Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
CCA17542147551201206222e-84
CCI44820147551231204991e-65
PHYCA_11834147551341213578e-44
PHYRA_95903147551341213455e-42
PHYSO_321155147551361213456e-42
PITG_18455147551321233333e-40
PYVX_18180147551351223334e-40
PHALS_06479147551361213334e-40
PHYKE_8392147551381233318e-40
PPTG_17126147551361233291e-39
PYIW_19970147551301183187e-38
PYU1_G001736147551231193161e-37
PYIR_13454147551291203124e-37
PYAP_17747147551341223134e-37
HYAP_07103147551641543061e-35
SPRG_06335147551231172771e-31
SDRG_01782147551231172717e-31
H310_09224147551231182612e-29
H257_06293147551231182561e-28
CCI442321114710555976e-05
HYAP_084991114710856890.001
CCA175211114710452870.002
HYAP_085006526017256890.002
PITG_137391114710565840.005
PHYSO_3150171114710965810.012
PHYKE_58411114712151810.013
PYAR_232071114711297810.015
PHALS_115641114710765800.020
PHYRA_816751114710665780.034
PYU1_G0059631114710351780.037
H257_07358111479847770.041
PYVX_208541114710451770.043
PPTG_092521114710565770.045
PYVX_151505606474667790.061
H310_07567111479854740.097
PYIW_147431114710550740.11
PHYCA_5353801114710865710.37
CCA258361570549517690.55
PYIR_151861114710950690.60
PYAP_228461114710451671.3
PYU1_G0005451192611558671.4
PYU1_G011200593711463661.7
PYU1_G013186793911453652.6
PPTG_017381839221273662.6
PYAP_21260263214036652.7
SDRG_149121114710542643.1
SPRG_128831114710542643.3
PYAR_20313952374044663.6
H310_0223565269962634.3
PYIW_142931416310445625.3
PHYSO_5285746009655460645.6
PYVX_195762168129752646.1
H257_1840614700460755637.6
H310_0186314700464555637.8
PYAP_21641593711754618.3
PHYSO_473132251730939629.4
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= CCA17542

Length=120
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

CCA17542                                                              244        2e-84
CCI44820                                                              196        1e-65
PHYCA_11834                                                           142        8e-44
PHYRA_95903                                                           137        5e-42
PHYSO_321155                                                          137        6e-42
PITG_18455                                                            132        3e-40
PYVX_18180                                                            132        4e-40
PHALS_06479                                                           132        4e-40
PHYKE_8392                                                            132        8e-40
PPTG_17126                                                            131        1e-39
PYIW_19970                                                            127        7e-38
PYU1_G001736                                                          126        1e-37
PYIR_13454                                                            124        4e-37
PYAP_17747                                                            125        4e-37
HYAP_07103                                                            122        1e-35
SPRG_06335                                                            111        1e-31
SDRG_01782                                                            108        7e-31
H310_09224                                                            105        2e-29
H257_06293                                                            103        1e-28
CCI44232                                                              42.0       6e-05
HYAP_08499                                                            38.9       0.001
CCA17521                                                              38.1       0.002
HYAP_08500                                                            38.9       0.002
PITG_13739                                                            37.0       0.005
PHYSO_315017                                                          35.8       0.012
PHYKE_5841                                                            35.8       0.013
PYAR_23207                                                            35.8       0.015
PHALS_11564                                                           35.4       0.020
PHYRA_81675                                                           34.7       0.034
PYU1_G005963                                                          34.7       0.037
H257_07358                                                            34.3       0.041
PYVX_20854                                                            34.3       0.043
PPTG_09252                                                            34.3       0.045
PYVX_15150                                                            35.0       0.061
H310_07567                                                            33.1       0.097
PYIW_14743                                                            33.1       0.11 
PHYCA_535380                                                          32.0       0.37 
CCA25836                                                              31.2       0.55 
PYIR_15186                                                            31.2       0.60 
PYAP_22846                                                            30.4       1.3  
PYU1_G000545                                                          30.4       1.4  
PYU1_G011200                                                          30.0       1.7  
PYU1_G013186                                                          29.6       2.6  
PPTG_01738                                                            30.0       2.6  
PYAP_21260                                                            29.6       2.7  
SDRG_14912                                                            29.3       3.1  
SPRG_12883                                                            29.3       3.3  
PYAR_20313                                                            30.0       3.6  
H310_02235                                                            28.9       4.3  
PYIW_14293                                                            28.5       5.3  
PHYSO_528574                                                          29.3       5.6  
PYVX_19576                                                            29.3       6.1  
H257_18406                                                            28.9       7.6  
H310_01863                                                            28.9       7.8  
PYAP_21641                                                            28.1       8.3  
PHYSO_473132                                                          28.5       9.4  

>CCA17542
Length=120

 Score = 244 bits (622),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 120/120 (100%), Positives = 120/120 (100%), Gaps = 0/120 (0%)

Query  1    MSDTRSIYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTIGYL  60
            MSDTRSIYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTIGYL
Sbjct  1    MSDTRSIYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTIGYL  60

Query  61   KIVTPHKRSDSGVKRFMFKDGERIEENLKASERARFKVQDIGEGLKRHHQLLRRQHFMDR  120
            KIVTPHKRSDSGVKRFMFKDGERIEENLKASERARFKVQDIGEGLKRHHQLLRRQHFMDR
Sbjct  61   KIVTPHKRSDSGVKRFMFKDGERIEENLKASERARFKVQDIGEGLKRHHQLLRRQHFMDR  120

>CCI44820
Length=123

 Score = 196 bits (499),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 111/120 (93%), Gaps = 0/120 (0%)

Query  1    MSDTRSIYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTIGYL  60
            +++TR I+K++++LAKSLP EKQA TLLNIR EFRKHRDI DP QL+QLLERAQSTIGYL
Sbjct  4    VNETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTIGYL  63

Query  61   KIVTPHKRSDSGVKRFMFKDGERIEENLKASERARFKVQDIGEGLKRHHQLLRRQHFMDR  120
            KIVTPHKRSDSGVK F++KDGERIE++L+A E+A+FKVQD+ EGLKRH+QL+RRQ+FMDR
Sbjct  64   KIVTPHKRSDSGVKHFVYKDGERIEKSLQAGEKAKFKVQDMEEGLKRHNQLIRRQYFMDR  123

>PHYCA_11834
Length=134

 Score = 142 bits (357),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 94/121 (78%), Gaps = 3/121 (2%)

Query  3    DTRSIYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTIGYLKI  62
            + R +YK+L+RLA+SLP  K+  ++  IR EFR H D++DP ++S+LL+RAQS++GYLKI
Sbjct  5    ELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGYLKI  64

Query  63   VTPHKRSDSGVKRFMFKDGERI---EENLKASERARFKVQDIGEGLKRHHQLLRRQHFMD  119
            VTP   S++GV+RF+++DG+R+   E   K  E AR+K QD+  GLKRHHQLLRRQ+FMD
Sbjct  65   VTPRAESNTGVQRFIYRDGKRVNAEELEGKGEENARWKTQDMEAGLKRHHQLLRRQYFMD  124

Query  120  R  120
            R
Sbjct  125  R  125

>PHYRA_95903
Length=134

 Score = 137 bits (345),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 91/121 (75%), Gaps = 3/121 (2%)

Query  3    DTRSIYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTIGYLKI  62
            + R +YK+L+RLA+SLP  K+  +L  IR EFR H +++DP ++S L++RAQS++GYLKI
Sbjct  5    ELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLGYLKI  64

Query  63   VTPHKRSDSGVKRFMFKDGERI---EENLKASERARFKVQDIGEGLKRHHQLLRRQHFMD  119
            VTP   S+ G++R+++++G+R+   E      E AR+K QDI  GLKRHHQLLRRQHFMD
Sbjct  65   VTPRAESNKGIQRYIYRNGQRVNADEVEAHGEENARYKTQDIEGGLKRHHQLLRRQHFMD  124

Query  120  R  120
            R
Sbjct  125  R  125

>PHYSO_321155
Length=136

 Score = 137 bits (345),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 91/121 (75%), Gaps = 3/121 (2%)

Query  3    DTRSIYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTIGYLKI  62
            + R +YK+L+RLA+SLP  K+  +L  IR EFR H D++DP  +S L++RAQS++ YLKI
Sbjct  7    ELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSSLSYLKI  66

Query  63   VTPHKRSDSGVKRFMFKDGERI---EENLKASERARFKVQDIGEGLKRHHQLLRRQHFMD  119
            VTP   S++GV+RF++++G+R+   E   K  E AR+K QDI  GLKRHHQLLRRQ+FMD
Sbjct  67   VTPRGESNTGVQRFIYRNGQRVNAAEFEAKGEENARYKTQDIEAGLKRHHQLLRRQYFMD  126

Query  120  R  120
            R
Sbjct  127  R  127

>PITG_18455
Length=132

 Score = 132 bits (333),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 95/123 (77%), Gaps = 3/123 (2%)

Query  1    MSDTRSIYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTIGYL  60
            MS+ R +YK+L+RLA+SLP  K+ +++  IR +FR H D +DP ++S L++RAQS++ YL
Sbjct  1    MSELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYL  60

Query  61   KIVTPHKRSDSGVKRFMFKDGERI---EENLKASERARFKVQDIGEGLKRHHQLLRRQHF  117
            KIVTP   S++GV+R+++++G+R+   E   K  E AR+K+QD+  GLKRHHQLL+RQ+F
Sbjct  61   KIVTPRAESNTGVQRYIYRNGQRVNAAEFEEKGVENARWKMQDMEGGLKRHHQLLQRQYF  120

Query  118  MDR  120
            M+R
Sbjct  121  MNR  123

>PYVX_18180
Length=135

 Score = 132 bits (333),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 91/122 (75%), Gaps = 3/122 (2%)

Query  2    SDTRSIYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTIGYLK  61
            ++ R +YK+L+RLA+SLP  K+A+T+  IRTEFR H +++D  ++++LL+RAQS +GYLK
Sbjct  5    AELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQLGYLK  64

Query  62   IVTPHKRSDSGVKRFMFKDGERI---EENLKASERARFKVQDIGEGLKRHHQLLRRQHFM  118
            IVTP   S SGVKR+++++G+R+          + AR+K  D+   LKRHHQLLRRQHFM
Sbjct  65   IVTPRGPSASGVKRYIYRNGQRVDADAAEAAGEDGARYKTPDMEGALKRHHQLLRRQHFM  124

Query  119  DR  120
            DR
Sbjct  125  DR  126

>PHALS_06479
Length=136

 Score = 132 bits (333),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 92/121 (76%), Gaps = 3/121 (2%)

Query  3    DTRSIYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTIGYLKI  62
            + R +YK+L+RLA++LP  K+ +++  IR EFR H D++DP ++S+ ++RAQS++ YLKI
Sbjct  7    ELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSYLKI  66

Query  63   VTPHKRSDSGVKRFMFKDGERIEE---NLKASERARFKVQDIGEGLKRHHQLLRRQHFMD  119
            +TP   S++GV+RF++++G+R+       K +E AR+K QD+  G KRHHQLLRRQ+FMD
Sbjct  67   ITPRTESNTGVQRFIYRNGQRVNAADFEKKGNENARWKTQDMEAGYKRHHQLLRRQYFMD  126

Query  120  R  120
            R
Sbjct  127  R  127

>PHYKE_8392
Length=138

 Score = 132 bits (331),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 92/123 (75%), Gaps = 5/123 (4%)

Query  3    DTRSIYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTIGYLKI  62
            + R +YK+L+R+A++LP  K+  +L  IR EFR H D+SDP ++S+LL+ AQS++ YLKI
Sbjct  7    ELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEVSKLLQLAQSSLSYLKI  66

Query  63   VTP--HKRSDSGVKRFMFKDGERI---EENLKASERARFKVQDIGEGLKRHHQLLRRQHF  117
            VTP     S+SGV+R+++++G+R+   E   K  E AR+K QD+  GLKRHHQL+RRQHF
Sbjct  67   VTPRDETESNSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQLMRRQHF  126

Query  118  MDR  120
            MDR
Sbjct  127  MDR  129

>PPTG_17126
Length=136

 Score = 131 bits (329),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 93/123 (76%), Gaps = 3/123 (2%)

Query  1    MSDTRSIYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTIGYL  60
            M + R +YK+L+RLA+SLP  K+ +++  IR +FR H D++DP ++S L++RAQS++ YL
Sbjct  5    MRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLSYL  64

Query  61   KIVTPHKRSDSGVKRFMFKDGERI---EENLKASERARFKVQDIGEGLKRHHQLLRRQHF  117
            KIVTP   S+ GV+R+++++G+R+   E   K  E AR+K QD+  GL+RHHQLLRRQ+F
Sbjct  65   KIVTPRAESNMGVQRYIYRNGQRVNADEFEEKGEENARWKTQDMEGGLRRHHQLLRRQYF  124

Query  118  MDR  120
            +DR
Sbjct  125  LDR  127

>PYIW_19970
Length=130

 Score = 127 bits (318),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 86/118 (73%), Gaps = 0/118 (0%)

Query  3    DTRSIYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTIGYLKI  62
            D R +YK+L++LAK+LP  K+  T   IR+EFR  +++SDP +L+ LL RAQS+I YLKI
Sbjct  12   DLRPVYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKI  71

Query  63   VTPHKRSDSGVKRFMFKDGERIEENLKASERARFKVQDIGEGLKRHHQLLRRQHFMDR  120
            VTP K SD+GVK +++K+G+R+E      + A++++ D    + RH +LLRRQHFMDR
Sbjct  72   VTPRKSSDAGVKNYIYKNGQRVEAAAVMEDGAKYQLPDYNGQMLRHQKLLRRQHFMDR  129

>PYU1_G001736
Length=123

 Score = 126 bits (316),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 85/119 (71%), Gaps = 0/119 (0%)

Query  2    SDTRSIYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTIGYLK  61
            SD R +YK+L++LA++LPA+K+  T+  IR EFR H    DP +++ LL RAQS+IGYLK
Sbjct  4    SDLRPMYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGYLK  63

Query  62   IVTPHKRSDSGVKRFMFKDGERIEENLKASERARFKVQDIGEGLKRHHQLLRRQHFMDR  120
            IVTP   SD+GVK +++  G+R+E    A + AR+K  D    ++RH QLLRRQHFMDR
Sbjct  64   IVTPRATSDAGVKNYVYIKGKRVEAAGAAEDGARYKTADYNAQMQRHVQLLRRQHFMDR  122

>PYIR_13454
Length=129

 Score = 124 bits (312),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 90/120 (75%), Gaps = 0/120 (0%)

Query  1    MSDTRSIYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTIGYL  60
            + D R +YK+L++LAK+LP  K+ ATL  IR+EFR  +D+SDP +L+ LL RAQS+IGYL
Sbjct  9    LGDLRPVYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSIGYL  68

Query  61   KIVTPHKRSDSGVKRFMFKDGERIEENLKASERARFKVQDIGEGLKRHHQLLRRQHFMDR  120
            KIVTP K SD+GVK +++K+G+R+E      + A++ + D    ++RH +LLRRQHFMDR
Sbjct  69   KIVTPRKSSDAGVKNYIYKNGQRVEATSVLEDGAKYSIPDYNAQMQRHQKLLRRQHFMDR  128

>PYAP_17747
Length=134

 Score = 125 bits (313),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 90/122 (74%), Gaps = 3/122 (2%)

Query  2    SDTRSIYKRLIRLAKSLPAE-KQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTIGYL  60
            S+ R +YKRL+RLAKSLP E K+ AT+  IR+EFR  +D  DP +++ L++RAQ+ IGYL
Sbjct  4    SELRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIGYL  63

Query  61   KIVTPHKRSDSGVKRFMFKDGERIEENLKAS--ERARFKVQDIGEGLKRHHQLLRRQHFM  118
            KIVTP   +D+GVK F++ +G+R++ +   +  E AR+K  D    ++RH+QLLRRQHFM
Sbjct  64   KIVTPRSTADAGVKSFVYVNGKRVDSSDVQTREEGARYKTIDFEGNMRRHNQLLRRQHFM  123

Query  119  DR  120
            DR
Sbjct  124  DR  125

>HYAP_07103
Length=164

 Score = 122 bits (306),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 91/154 (59%), Gaps = 38/154 (25%)

Query  5    RSIYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTIGYLKIVT  64
            R +YK+L+RLA+SLP  K+  +L  IR EFR H D++DP ++S LL+RAQS+I +LKIVT
Sbjct  2    RPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKIVT  61

Query  65   PHKR-----------------------------------SDSGVKRFMFKDGERI---EE  86
            P                                      SD+G++RF+++DG+RI   E 
Sbjct  62   PRAESGGFMASLAFSIMCLTLSLFSVLLLLLHHYFSCFFSDTGIQRFVYRDGKRIDAAEL  121

Query  87   NLKASERARFKVQDIGEGLKRHHQLLRRQHFMDR  120
              K  E AR+K QDI  G+KRHHQLLRRQHFMDR
Sbjct  122  KKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDR  155

>SPRG_06335
Length=123

 Score = 111 bits (277),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 78/117 (67%), Gaps = 1/117 (1%)

Query  5    RSIYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTIGYLKIVT  64
            R+ YK+L++LAKS+P E++A TL  +RTEFR H   + P +L QLL +AQS I YLKIVT
Sbjct  6    RAAYKKLLKLAKSVPQEQRAQTLEKVRTEFRAHTGAATPEELDQLLRKAQSKISYLKIVT  65

Query  65   PHKRSDSGV-KRFMFKDGERIEENLKASERARFKVQDIGEGLKRHHQLLRRQHFMDR  120
            P K    G    F++K+G+RI+    +++ A  K  D    + +H QL+RRQHFMDR
Sbjct  66   PKKSPSPGQGNHFVYKNGQRIDGRELSADSATIKTADYNAMMTKHVQLVRRQHFMDR  122

>SDRG_01782
Length=123

 Score = 108 bits (271),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 78/117 (67%), Gaps = 1/117 (1%)

Query  5    RSIYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTIGYLKIVT  64
            R+ YK+L++LAKS+P E++A TL  +R EFR H   + P +L QLL +AQS I YLKIVT
Sbjct  6    RAAYKKLLKLAKSVPQEQRAQTLEKVRHEFRAHEGAATPEELDQLLRKAQSKISYLKIVT  65

Query  65   PHKRSDSGV-KRFMFKDGERIEENLKASERARFKVQDIGEGLKRHHQLLRRQHFMDR  120
            P K S S     F++K+G+RI+    +++ A  K  D    + +H QL+RRQHFMDR
Sbjct  66   PKKSSSSTQGSHFVYKNGQRIDGRELSADSATIKTHDYNAMMTKHVQLVRRQHFMDR  122

>H310_09224
Length=123

 Score = 105 bits (261),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 78/118 (66%), Gaps = 1/118 (1%)

Query  4    TRSIYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTIGYLKIV  63
             R+ YK+LI+LA+SLPAE++   L  +R EFR H  I+   QL +++ +AQS I YLKIV
Sbjct  5    VRTAYKKLIKLAQSLPAEQKPVALDKVRHEFRSHGVITSSDQLDKIVMKAQSKISYLKIV  64

Query  64   TPHKRSDSGVKRFMFKDGERIEEN-LKASERARFKVQDIGEGLKRHHQLLRRQHFMDR  120
            TP +   +  +R+++KDG+R++   +  S  A  K  D    ++RH +L+RRQHFMDR
Sbjct  65   TPKRAPQTSPQRYIYKDGKRLDPGCIDQSTNATIKTVDFNAMMERHVKLVRRQHFMDR  122

>H257_06293
Length=123

 Score = 103 bits (256),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 79/118 (67%), Gaps = 1/118 (1%)

Query  4    TRSIYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTIGYLKIV  63
             R+ YK+LI+LA+SLPA+++   L  IR +FR    IS   +L +L+ +AQS I YLKIV
Sbjct  5    VRTAYKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEELDKLVMKAQSKISYLKIV  64

Query  64   TPHKRSDSGVKRFMFKDGERIE-ENLKASERARFKVQDIGEGLKRHHQLLRRQHFMDR  120
            TP +   SG +RF++KDG+R++ ++L        K  D+   ++RH +L+RRQHFMDR
Sbjct  65   TPKRTPQSGPQRFIYKDGKRLDSQSLDDGGNRTIKTTDVNAMMERHVKLIRRQHFMDR  122

>CCI44232
Length=105

 Score = 42.0 bits (97),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 35/55 (64%), Gaps = 0/55 (0%)

Query  6   SIYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTIGYL  60
            +Y+R++RLA+  P+ K+ A + +IR EFR+ R+I+ P  + Q +  A + I  L
Sbjct  8   GLYRRILRLARRYPSIKRDAIVEDIRLEFRESRNIARPAAIEQKIASANAGIKEL  62

>HYAP_08499
Length=108

 Score = 38.9 bits (89),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 38/56 (68%), Gaps = 0/56 (0%)

Query  7   IYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTIGYLKI  62
           +Y+R+++LA+  P+ K+ + + +I++EFR +R++SD  ++ + L   Q+ I  L +
Sbjct  10  MYRRILKLAQRYPSIKRQSIICDIKSEFRANRNLSDAQKVRKELAVVQAGIKELSM  65

>CCA17521
Length=104

 Score = 38.1 bits (87),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 32/52 (62%), Gaps = 0/52 (0%)

Query  6   SIYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTI  57
            +Y+R++RLA+  P+ K+ A + +IR EFR+ RDI+    +   +  A + I
Sbjct  8   GLYRRILRLARRYPSIKRDAIINDIRMEFRESRDITTAAIIDHKIASANAGI  59

>HYAP_08500
Length=172

 Score = 38.9 bits (89),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 38/56 (68%), Gaps = 0/56 (0%)

Query  7    IYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTIGYLKI  62
            +Y+R+++LA+  P+ K+ + + +I++EFR +R++SD  ++ + L   Q+ I  L +
Sbjct  74   MYRRILKLAQRYPSIKRQSIICDIKSEFRANRNLSDAQKVRKELAVVQAGIKELSM  129

>PITG_13739
Length=105

 Score = 37.0 bits (84),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 18/65 (28%), Positives = 42/65 (65%), Gaps = 3/65 (5%)

Query  1   MSDTRSI---YKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTI  57
           M++TR +   Y+R+++LA+  P+ K+ + + +I+TEF  ++D++D  ++ + L   ++ I
Sbjct  1   MAETREVLRMYRRILKLAQRYPSIKRESIIRDIKTEFHANKDLTDAQKIREELASVRAGI  60

Query  58  GYLKI  62
             L +
Sbjct  61  TELSM  65

>PHYSO_315017
Length=109

 Score = 35.8 bits (81),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 42/65 (65%), Gaps = 3/65 (5%)

Query  1   MSDTRSI---YKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTI  57
           M++T+ +   Y+R+++LA+  P+ K+ + + +I+TEF  ++D++D  ++ + L   ++ I
Sbjct  1   MAETKEVLRMYRRILKLAQRYPSVKRESIIRDIKTEFHANKDLTDAQKIREELASVRAGI  60

Query  58  GYLKI  62
             L +
Sbjct  61  KELSM  65

>PHYKE_5841
Length=121

 Score = 35.8 bits (81),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 35/51 (69%), Gaps = 0/51 (0%)

Query  7   IYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTI  57
           +Y+R+++LA+  P+ K+ + + +I+TEF  H+ ++D  ++ + L  A++ I
Sbjct  10  MYRRILKLAQRYPSVKRDSIIRDIKTEFHAHKGLTDAQKIREELASARAGI  60

>PYAR_23207
Length=112

 Score = 35.8 bits (81),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 24/97 (25%), Positives = 51/97 (53%), Gaps = 3/97 (3%)

Query  7    IYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTIGYLKIVTPH  66
            +Y+R+++LAK  P+ K+ A + +I+ EF + + ++D T +   +  AQ+ I   K ++ +
Sbjct  13   LYRRVLQLAKQYPSIKRDALVEDIKLEFHEAKHLTDATAIEHKIAAAQAGI---KELSQY  69

Query  67   KRSDSGVKRFMFKDGERIEENLKASERARFKVQDIGE  103
                S    +    G  +E    ASE+ +   + +G+
Sbjct  70   ASLRSDAMSWTVDVGREVEPRQPASEKEQPTFKVVGD  106

>PHALS_11564
Length=107

 Score = 35.4 bits (80),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 18/65 (28%), Positives = 39/65 (60%), Gaps = 3/65 (5%)

Query  1   MSDTRSI---YKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTI  57
           M++T+ +   Y+RL++LA+  P+ K+ A + +I+ EF  +  I+D  ++ + +  A + I
Sbjct  1   MAETKQVLRVYRRLLKLAQHYPSIKREAIIRDIKEEFHANAIITDAQKICEAMASAHAGI  60

Query  58  GYLKI  62
             L +
Sbjct  61  KELSM  65

>PHYRA_81675
Length=106

 Score = 34.7 bits (78),  Expect = 0.034, Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 42/65 (65%), Gaps = 3/65 (5%)

Query  1   MSDTRSI---YKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTI  57
           M++T+ +   Y+R+++LA+  P+ K+A+ + +I+TEF  ++ ++D  ++ + L   ++ I
Sbjct  1   MAETKEVVRMYRRILKLAQRYPSIKRASIIRDIKTEFHANKHLTDAQKIREELASVRAGI  60

Query  58  GYLKI  62
             L +
Sbjct  61  KELSM  65

>PYU1_G005963
Length=103

 Score = 34.7 bits (78),  Expect = 0.037, Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 34/51 (67%), Gaps = 0/51 (0%)

Query  7   IYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTI  57
           IY+R+++LA   P+ K+ A + +I+ EFR+++ ++D + +   ++ A+  I
Sbjct  10  IYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGI  60

>H257_07358
Length=98

 Score = 34.3 bits (77),  Expect = 0.041, Method: Compositional matrix adjust.
 Identities = 14/47 (30%), Positives = 31/47 (66%), Gaps = 0/47 (0%)

Query  7   IYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERA  53
           IY+R+++LA   P+ KQ   + +I+ EF +++ ++DP ++ + +  A
Sbjct  10  IYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDPAKIKEKINIA  56

>PYVX_20854
Length=104

 Score = 34.3 bits (77),  Expect = 0.043, Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 36/51 (71%), Gaps = 0/51 (0%)

Query  7   IYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTI  57
           +Y+R+++LA+  P+ K+ + + +I+TEF +++ +SD  Q+ + +  A++ I
Sbjct  10  LYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGI  60

>PPTG_09252
Length=105

 Score = 34.3 bits (77),  Expect = 0.045, Method: Compositional matrix adjust.
 Identities = 16/65 (25%), Positives = 42/65 (65%), Gaps = 3/65 (5%)

Query  1   MSDTRSI---YKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTI  57
           M++T+ +   Y+R+++LA+  P+ K+ + + +I+TEF  +++++D  ++ + L   ++ I
Sbjct  1   MAETKEVLRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGI  60

Query  58  GYLKI  62
             L +
Sbjct  61  TELSM  65

>PYVX_15150
Length=746

 Score = 35.0 bits (79),  Expect = 0.061, Method: Composition-based stats.
 Identities = 21/67 (31%), Positives = 36/67 (54%), Gaps = 4/67 (6%)

Query  14   LAKSL--PAEKQAATLLNIRTEFRKHRDISDPTQLSQLLE--RAQSTIGYLKIVTPHKRS  69
            LAK L  P+   A  +L     FR   D S+  ++  +LE  R+  ++ YL +V P ++ 
Sbjct  592  LAKELARPSSLVAQNVLCWSYSFRSEADTSESGRVEGILEMLRSNCSLQYLSLVMPREQH  651

Query  70   DSGVKRF  76
            D+ ++RF
Sbjct  652  DASLERF  658

>H310_07567
Length=98

 Score = 33.1 bits (74),  Expect = 0.097, Method: Compositional matrix adjust.
 Identities = 16/54 (30%), Positives = 33/54 (61%), Gaps = 0/54 (0%)

Query  7   IYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTIGYL  60
           IY+R+++LAK  P+ K+   + +I+ EF  ++ ++DP ++ + +  A   I  L
Sbjct  10  IYRRVLQLAKKFPSIKRDQLVEDIKAEFHDNKVLTDPVKIKEKVNIAIKGIQQL  63

>PYIW_14743
Length=105

 Score = 33.1 bits (74),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 34/50 (68%), Gaps = 3/50 (6%)

Query  7   IYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQST  56
           +Y+R+++LA   P+ K++A +  I+ EF +++ ++D    +++L++ QS 
Sbjct  10  LYRRILKLAAQYPSIKRSAIIREIKIEFHQNKTLTDS---AKILDKVQSA  56

>PHYCA_535380
Length=108

 Score = 32.0 bits (71),  Expect = 0.37, Method: Compositional matrix adjust.
 Identities = 16/65 (25%), Positives = 40/65 (62%), Gaps = 3/65 (5%)

Query  1   MSDTRSI---YKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTI  57
           M++T+ +   Y+R+++LA   P+ K+ + + +I+TEF  ++ ++D  ++ + L   ++ I
Sbjct  1   MAETKEVLRMYRRILKLAHRYPSIKRESIIRDIKTEFHANKSLTDAQRIREELASVRAGI  60

Query  58  GYLKI  62
             L +
Sbjct  61  KELSM  65

>CCA25836
Length=95

 Score = 31.2 bits (69),  Expect = 0.55, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)

Query  1   MSDTRSIYKRLIRLAKS  17
           M+DT SIYKRLIRLAK 
Sbjct  3   MNDTLSIYKRLIRLAKG  19

>PYIR_15186
Length=109

 Score = 31.2 bits (69),  Expect = 0.60, Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 32/50 (64%), Gaps = 3/50 (6%)

Query  7   IYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQST  56
           +Y+R+++LA   P+ K+ A +  I+ EF  ++ ++D    +++L++ QS 
Sbjct  10  VYRRILKLAAQYPSIKRNAIIREIKLEFHANKHLTDN---AKILDKVQSA  56

>PYAP_22846
Length=104

 Score = 30.4 bits (67),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 30/51 (59%), Gaps = 0/51 (0%)

Query  7   IYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTI  57
           +Y+ +++LAK  P+ K+ A + +I+ EF + +  +D   +   +  AQ+ I
Sbjct  10  LYRHILKLAKQYPSVKRDAIIQDIKLEFHEGKHATDARTIQHKIAAAQAGI  60

>PYU1_G000545
Length=115

 Score = 30.4 bits (67),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 16/58 (28%), Positives = 32/58 (55%), Gaps = 1/58 (2%)

Query  7   IYKRLIRLAKSLPAEKQAATL-LNIRTEFRKHRDISDPTQLSQLLERAQSTIGYLKIV  63
           +Y+ L+R+A++ P     A L  N R   R  RD +  T+++Q L+  + T+   +++
Sbjct  11  LYRELLRVARAFPERSMGAKLQYNTRELIRLRRDETSATKIAQFLQEGRDTLRMYQLL  68

>PYU1_G011200
Length=114

 Score = 30.0 bits (66),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 15/63 (24%), Positives = 32/63 (51%), Gaps = 5/63 (8%)

Query  4   TRSIYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERA----QSTIGY  59
            R +Y+R + + K  P          ++T F K+RD++DP ++ + + +     Q  IG 
Sbjct  5   VRDLYRRFLHVGKDYPL-GLPYVREKVKTAFLKNRDLTDPLEIKKAIHKGRWMVQEMIGV  63

Query  60  LKI  62
           +++
Sbjct  64  IQL  66

>PYU1_G013186
Length=114

 Score = 29.6 bits (65),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 32/53 (60%), Gaps = 2/53 (4%)

Query  1   MSDTRSIYKRLIRLAKSLPAE--KQAATLLNIRTEFRKHRDISDPTQLSQLLE  51
           M++ R++Y+R++R+A++      +Q       RT F + R I+D  ++ +L++
Sbjct  1   MAEARALYRRVLRVARTWEGGYVEQQWIRREARTRFEEQRAITDARRIRELVQ  53

>PPTG_01738
Length=212

 Score = 30.0 bits (66),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 34/73 (47%), Gaps = 9/73 (12%)

Query  39   DISDPTQLSQLLERAQSTIGYLKIVTP-------HKRSDSGVKRFMFKDGERIEENL--K  89
            D   P ++  LLER ++T+G    VTP        +   + VKR+  K  E  E  L  +
Sbjct  18   DARSPNEMKHLLERFRATLGKNVTVTPTVTIRSLDRVWTAFVKRWNLKGCEAYESMLQRR  77

Query  90   ASERARFKVQDIG  102
             ++ AR  V D+ 
Sbjct  78   EADHARLSVGDLA  90

>PYAP_21260
Length=140

 Score = 29.6 bits (65),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 15/36 (42%), Positives = 22/36 (61%), Gaps = 4/36 (11%)

Query  19  PAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQ  54
           PAE +    L+I+  FRKH D+ DP  L  L+++A 
Sbjct  44  PAEAR----LSIQALFRKHADVKDPRVLDMLIKKAN  75

>SDRG_14912
Length=105

 Score = 29.3 bits (64),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 11/42 (26%), Positives = 28/42 (67%), Gaps = 0/42 (0%)

Query  7   IYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQ  48
           IY+R+++LA+  P+ K+   + +I+ EF ++  ++D  ++ +
Sbjct  9   IYRRVLKLAQRFPSIKKDQLVADIKAEFHENASLTDAAKIQE  50

>SPRG_12883
Length=105

 Score = 29.3 bits (64),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 11/42 (26%), Positives = 28/42 (67%), Gaps = 0/42 (0%)

Query  7   IYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQ  48
           IY+R+++LA+  P+ K+   + +I+ EF ++  ++D  ++ +
Sbjct  9   IYRRVLKLAQRFPSIKKDQLVADIKAEFHENASLTDAAKIQE  50

>PYAR_20313
Length=740

 Score = 30.0 bits (66),  Expect = 3.6, Method: Composition-based stats.
 Identities = 21/44 (48%), Positives = 22/44 (50%), Gaps = 2/44 (5%)

Query  68   RSDSGVKRFMFKDGERIEENLKASERARFKVQDIGEGLKRHHQL  111
            R DS V  F  KD   IE   K  E A  K Q I   +KRHHQL
Sbjct  608  REDSSVHSFAKKDSRVIEAG-KVYE-AVLKFQPISYLVKRHHQL  649

>H310_02235
Length=99

 Score = 28.9 bits (63),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 16/62 (26%), Positives = 36/62 (58%), Gaps = 1/62 (2%)

Query  6   SIYKRLIRLAKSLPAEKQAATLLN-IRTEFRKHRDISDPTQLSQLLERAQSTIGYLKIVT  64
           S+Y+++ R A  +P + +   +   +R+E+ K+R  +DP ++  L++ A + +  L+I  
Sbjct  25  SLYRKIYRTAGRMPTKDRTEFVRRRLRSEYDKYRHETDPERIEFLIKVADTQLDTLEIQV  84

Query  65  PH  66
            H
Sbjct  85  EH  86

>PYIW_14293
Length=104

 Score = 28.5 bits (62),  Expect = 5.3, Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 25/45 (56%), Gaps = 2/45 (4%)

Query  7   IYKRLIRLAKSLPAEKQAATLLN--IRTEFRKHRDISDPTQLSQL  49
           +Y+  +RLAK +    +  + +   IR EF K RD +DP ++  L
Sbjct  13  LYRDCMRLAKHIGGTSKKGSAIKDLIRREFEKARDETDPEKIEAL  57

>PHYSO_528574
Length=554

 Score = 29.3 bits (64),  Expect = 5.6, Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 31/60 (52%), Gaps = 7/60 (12%)

Query  50   LERAQSTI-------GYLKIVTPHKRSDSGVKRFMFKDGERIEENLKASERARFKVQDIG  102
            L+RA S +       G  ++ + H RS S ++  + KDG  ++ +LK   R   ++Q IG
Sbjct  316  LQRADSLLLDGVVQDGVKRMSSIHVRSASNLQLSVSKDGGIVDRDLKFESRGTLQLQPIG  375

>PYVX_19576
Length=1297

 Score = 29.3 bits (64),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 17/52 (33%), Positives = 27/52 (52%), Gaps = 5/52 (10%)

Query  70   DSGVKRFM---FKDGERIEENLKASERARFKVQDIGEGLKRHHQLLRRQHFM  118
            +SGV++       +  RI+ +  A++R   K +D  E     HQL+  QHFM
Sbjct  422  NSGVQQLATMSLSNPMRIDADASAADRPSAKTKDKAESFSTPHQLM--QHFM  471

>H257_18406
Length=607

 Score = 28.9 bits (63),  Expect = 7.6, Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 28/55 (51%), Gaps = 0/55 (0%)

Query  54   QSTIGYLKIVTPHKRSDSGVKRFMFKDGERIEENLKASERARFKVQDIGEGLKRH  108
            +ST+  + +    K+S +G      K+  +I ++L A       + D+ +GLKRH
Sbjct  295  KSTLHLVDLAGSEKQSATGATGTRLKEASQINKSLSALSNVITGLVDVSKGLKRH  349

>H310_01863
Length=645

 Score = 28.9 bits (63),  Expect = 7.8, Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 28/55 (51%), Gaps = 0/55 (0%)

Query  54   QSTIGYLKIVTPHKRSDSGVKRFMFKDGERIEENLKASERARFKVQDIGEGLKRH  108
            +ST+  + +    K+S +G      K+  +I ++L A       + D+ +GLKRH
Sbjct  330  KSTLHLVDLAGSEKQSATGTTGTRLKEASQINKSLSALSNVITGLVDVSKGLKRH  384

>PYAP_21641
Length=117

 Score = 28.1 bits (61),  Expect = 8.3, Method: Compositional matrix adjust.
 Identities = 12/54 (22%), Positives = 29/54 (54%), Gaps = 1/54 (2%)

Query  4   TRSIYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTI  57
            R +YKR + + +  P    +     ++T F K+RD+ DP ++ + +++ +  +
Sbjct  6   VRDLYKRFLFVGRDYPL-GLSYVREKVKTAFFKNRDLRDPVEIKKAVKKGRWMV  58

>PHYSO_473132
Length=309

 Score = 28.5 bits (62),  Expect = 9.4, Method: Compositional matrix adjust.
 Identities = 12/39 (31%), Positives = 22/39 (56%), Gaps = 0/39 (0%)

Query  42   DPTQLSQLLERAQSTIGYLKIVTPHKRSDSGVKRFMFKD  80
            DP+ L+Q + R  +  G+  ++   K  D G+ R ++KD
Sbjct  66   DPSPLTQTMVRHAAAGGHAHVLKWLKEHDDGLNRSLWKD  104

Lambda      K        H        a         alpha
   0.321    0.134    0.370    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3321348432

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40