++ Q+YH EDVGRILLQ Q ELR +R ++                         +EN 
Sbjct  1     MEKLCQQYHAEDVGRILLQAQDELRSMREKV-------------------------HENN  35

Query  86    SKDLETLHDILDRAEREIQAKVDLMFRGAANFGQMMQTGLPAVTSPP--RQVSTTTKSLS  143
             + D+  +H IL+RAE +++AK +++  G  N    M   LPA+ +P   R +S  +  L+
Sbjct  36    NLDVNQIHAILERAEADLRAKAEIVLNGVVNNSMKM---LPAIDAPGGQRYLSKFSSKLA  92

Query  144   DQ--IFSTQESKVDGTRKQLTAAKD-DYKCSPSMQQSELISP--------KRP------T  186
              +  + +T   +        T   D  Y+  PS+  S  I P        +RP       
Sbjct  93    QKRDLAATMARENTYEPGSPTYGHDTSYREHPSL--SGPIEPMERDRTPGRRPVGRIVKA  150

Query  187   QGLLTSKASKKRYNVSLKSLPAVQNGHastsssaladqssETA-HFLNSRHGSPLNSIEI  245
               L+  K +K R     + LP +     +    AL D  +    H L +R   P  S+++
Sbjct  151   GSLVKHKTTKPR-----RILPKMNRLDPTAPPPALLDDDARGGVHNLLTRGFLP-PSVDV  204

Query  246   SQS-TYDRALMQRT-AQLHNRLEEPIRTTPCTSTISHDITSLKFDFSAPT--------IL  295
             + + T+  +++Q T  ++++R  +P+++ P T+    ++ SLKFD   PT        I 
Sbjct  205   TPAFTHGTSVIQNTRVKIYDRASQPVKSMPYTNPSGFNMASLKFDMVTPTPPTVANVPIN  264

Query  296   QS----PGKVQIHEQV-THFNDQALGECNCRLSTNQVSMALINGFREDNSKLSPSRDHSK  350
             Q     P K  I   +   F+  A      R    +       G  + + K   S D   
Sbjct  265   QGGDIPPSKTSIPTPIDITFDGHANNAVPFRPEQPK-------GGNDPSGKDCASADDGA  317

Query  351   KMGIPKVIKSTKINTDTESHKGNNSSNHDFTIHQGIVDRRRS-----DFKSFQCFANDVW  405
                    I + + N   E  +G N     +++HQ I+ + ++     +F SFQ    D+W
Sbjct  318   GGNDSTSIHNLRRNV--EKIRGYNELLDTYSLHQFIIRKGKTLADTPEFISFQRTTEDLW  375

Query  406   NNVEEVVTTLERLLSVYFIPIAHINGQRILTLSQENNKIITNRDLLSCVKNEHEVRMLLL  465
              +V + +  LE +L+ Y +P+A+++GQ+++ ++  +       +LLSC+ N  EV  L+ 
Sbjct  376   GSVSKSIQELEAMLTNYSVPLAYVDGQKLMKIAAMDGTARGTMELLSCILNMDEVSSLMR  435

Query  466   KPGQRFQGVEKCTRAAMAVQSFMRM-ITFRRTYLLMISNH---RKVRAIQQNWRRYAAYK  521
             +PGQRF+G      AA+ +QS  RM IT +R     + NH        IQ+ +R Y  + 
Sbjct  436   RPGQRFKGKSGPDLAAVLLQSVWRMYITKKR-----LKNHHGNEDAAVIQRIYRSYRCFS  490

Query  522   ATKIKIEAIRERQDIVFNEIMRSFCSNWDKIRTQRRTVMHIPSISIDPRHRMKTEQFSIQ  581
               + +++++RE    +++  M+ F +NWD I+ QRR V+H+PS S + R R+K E FSIQ
Sbjct  491   QLQQRLKSVREADLRIWDAQMQRFRANWDSIKMQRRVVVHVPSFSSEERTRLKMENFSIQ  550

Query  582   QNLQLQRLCALIDENVELIYICPFELTDDIVQYYMKLLQLAGISDAAARIKLMCPENASR  641
             QNLQ+ R+CA+ D NV++IYI PFEL+ DI +Y ++LLQL GI+D   RI+++ PEN  R
Sbjct  551   QNLQMARMCAIADPNVDIIYISPFELSPDIQKYQVRLLQLGGIADPQTRIRMLHPENVDR  610

Query  642   FPSHFSLSNVVLCSPHTMKRLSRYIRGRNAYLVPGFPGTEDKRLAALLRIPILGLDPAKF  701
             FP HFSL+ V+L SPH +K++ R++RG++AY+V G  G EDKRLA  L++P+LG+DP K 
Sbjct  611   FPEHFSLTTVLLYSPHCLKKIKRFVRGKDAYIVTGNVGPEDKRLAIALQLPLLGMDPDKA  670

Query  702   FQMTTHSGIKRCFKKTNANTLPGSIDLYDENELIFSLAKLIAANPHQSSMVLKLDYDPFR  761
                 T SG KR F   + N   G+ D+YDE+ELI SL+KLIAA+  Q+  ++K+D D   
Sbjct  671   LLYGTRSGGKRIFMAADVNIPMGAHDIYDEDELIQSLSKLIAADIDQTEWLIKIDADQSN  730

Query  762   TGTALVDISQLQSIQVLRLRTRTL-----DYWRQPPIQNKLIRNIVQEM-QSIISSLVFM  815
             TG A +++ ++QS+   R   R +     +Y++QP +++ ++R++  E+ +S  ++ V  
Sbjct  731   TGIASLNVDKMQSVAKFRAEKREMKHGAAEYFQQPDVRDAVLRSVYSELNESYFAANVTP  790

Query  816   VNPEVYPSWKSFLQAIRMYGVVIEVCPKNRQGYVRANLFIEPSRRVCISSTQE-FLSFEN  874
               PE+Y SW +        GVVIE  P     +VR N+FIEPS  V I+S  + F+   N
Sbjct  791   CFPEMYASWAAMRPIALRVGVVIEAYPSKVLSHVRTNIFIEPSGGVHITSAHDVFMCPVN  850

Query  875   IHENDDRARKVVFDKAFAAKMRTIGFTFPQTLIDHEVLKSASLVIGQALAKDGICGYISV  934
              H                         FPQ+ + ++ ++ ASL I  ++   GI GY S+
Sbjct  851   KHLPQ-------------------CAVFPQSSVPYQAIRGASLAIASSMFIKGIIGYASI  891

Query  935   DFLVILDDQTQ-----NKILYAMALQPFLTNsaasfslfqflsRGGGYNSKTGLFHLPRA  989
             D++   D +        + L+AM + P LTN+A SF +F FLS    +N  TG  HL  A
Sbjct  892   DYISFADPKAMVSGRPRQRLWAMQVVPGLTNTAVSFVMFAFLS-CSQFNPITGKSHLQVA  950

Query  990   ITshgvtsdtpsssslsatDLMIREARLSGIVSNELPLTPTRSYVLLEYVCNPNVATLSY  1049
                    S   +  + +  ++    +  S   +  +   P R+Y++L+Y+ +PN+ATL +
Sbjct  951   PAPVATLSTANAPITPTQQEIATILSPPSSAAAASV-CGPERTYMVLDYIYHPNMATLQF  1009

Query  1050  GSFFQNCRSRGVYFDIERDIGTVFLLADSLTAGVLGIMCISDTRKNALLSCRAAMEAIAA  1109
              +FF  CR  GV FD++R IG  ++LADSLTAGV+G++CI ++ K A    R A+E I  
Sbjct  1010  ATFFNTCRLHGVSFDLQRAIGAAYILADSLTAGVVGLICIGESDKEAFRIARQAVELIGD  1069

Query  1110  SAGTKS  1115
               G ++
Sbjct  1070  QVGVQA  1075

>PHYCA_34475
Length=692

 Score = 501 bits (1290),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 283/735 (39%), Positives = 423/735 (58%), Gaps = 73/735 (10%)

Query  376   SNHDFTIHQGIVDRRRSDFKSFQCFANDVWNNVEEVVTTLERLLSVYFIPIAHINGQRIL  435
             S H F IH+G   R   +F SF   A ++W +VEE +  LE LL+ YF+P+A+++GQR+L
Sbjct  11    SLHQFLIHKGRTMRDTPEFISFHRVAQELWGSVEEALRALETLLTHYFVPLAYVDGQRLL  70

Query  436   TLSQENNKIITNRDLLSCVKNEHEVRMLLLKPGQRFQGVEKCTRAAMAVQSFMRMITFRR  495
             +L+       + R+LLSC+ NE +V   L +PGQR++G ++  RAA  +Q+F+RM   RR
Sbjct  71    SLAATGQPRFSKRELLSCIVNEEQVMAALRRPGQRYKGRDRKRRAATTIQAFVRMWAARR  130

Query  496   TYLLMISNHRKVRAIQQNWRRYAAYKATKIKIEAIRERQDIVFNEIMRSFCSNWDKIRTQ  555
              Y    +       IQ  WR Y+ + A K ++  +R  Q   +   M    S W +I + 
Sbjct  131   RYARSRARDINATRIQLAWRAYSCHAALKARLREVRREQLEKWEARMHRLKSQWAQIASH  190

Query  556   RRTVMHIPSISIDPRHRMKTEQFSIQQNLQLQRLCAL-IDENVEL-IYICPFELTDDIVQ  613
             RR V+H+PS+S+D   R+  E  +++QNLQL R+CA  +D  V+L +Y+ PFELT D+ Q
Sbjct  191   RRVVVHVPSLSLDEYSRLSAENLAVRQNLQLTRICAAALDSRVDLLVYVSPFELTTDVSQ  250

Query  614   YYMKLLQLAGISDAAARIKLMCPENASRFPSHFSLSNVVLCSPHTMKRLSRYIRGRNAYL  673
             Y++KLLQL G++D+  R+KL+ PE A+RFP+HFSLS+++L SPH ++R+  Y  G+ AYL
Sbjct  251   YFIKLLQLGGLADSRPRVKLLFPEQATRFPAHFSLSSLLLYSPHCLRRIRHYTAGKEAYL  310

Query  674   VPGFPGTEDKRLAALLRIPILGLDPAKFFQMTTHSGIKRCFKKTNANTLPGSIDLYDENE  733
             V G PG ED+RLA  L +PILG  PA+   + T SG KR   + + N   G+ +LYDE+E
Sbjct  311   VMGLPGAEDQRLAMTLDLPILGAPPAQALPLLTRSGGKRLLIRADVNVPAGTYELYDEHE  370

Query  734   LIFSLAKLIAANPHQSSMVLKLDYDPFRTGTALVDISQLQSIQVLRLRTRTLDYWRQPPI  793
             L  +LAKL  A+  Q   + KLDYDP   G A+VD+S +Q+++ LR   RT +YWRQP  
Sbjct  371   LFSALAKLAVAHMDQPKWLFKLDYDPLGVGEAVVDLSGMQAMRELRREKRTPEYWRQPGP  430

Query  794   QNKLIRNIVQEMQ--SIISSLVFMVNPEVYPSWKSFLQAIRMYGVVIEVCPKN-------  844
             ++   + ++ E++    ++ L   V+ +++PSW  F +AI  +G VIE  P         
Sbjct  431   RDAAAKLVLTELERPGTLARLAMPVHKDIFPSWLEFAEAIGHFGCVIEAVPLTAIAVTPE  490

Query  845   ------RQGYVRANLFIEPSRRVCISSTQEFLSFENIHENDDRARKVVFDKAFAAKMRTI  898
                      Y+RANLF++P   V ++ST   L+      N                 RT+
Sbjct  491   TSTALLEPAYIRANLFVDPDGSVHVTSTLNMLATGGGGLNR----------------RTV  534

Query  899   GFTFPQTLIDHEVLKSASLVIGQALAKDGICGYISVDFLVILDDQTQNKI-LYAMALQPF  957
              FTFPQT   HE +K A    G+ L +  + GY+S+DF+V  DD++     L+A+A+ PF
Sbjct  535   AFTFPQTAAPHEAVKGACSAAGKLLVETNVWGYVSLDFVVFQDDKSNGAPRLWALAVHPF  594

Query  958   LTNsaasfslfqflsRGGGYNSKTGLFHLPRAITshgvtsdtpsssslsatDLMIREARL  1017
             LT+SAASF+ F  L+R G  ++ +G++ +  A T                          
Sbjct  595   LTDSAASFACFHLLAR-GVLDANSGVYRMAAAST--------------------------  627

Query  1018  SGIVSNELPLTPTRSYVLLEYVCNPNVATLSYGSFFQNCRSRGVYFDIERDIGTVFLLAD  1077
                          R +V+  YV +P+V T+ Y +FF  CR  GV FD+ER +GT+FLLAD
Sbjct  628   ------------PRCFVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLAD  675

Query  1078  SLTAGVLGIMCISDT  1092
             SLTAGV G++ I +T
Sbjct  676   SLTAGVFGVLSIGET  690

>PHYKE_8394
Length=428

 Score = 196 bits (498),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/219 (45%), Positives = 137/219 (63%), Gaps = 25/219 (11%)

Query  575  TEQFSIQQNLQLQRLCAL-IDENVEL-IYICPFELTDDIVQYYMKLLQLAGISDAAARIK  632
            TE F++QQNLQL R+CA  +D NV+L +Y+ PFELT D+ QY++KLLQL G++D+  R+K
Sbjct  177  TENFAVQQNLQLTRICAAALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVK  236

Query  633  LMCPENASRFPSHFSLSNVVLCSPHTMKRLSRYIRGRNAYLVPGFPGTEDKRLAALLRIP  692
            L+ PE A RFP+                       G++AYLV G PG ED+RLA  L +P
Sbjct  237  LVFPEQALRFPT-----------------------GKDAYLVMGLPGAEDQRLAIALDLP  273

Query  693  ILGLDPAKFFQMTTHSGIKRCFKKTNANTLPGSIDLYDENELIFSLAKLIAANPHQSSMV  752
            ILG  PA+   + T SG KR   + + N   G+ +LYD++EL  +LAKL   +  Q   +
Sbjct  274  ILGAPPAQALPLLTRSGGKRLLIRADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWL  333

Query  753  LKLDYDPFRTGTALVDISQLQSIQVLRLRTRTLDYWRQP  791
            LKLDYDP   G A++D+S +Q+++ LR   R  +YWRQP
Sbjct  334  LKLDYDPLGVGEAIIDLSGMQAMRELRREKRAPEYWRQP  372

 Score = 43.9 bits (102),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 62/116 (53%), Gaps = 31/116 (27%)

Query  26   MEQVEQKYHKEDVGRILLQTQQELRDIRAEISARKQAGISHVVDAHPHREDHASLANENQ  85
            ME+++Q++H EDVGR+LLQTQ++LR +R +++A  +   +   +A P R  H+++     
Sbjct  1    MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAE---AVEANASPMR--HSTV-----  50

Query  86   SKDLETLHDILDRAEREIQAKVDLMFRGAANFGQMMQ-------TGLPAVT--SPP  132
                        + E E++AK +L+  G  N     Q       T LPAVT  +PP
Sbjct  51   ------------KTEMELRAKAELVLNGMVNSSSNDQSNQNQHGTLLPAVTVGAPP  94

>PYAR_13581
Length=730

 Score = 194 bits (493),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 111/313 (35%), Positives = 171/313 (55%), Gaps = 34/313 (11%)

Query  363  INTDTESHKGNNS-----SNHDFTIHQGIVDRRRSDFKSFQCFANDVWNNVEEVVTTLER  417
            +  + E  +G N      S H F IH+G   R   +F+SF+    ++W  V+EV+  LE 
Sbjct  84   LRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFQSFKRVGQEIWGAVDEVIRALEA  143

Query  418  LLSVYFIPIAHINGQRILTLSQENNKIITNRDLLSCVKNEHEVRMLLLKPGQRFQGVEKC  477
            LL+ YF+                         LLSCV NE +V  LL +PGQR++G ++ 
Sbjct  144  LLTRYFM------------------ASFPTSVLLSCVVNEDQVASLLRRPGQRYKGKDRK  185

Query  478  TRAAMAVQSFMRMITFRRTYLLMISNHRKVRAIQQNWRRYAAYKATKIKIEAIRERQDIV  537
             RAA  +Q+F RM+  R  +  +         IQ  WR++AA ++ + ++   R  Q  V
Sbjct  186  RRAATTLQAFFRMLFHRNRFRRVCRRGASATRIQTTWRKFAAQQSLRRELTLRRAEQLRV  245

Query  538  FNEIMRSFCSNWDKIRTQRRTVMHIPSISIDPRHRMKTEQFSIQQNLQLQRLCALIDENV  597
            +   M    S W +I TQRR V+H+PS+S+D   R+  + F++QQNLQL RL A++D  V
Sbjct  246  WQLQMARLRSQWREISTQRRVVVHVPSLSLDEHARVSLDHFAVQQNLQLARLAAVVDATV  305

Query  598  E-LIYICPFELTDDIVQYYMKLLQLAGISDAAARIKLMCPENASRFPSHFSLSNVVLCSP  656
            E ++Y+ PFEL  D+           G+++AA R+K++ PE+A+ FP HFSL+  +L SP
Sbjct  306  EYVVYVSPFELPTDLSH---------GVANAAHRVKIVVPEHAATFPGHFSLATQLLYSP  356

Query  657  H-TMKRLSRYIRG  668
            H T+++L R  R 
Sbjct  357  HLTLEKLGRCSRA  369

 Score = 127 bits (318),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 92/315 (29%), Positives = 144/315 (46%), Gaps = 71/315 (23%)

Query  761   RTGTALVDISQLQSIQVLRLRTRTLDYWRQPPIQNKLIRNIVQEMQSIISSLVFMVNPEV  820
             R  TAL+D+S L +++ +R   +   YW+QP I++ + R ++QE++  I +L    + E 
Sbjct  385   RARTALLDVSALTTLREIRRAHKPPAYWKQPGIRDTVARALLQELERAIGTLAKPCHSER  444

Query  821   YPSWKSFLQAIRMYGVVIEVCPKNRQGYVRANLFIEPSRR-----VCISSTQEFLSFENI  875
             +P W++F QAI   GVVIE  P   +G VR N+F+ P+       V + STQE L     
Sbjct  445   FPDWRAFAQAIGRDGVVIEALPARVRGVVRVNIFVTPASSDHDADVPVVSTQEAL-----  499

Query  876   HENDDRARKVVFDKAFAAKMRTIGFTFPQTLIDHEVLKSASLVIGQALAKD-GICGYISV  934
                          +A A +   + F  PQTL+ H+ +  A+  IG+ L +D   CGY SV
Sbjct  500   -------------RASAGRA-PLAFACPQTLVPHDAVVGAAQAIGRLLREDYAFCGYASV  545

Query  935   DFLVILDDQTQNKILYAMALQPFLTNsaasfslfqflsRGGGYNSKTGLFHLPRAITshg  994
             D  +  D+                                      +GL+ LP       
Sbjct  546   DLQLCRDE-------------------------------------TSGLYLLP-------  561

Query  995   vtsdtpsssslsatDLMIREARLSGIVSNEL--PLTPTRSYVLLEYVCNPNVATLSYGSF  1052
               +   S+    AT L+++EA L    S  L  P    R +V +++  +PN+ T+   +F
Sbjct  562   SPAVDTSAPLSPATPLVLQEAHLLARSSRPLASPSASPRCFVSVDWAVHPNLCTMPTAAF  621

Query  1053  FQNCRSRGVYFDIER  1067
             F  CR RGV FD+ R
Sbjct  622   FLACRRRGVCFDVTR  636

>PHYSO_326799
Length=1117

 Score = 43.9 bits (102),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 70/157 (45%), Gaps = 25/157 (16%)

Query  666  IRGRNAYLVPGFPGTEDKRLAALLRIPILGLDPAKFFQM-TTHSGIKRCFKKTNANTL--  722
            I G N  +V G  G E KR+  +  I   GLD A  F + TT   I +C  KT    L  
Sbjct  237  ILGSN--MVRGVSGGERKRMTLMDEIST-GLDSAATFDIITTQRSIAKCLHKTIVIALLQ  293

Query  723  --PGSIDLYDENELIFSLAKLIAANPHQSSM----VLKLDYDPFR-TGTALVDISQLQSI  775
              P   DL+D N ++ +  ++I   P + ++     L     P R +   L+D+     +
Sbjct  294  PAPEVFDLFD-NVMVLNHGEIIYHGPREQAVPYFETLGFKCPPRRDSADFLLDLGTKMQL  352

Query  776  QV-----------LRLRTRTLDYWRQPPIQNKLIRNI  801
            +            LRL +   ++WRQ P+  +LI++I
Sbjct  353  KYQVELPAGITKHLRLASEYSEHWRQSPLSRRLIQDI  389

>CCA16530
Length=1512

 Score = 36.2 bits (82),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 26/44 (59%), Gaps = 3/44 (7%)

Query  474   VEKCTRAAMAVQSFMRMITFRRTYLLMISNHRKVRAIQQNWRRY  517
             +E+  RAA+ VQS MRM   R  Y L     R + +IQ+ WRRY
Sbjct  1302  LERKIRAAILVQSLMRMELERVEYKLQ---RRAIVSIQRCWRRY  1342

>H257_02115
Length=999

 Score = 35.8 bits (81),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 37/151 (25%), Positives = 63/151 (42%), Gaps = 34/151 (23%)

Query  1    MLRHLVSYK------------SNYSCYKGSCLELQDGMEQVEQKYHKEDVGRILLQTQQE  48
            ++ H+VSYK            S  +    + ++  D ++        E V   L      
Sbjct  59   LMVHIVSYKDYCDGNGLLSTVSRRTSRNDAIVKFVDDLKPTGGGDFPEAVKTALNHVIMT  118

Query  49   LRDIRAEISARKQAGISHVVDAHPHREDHASLANENQSKDLETLHDILDRAEREIQAKVD  108
            + DIRA +SA  +A +    DA PH   H +  + NQS+++E + D             +
Sbjct  119  VDDIRATVSATSRALVFLYTDAPPH---HQTTRSNNQSREIEAIQD-------------N  162

Query  109  LMFRGAANFGQMMQT----GLPAVT--SPPR  133
              +RG  ++ Q+ +T    G+P  T  SP R
Sbjct  163  PKYRGGHDWFQLQRTLQDLGIPVYTFHSPTR  193

>PITG_07116
Length=460

 Score = 35.0 bits (79),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 39/146 (27%), Positives = 58/146 (40%), Gaps = 27/146 (18%)

Query  676  GFPGTEDKRLAALLRIPILGLDPAKFFQMTTHSGIKRCFKKTNANTL----PGSIDLYDE  731
            G  G E KR+          +D A F  +TT   I +C  KT    L    P   +L+D 
Sbjct  225  GVSGGERKRVTTG------EMDAATFNIITTQRSIAKCLHKTIVIALLQPAPEVFNLFD-  277

Query  732  NELIFSLAKLIAANPHQSSM----VLKLDYDPFR--------TGTALVDISQLQ----SI  775
            N ++ +  +++   P   ++     L L   P R         GT +    Q++      
Sbjct  278  NVMVLNQGEIVYHGPRNHAVSYFETLGLKCPPRRDAADFLLDLGTTMQKKYQVELPMGMT  337

Query  776  QVLRLRTRTLDYWRQPPIQNKLIRNI  801
            Q  RL +   DYWRQ P+   LI  I
Sbjct  338  QPPRLASEFSDYWRQSPLYADLIGAI  363

>PHYRA_85909
Length=389

 Score = 34.7 bits (78),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 51/125 (41%), Gaps = 29/125 (23%)

Query  402  NDVWNNVEEVVTTL---ERLLSVYFIPIAHINGQRILTLSQENNKIITNRDLLSCVKNEH  458
            ND    +EEVV+ L   E LL++          QR   L    + + T       V+  H
Sbjct  159  NDALKELEEVVSRLKQEEPLLAL----------QRDRALYSTKHSVFT-----VVVEYFH  203

Query  459  EVRMLLLKPGQRFQGVEKCTRAAMAVQSFMRMITFRRTYL---LMISNHRKVRAIQQNWR  515
              R  L  P    QG  +         +F   I F R+ L   +M+   + V A+ + WR
Sbjct  204  LFRNGLRAPASSVQGEPR--------DAFQEQIVFLRSSLTPDVMLGERQGVEALIEQWR  255

Query  516  RYAAY  520
            RY+AY
Sbjct  256  RYSAY  260

Lambda      K        H        a         alpha
   0.321    0.133    0.384    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 96884489880

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40